ACIAD3041 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: eb7040d05b19fd2039b649c09a755c86.TrEMBL.fasta
           19 sequences; 10,313 total letters



Query= ACIAD3041

Length=794
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A0A1P8EJK1 Phenylalanine--tRNA ligase beta subunit [Acinetobact...  1379    0.0   
  A0A0M1I5J8 Phenylalanine--tRNA ligase beta subunit [Acinetobact...  1379    0.0   
  N9BXC2 Phenylalanine--tRNA ligase beta subunit [Acinetobacter s...  1376    0.0   
  N9C4H9 Phenylalanine--tRNA ligase beta subunit [Acinetobacter u...  1364    0.0   
  N9QVY0 Phenylalanine--tRNA ligase beta subunit [Acinetobacter u...  1364    0.0   
  A0A009YHD7 Phenylalanine--tRNA ligase beta subunit [Acinetobact...  1362    0.0   
  V2UUX2 Phenylalanine--tRNA ligase beta subunit [Acinetobacter b...  1360    0.0   
  A0A143IWZ5 Phenylalanine--tRNA ligase beta subunit [Acinetobact...  1359    0.0   
  A0A009QUA6 Phenylalanine--tRNA ligase beta subunit [Acinetobact...  1358    0.0   
  A0A0U1ZDM2 Phenylalanine--tRNA ligase beta subunit [uncultured ...   371    3e-118
  G3CQZ9 Phenylalanine--tRNA ligase beta subunit [uncultured bact...   211    9e-62 
  Q8RPZ7 Phenylalanyl-tRNA-synthetase beta-subunit [Azotobacter v...   193    6e-60 
  Q9K4Q4 Putative phenylalanyl-tRNA synthetase chain B [Myxococcu...  72.8    9e-18 
  G9C4N1 Phenylalanyl-tRNA synthetase beta subunit [Pasteuria pen...  68.9    3e-16 
  Q46107 Phenylalanyl-tRNA synthetase beta chain [Campylobacter j...  51.2    1e-10 
  O58271 tRNA-binding domain-containing protein [Pyrococcus horik...  48.5    4e-09 
  A0A1Q1NKL1 Tyrosine--tRNA ligase [Bombyx mori]                      49.7    4e-09 
  Q8KR35 YdjD [Lactococcus lactis subsp. cremoris]                    47.8    5e-09 
  B7U9W7 p43 protein [Hirudo medicinalis]                             47.0    2e-08 


> A0A1P8EJK1 Phenylalanine--tRNA ligase beta subunit [Acinetobacter 
soli]
Length=793

 Score = 1379 bits (3570),  Expect = 0.0
 Identities = 690/793 (87%), Positives = 744/793 (94%), Gaps = 0/793 (0%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MKISESWLRTWVNPAIDS TL DQLTMLGLEVDELAP+AKPFTGVVVGEVL+VEQHPDAD
Sbjct  1    MKISESWLRTWVNPAIDSETLTDQLTMLGLEVDELAPIAKPFTGVVVGEVLSVEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            RLRVTTVNIGNGEPLQIVCGAPN+RVGMKAPVATIGAVLPG+FKIKKGKLRGIESQGMLC
Sbjct  61   RLRVTTVNIGNGEPLQIVCGAPNVRVGMKAPVATIGAVLPGDFKIKKGKLRGIESQGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
            GASEIDLEDKIDGLLELP+DAPVG NIR+YLKLDD++IDISITPNRGDCFSIRGIAR++ 
Sbjct  121  GASEIDLEDKIDGLLELPQDAPVGTNIRDYLKLDDHVIDISITPNRGDCFSIRGIAREIG  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS  240
            V+NQL VTPP I AVE+++ EQKQVHL T+GAPRYLGR IKNVNV+A TP+WMA AL+ S
Sbjct  181  VINQLAVTPPVIAAVESSILEQKQVHLATDGAPRYLGRAIKNVNVQAQTPDWMAHALSCS  240

Query  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI  300
            GIRTHSILVD+TNYVLMELGQPMHAFDLAK++G IHVRQA+ QEKL LLN+Q VELN DI
Sbjct  241  GIRTHSILVDITNYVLMELGQPMHAFDLAKIDGDIHVRQAADQEKLVLLNEQEVELNPDI  300

Query  301  MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE  360
            MVIAD++K LAIAGIMGGL+SSVTD+T+DIFLESAFFAPLAIAGRARRFGLHTDSSQR+E
Sbjct  301  MVIADNSKALAIAGIMGGLDSSVTDETRDIFLESAFFAPLAIAGRARRFGLHTDSSQRYE  360

Query  361  RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV  420
            RGVDFELP+LAM+RAS+LIQQ+AGGEFGPI+VAE   LLPKR+ I L+Q QV  LLGY V
Sbjct  361  RGVDFELPMLAMHRASELIQQYAGGEFGPISVAEKAELLPKRDPITLHQSQVDALLGYRV  420

Query  421  ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK  480
            ETDFI DAL RLGC+V V A GEW VV PSHRFD+ IYQDLIEEVARIHGYDNIQI LPK
Sbjct  421  ETDFITDALQRLGCEVTVVATGEWHVVPPSHRFDLAIYQDLIEEVARIHGYDNIQIALPK  480

Query  481  IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL  540
            IDV+LA+YQDHLEL  LRQT+ATLGYQEAISFSFADLKLEKQLNP+VNPLALANPISSDL
Sbjct  481  IDVQLAQYQDHLELAALRQTVATLGYQEAISFSFADLKLEKQLNPNVNPLALANPISSDL  540

Query  541  AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS  600
            AVMRSTLLSSLIPCVQHNLNRQQ+RVRFFELGLRFDYQ+AASIHDLQQ PTLALIAVGS 
Sbjct  541  AVMRSTLLSSLIPCVQHNLNRQQSRVRFFELGLRFDYQHAASIHDLQQIPTLALIAVGSR  600

Query  601  VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL  660
             PE WHGK QPMDFFDLK+++EQILAAGR+ V YVRSER WLHPGQSAEIL+ GQSIGYL
Sbjct  601  TPELWHGKVQPMDFFDLKNEVEQILAAGRLNVSYVRSERVWLHPGQSAEILVDGQSIGYL  660

Query  661  GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720
            GRLHPSLEN+LDLG TWVAE+DQ+AILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI
Sbjct  661  GRLHPSLENELDLGTTWVAEIDQKAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720

Query  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE  780
            QQLIKQTGGDLLDSTWLFDVYTGQGVE+GKRSLAFALLWQHPSRTLEDAEIKSGMDNII+
Sbjct  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEQGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIQ  780

Query  781  VLENTYQATLRAS  793
            VLENTYQATLRAS
Sbjct  781  VLENTYQATLRAS  793


> A0A0M1I5J8 Phenylalanine--tRNA ligase beta subunit [Acinetobacter 
sp. C15]
Length=793

 Score = 1379 bits (3568),  Expect = 0.0
 Identities = 689/793 (87%), Positives = 743/793 (94%), Gaps = 0/793 (0%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MKISESWLRTWVNPAIDS TL DQLTMLGLEVDELAP+AKPFTGVVVGEVL+VEQHPDAD
Sbjct  1    MKISESWLRTWVNPAIDSETLTDQLTMLGLEVDELAPIAKPFTGVVVGEVLSVEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            RLRVTTVNIGNGEPLQIVCGAPN+RVGMKAPVATIGAVLPG+FKIKKGKLRGIESQGMLC
Sbjct  61   RLRVTTVNIGNGEPLQIVCGAPNVRVGMKAPVATIGAVLPGDFKIKKGKLRGIESQGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
            GASEIDLEDKIDGLLELP+DAPVG NIR+YLKLDD++IDISITPNRGDCFSIRGIAR++ 
Sbjct  121  GASEIDLEDKIDGLLELPQDAPVGTNIRDYLKLDDHVIDISITPNRGDCFSIRGIAREIG  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS  240
            V+NQL VTPP I AVE+++ EQKQVHL T+GAPRYLGR IKNVNV+A TP+WMA AL+ S
Sbjct  181  VINQLTVTPPAIAAVESSILEQKQVHLATDGAPRYLGRAIKNVNVQAQTPDWMAHALSCS  240

Query  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI  300
            GIRTHSILVD+TNYVLMELGQPMHAFDLAK++G IHVRQA+ QEKL LLN+Q VELN+DI
Sbjct  241  GIRTHSILVDITNYVLMELGQPMHAFDLAKIDGDIHVRQAADQEKLVLLNEQEVELNQDI  300

Query  301  MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE  360
            MVIAD++K LAIAGIMGGL+SSVTD+T+DIFLESAFFAPLAIAGRARRFGLHTDSSQR+E
Sbjct  301  MVIADNSKALAIAGIMGGLDSSVTDETRDIFLESAFFAPLAIAGRARRFGLHTDSSQRYE  360

Query  361  RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV  420
            RGVDFELP+LAM+RAS+LIQQ+AGGEFGPI+VAE   LLPKR+ I L+Q QV  LLGY V
Sbjct  361  RGVDFELPMLAMHRASELIQQYAGGEFGPISVAEKAELLPKRDPITLHQSQVDALLGYRV  420

Query  421  ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK  480
            ETDFI DAL RLGC+V V A GEW VV PSHRFD+ IYQDLIEEVARIHGYDNIQI LPK
Sbjct  421  ETDFITDALQRLGCEVTVVATGEWHVVPPSHRFDLAIYQDLIEEVARIHGYDNIQIALPK  480

Query  481  IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL  540
            IDV+LA+YQDHLEL  LRQT+ATLGYQEAISFSFADLKLEKQLNP VNPLALANPISSDL
Sbjct  481  IDVQLAQYQDHLELAALRQTVATLGYQEAISFSFADLKLEKQLNPKVNPLALANPISSDL  540

Query  541  AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS  600
            AVMRSTLLSSLIPCVQHNLNRQQ+RVRFFELGLRFDYQ+A SIHDLQQ PTLALIAVGS 
Sbjct  541  AVMRSTLLSSLIPCVQHNLNRQQSRVRFFELGLRFDYQHATSIHDLQQIPTLALIAVGSR  600

Query  601  VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL  660
             PE WHGK QPMDFFDLK+++EQILAAGR+ V YVRSER WLHPGQSAEIL+ GQSIGYL
Sbjct  601  TPELWHGKVQPMDFFDLKNEVEQILAAGRLNVSYVRSERVWLHPGQSAEILVDGQSIGYL  660

Query  661  GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720
            GRLHPSLEN+LDLG TWVAE+DQ+AILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI
Sbjct  661  GRLHPSLENELDLGTTWVAEIDQKAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720

Query  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE  780
            QQLIKQTGGDLLDSTWLFDVYTGQGVE+GKRSLAFALLWQHPSRTLEDAEIKSGMDNII+
Sbjct  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEQGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIQ  780

Query  781  VLENTYQATLRAS  793
            VLENTYQATLRAS
Sbjct  781  VLENTYQATLRAS  793


> N9BXC2 Phenylalanine--tRNA ligase beta subunit [Acinetobacter 
soli NIPH 2899]
Length=793

 Score = 1376 bits (3561),  Expect = 0.0
 Identities = 687/793 (87%), Positives = 744/793 (94%), Gaps = 0/793 (0%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MKISESWLRTWVNPAIDS TL DQLTMLGLEVDELAP+AKPFTGVVVGEVL+VEQHPDAD
Sbjct  1    MKISESWLRTWVNPAIDSETLTDQLTMLGLEVDELAPIAKPFTGVVVGEVLSVEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            RLRVTTVNIG+GEPLQIVCGAPN+RVGMKAPVATIGAVLPG+FKIKKGKLRGIESQGMLC
Sbjct  61   RLRVTTVNIGSGEPLQIVCGAPNVRVGMKAPVATIGAVLPGDFKIKKGKLRGIESQGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
            GASEIDLEDKIDGLLELP+DAPVG NIR+YLKLDD++IDISITPNRGDCFSIRGIAR++ 
Sbjct  121  GASEIDLEDKIDGLLELPQDAPVGTNIRDYLKLDDHVIDISITPNRGDCFSIRGIAREIG  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS  240
            V+NQL VTPP I AVE++++EQKQVHL T+GAPRYLGR IKNVNV+A TP+WMA AL+ S
Sbjct  181  VINQLTVTPPAIAAVESSISEQKQVHLATDGAPRYLGRAIKNVNVQAQTPDWMAHALSCS  240

Query  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI  300
            GIRTHSILVD+TNYVLMELGQPMHAFDLAK++G IHVRQA+ QEKL LLN+Q V+LN DI
Sbjct  241  GIRTHSILVDITNYVLMELGQPMHAFDLAKIDGDIHVRQAADQEKLVLLNEQEVKLNPDI  300

Query  301  MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE  360
            MVIAD++K LAIAGIMGGL+SSVTD+T+DIFLESAFFAPLAIAGRARRFGLHTDSSQR+E
Sbjct  301  MVIADNSKALAIAGIMGGLDSSVTDETRDIFLESAFFAPLAIAGRARRFGLHTDSSQRYE  360

Query  361  RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV  420
            RGVDFELP+LAM+RAS+LIQQ+AGGEFGPI+VAE   LLPKR+ I L+Q QV  LLGY V
Sbjct  361  RGVDFELPMLAMHRASELIQQYAGGEFGPISVAEKAELLPKRDPITLHQSQVDALLGYRV  420

Query  421  ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK  480
            ETDFI DAL RLGC+V V A GEW VV PSHRFD+ IYQDLIEEVARIHGYDNIQI LPK
Sbjct  421  ETDFITDALQRLGCEVTVVATGEWHVVPPSHRFDLAIYQDLIEEVARIHGYDNIQIALPK  480

Query  481  IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL  540
            IDV+LA+YQDHLEL  LRQT+ATLGYQEAISFSFADLKLEKQLNP VNPLALANPISSDL
Sbjct  481  IDVQLAQYQDHLELAALRQTVATLGYQEAISFSFADLKLEKQLNPKVNPLALANPISSDL  540

Query  541  AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS  600
            AVMRSTLLSSLIPCVQHNLNRQQ+RVRFFELGLRFDYQ+A+SIHDLQQ PTLALIAVGS 
Sbjct  541  AVMRSTLLSSLIPCVQHNLNRQQSRVRFFELGLRFDYQHASSIHDLQQIPTLALIAVGSR  600

Query  601  VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL  660
             PE WHGK QPMDFFDLK+++EQILAAGR+ V YVRSER WLHPGQSAEIL+ GQSIGYL
Sbjct  601  TPELWHGKVQPMDFFDLKNEVEQILAAGRLNVSYVRSERVWLHPGQSAEILVDGQSIGYL  660

Query  661  GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720
            GRLHPSLEN+LDLG TWVAE+DQ+AILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI
Sbjct  661  GRLHPSLENELDLGTTWVAEIDQKAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720

Query  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE  780
            QQLIKQTGGDLLDSTWLFDVYTGQGVE+GKRSLAFALLWQHPSRTLEDAEIKSGMDNII+
Sbjct  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEQGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIQ  780

Query  781  VLENTYQATLRAS  793
            VLENTYQATLRAS
Sbjct  781  VLENTYQATLRAS  793


> N9C4H9 Phenylalanine--tRNA ligase beta subunit [Acinetobacter 
ursingii ANC 3649]
Length=793

 Score = 1364 bits (3531),  Expect = 0.0
 Identities = 681/793 (86%), Positives = 737/793 (93%), Gaps = 0/793 (0%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MKISE+WLRTWVNPAIDS TLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD
Sbjct  1    MKISENWLRTWVNPAIDSETLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            RLRVTTVNIG+GE LQIVCGAPN+RVGMKAPVATIGAVLPG+FKIKKGKLRG+ESQGMLC
Sbjct  61   RLRVTTVNIGSGEALQIVCGAPNVRVGMKAPVATIGAVLPGDFKIKKGKLRGVESQGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
            GASEIDLEDKIDGLLELP+DAPVG+N+R+YLKLDDN+IDISITPNRGDCFSIRGIAR++ 
Sbjct  121  GASEIDLEDKIDGLLELPDDAPVGVNVRDYLKLDDNVIDISITPNRGDCFSIRGIAREIG  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS  240
            V+NQL VT P+IQA+ A + +QKQV L T+GAPRYLGR++KNVN+KA TP WM QALA S
Sbjct  181  VINQLPVTQPEIQAIAANITDQKQVQLTTDGAPRYLGRVVKNVNIKAATPAWMEQALARS  240

Query  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI  300
            G+RTHSILVD+TNYVLMELGQPMHAFDLAKL G I VRQA  QEKL LLN+Q VELN +I
Sbjct  241  GVRTHSILVDITNYVLMELGQPMHAFDLAKLQGDIQVRQAQPQEKLMLLNEQEVELNPEI  300

Query  301  MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE  360
            MVIADDAKVLAIAGIMGGLE+SVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQR+E
Sbjct  301  MVIADDAKVLAIAGIMGGLETSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRYE  360

Query  361  RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV  420
            RGVDFELP++AM+RASQLIQQ+AGGEFGPITVAE T  LP+R AIEL+Q QV  LLGY+V
Sbjct  361  RGVDFELPMIAMDRASQLIQQYAGGEFGPITVAEKTERLPQRNAIELDQAQVDALLGYQV  420

Query  421  ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK  480
              +FIADALTRLGC V VKAQG+W V+ PSHR+D+ IYQDLIEEVARIHGYDNIQIRLP+
Sbjct  421  SAEFIADALTRLGCVVTVKAQGQWSVLPPSHRYDMAIYQDLIEEVARIHGYDNIQIRLPQ  480

Query  481  IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL  540
            IDVK + YQD  E  QLRQT+ TLGYQEAISFSFADLKLEKQLNP V+PLALANPISSDL
Sbjct  481  IDVKFSAYQDGFEQDQLRQTMVTLGYQEAISFSFADLKLEKQLNPAVHPLALANPISSDL  540

Query  541  AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS  600
            AVMRSTLLSSLIPCVQ+NLNRQQNRVR FELGLRFDYQNA SIHDL+Q PTLALIAVGS 
Sbjct  541  AVMRSTLLSSLIPCVQYNLNRQQNRVRLFELGLRFDYQNAQSIHDLKQIPTLALIAVGSR  600

Query  601  VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL  660
            +PEQWH K QPMDFFDLK ++EQILAAGRV+V+YVRSER WLHPGQSAEI++ GQSIGYL
Sbjct  601  IPEQWHAKAQPMDFFDLKGEVEQILAAGRVQVDYVRSERVWLHPGQSAEIVVNGQSIGYL  660

Query  661  GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720
            GRLHPSLENDLDLGVTWVAELDQ A+LQSYVSNFTELSRFPSVRRDIALLISD INV+DI
Sbjct  661  GRLHPSLENDLDLGVTWVAELDQSAVLQSYVSNFTELSRFPSVRRDIALLISDNINVNDI  720

Query  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE  780
            QQLIKQTGGDLLDS+WLFDVYTGQGVE+GKRSLAFALLWQHPSRTLEDAEIKSGMD IIE
Sbjct  721  QQLIKQTGGDLLDSSWLFDVYTGQGVEQGKRSLAFALLWQHPSRTLEDAEIKSGMDQIIE  780

Query  781  VLENTYQATLRAS  793
            VLENTYQATLRAS
Sbjct  781  VLENTYQATLRAS  793


> N9QVY0 Phenylalanine--tRNA ligase beta subunit [Acinetobacter 
ursingii NIPH 706]
Length=793

 Score = 1364 bits (3530),  Expect = 0.0
 Identities = 683/793 (86%), Positives = 735/793 (93%), Gaps = 0/793 (0%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MKISE+WLRTWVNPAIDS TLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD
Sbjct  1    MKISENWLRTWVNPAIDSETLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            RLRVT VNIG+GE LQIVCGAPN+RVGMKAPVATIGAVLPG+FKIKKGKLRG+ESQGMLC
Sbjct  61   RLRVTKVNIGSGEALQIVCGAPNVRVGMKAPVATIGAVLPGDFKIKKGKLRGVESQGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
            GASEIDLEDKIDGLLELP+DAPVG+N+R+YLKLDDN+IDISITPNRGDCFSIRGIAR++ 
Sbjct  121  GASEIDLEDKIDGLLELPDDAPVGVNVRDYLKLDDNVIDISITPNRGDCFSIRGIAREIG  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS  240
            V+NQL VT P+IQA+ A + EQKQV L T+GAPRYLGR++KNVNVKA TP WM QALA S
Sbjct  181  VINQLPVTQPEIQAIAANITEQKQVQLTTDGAPRYLGRVVKNVNVKAATPAWMEQALARS  240

Query  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI  300
            GIRTHSILVD+TNYVLMELGQPMHAFDLAKL G I VRQA  QEKL LLN+Q VELN +I
Sbjct  241  GIRTHSILVDITNYVLMELGQPMHAFDLAKLQGDIQVRQAQPQEKLMLLNEQEVELNPEI  300

Query  301  MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE  360
            MVIADD KVLAIAGIMGGLE+SVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQR+E
Sbjct  301  MVIADDVKVLAIAGIMGGLETSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRYE  360

Query  361  RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV  420
            RGVDFELP++AM+RASQLIQQ+AGGEFGPITVAE T  LP+R +IELNQ QV  LLGY+V
Sbjct  361  RGVDFELPMIAMDRASQLIQQYAGGEFGPITVAEKTERLPQRNSIELNQAQVDALLGYQV  420

Query  421  ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK  480
              +FIADALTRLGC V VKAQG+W VV PSHR+D+ IYQDLIEEVARIHGYDNIQIRLP+
Sbjct  421  SAEFIADALTRLGCIVTVKAQGQWSVVPPSHRYDMAIYQDLIEEVARIHGYDNIQIRLPQ  480

Query  481  IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL  540
            IDVK + YQD  E  QLRQT+ TLGYQEAISFSFADLKLEKQLNP V+PLALANPISSDL
Sbjct  481  IDVKFSAYQDGFEQDQLRQTMVTLGYQEAISFSFADLKLEKQLNPAVHPLALANPISSDL  540

Query  541  AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS  600
            AVMRSTLLSSLIPCVQ+NLNRQQNRVR FELGLRFDYQNA SIHDL+Q PTLALIAVGS 
Sbjct  541  AVMRSTLLSSLIPCVQYNLNRQQNRVRLFELGLRFDYQNAQSIHDLKQIPTLALIAVGSR  600

Query  601  VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL  660
            +PEQWH K QPMDFFDLK ++EQILAAGRV+V+YVRSERAWLHPGQSAEI++ GQS GYL
Sbjct  601  IPEQWHAKAQPMDFFDLKGEVEQILAAGRVQVDYVRSERAWLHPGQSAEIVVNGQSFGYL  660

Query  661  GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720
            GRLHPSLENDLDLGVTWVAELDQ A+LQSYVSNFTELSRFPSVRRDIALLISD INV+DI
Sbjct  661  GRLHPSLENDLDLGVTWVAELDQSAVLQSYVSNFTELSRFPSVRRDIALLISDNINVNDI  720

Query  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE  780
            QQLIKQTGGDLLDS+WLFDVYTGQGVE+GKRSLAFALLWQHPSRTLEDAEIKSGMD IIE
Sbjct  721  QQLIKQTGGDLLDSSWLFDVYTGQGVEQGKRSLAFALLWQHPSRTLEDAEIKSGMDQIIE  780

Query  781  VLENTYQATLRAS  793
            VLENTYQATLRAS
Sbjct  781  VLENTYQATLRAS  793


> A0A009YHD7 Phenylalanine--tRNA ligase beta subunit [Acinetobacter 
sp. 479375]
Length=793

 Score = 1362 bits (3526),  Expect = 0.0
 Identities = 682/793 (86%), Positives = 734/793 (93%), Gaps = 0/793 (0%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MKISE+WLRTWVNPAIDS TLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD
Sbjct  1    MKISENWLRTWVNPAIDSETLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            RLRVT VNIG+GE LQIVCGAPN+RVGMKAPVATIGAVLPG+FKIKKGKLRG+ESQGMLC
Sbjct  61   RLRVTKVNIGSGEALQIVCGAPNVRVGMKAPVATIGAVLPGDFKIKKGKLRGVESQGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
            GASEIDLEDKIDGLLELP+DAPVG+N+R+YLKLDDN+IDISITPNRGDCFSIRGIAR++ 
Sbjct  121  GASEIDLEDKIDGLLELPDDAPVGVNVRDYLKLDDNVIDISITPNRGDCFSIRGIAREIG  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS  240
            V+NQL VT P+IQA+ A + EQKQV L T+GAPRYLGR++KNVNVKA TP WM QALA S
Sbjct  181  VINQLPVTQPEIQAIAANITEQKQVQLTTDGAPRYLGRVVKNVNVKAATPAWMEQALARS  240

Query  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI  300
            GIRTHSILVD+TNYVLMELGQPMHAFDLAKL G I VRQA  QEKL LLN+Q VELN +I
Sbjct  241  GIRTHSILVDITNYVLMELGQPMHAFDLAKLQGDIQVRQAQPQEKLMLLNEQEVELNPEI  300

Query  301  MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE  360
            MVIADD KVLAIAGIMGGLE+SVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQR+E
Sbjct  301  MVIADDVKVLAIAGIMGGLETSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRYE  360

Query  361  RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV  420
            RGVDFELP++AM+RASQLIQQ+AGGEFGPITVAE T  LP+R +IELNQ QV  LLGY+V
Sbjct  361  RGVDFELPMIAMDRASQLIQQYAGGEFGPITVAEKTERLPQRNSIELNQAQVDALLGYQV  420

Query  421  ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK  480
              +FIADALTRLGC V VKAQG+W VV PSHR+D+ IYQDLIEEVARIHGYDNIQIRLP+
Sbjct  421  SAEFIADALTRLGCIVTVKAQGQWSVVPPSHRYDMAIYQDLIEEVARIHGYDNIQIRLPQ  480

Query  481  IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL  540
            IDVK + YQD  E  QLRQT+ TLGYQEAISFSFADLKLEKQLNP V+PLALANPISSDL
Sbjct  481  IDVKFSAYQDGFEQDQLRQTMVTLGYQEAISFSFADLKLEKQLNPAVHPLALANPISSDL  540

Query  541  AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS  600
            AVMRSTLLSSLIPCVQ+NLNRQQNRVR FELGLRFDYQNA SIHDL+Q PTLALIAVGS 
Sbjct  541  AVMRSTLLSSLIPCVQYNLNRQQNRVRLFELGLRFDYQNAQSIHDLKQIPTLALIAVGSR  600

Query  601  VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL  660
            +PEQWH K QPMDFFDLK ++EQILAAGRV+V+YVRSERAWLHPGQSAEI++ GQS GYL
Sbjct  601  IPEQWHAKAQPMDFFDLKGEVEQILAAGRVQVDYVRSERAWLHPGQSAEIVVNGQSFGYL  660

Query  661  GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720
            GRLHPSLENDLDLGVTWVAELDQ  +LQSYVSNFTELSRFPSVRRDIALLISD INV+DI
Sbjct  661  GRLHPSLENDLDLGVTWVAELDQSTVLQSYVSNFTELSRFPSVRRDIALLISDNINVNDI  720

Query  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE  780
            QQLIKQTGGDLLDS+WLFDVYTGQGVE+GKRSLAFALLWQHPSRTLEDAEIKSGMD IIE
Sbjct  721  QQLIKQTGGDLLDSSWLFDVYTGQGVEQGKRSLAFALLWQHPSRTLEDAEIKSGMDQIIE  780

Query  781  VLENTYQATLRAS  793
            VLENTYQATLRAS
Sbjct  781  VLENTYQATLRAS  793


> V2UUX2 Phenylalanine--tRNA ligase beta subunit [Acinetobacter 
brisouii CIP 110357]
Length=793

 Score = 1360 bits (3519),  Expect = 0.0
 Identities = 685/793 (86%), Positives = 733/793 (92%), Gaps = 0/793 (0%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MKISE+WLRTWVNPAIDS TL++QLTMLGLEVDELAPVAK FTGVVVGEVLTVEQHPDAD
Sbjct  1    MKISENWLRTWVNPAIDSNTLSEQLTMLGLEVDELAPVAKAFTGVVVGEVLTVEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            RLRVTTVNIG+GEPLQIVCGAPN+RVGMKAPVATIGAVLPG+FKIKKGKLRGIES GMLC
Sbjct  61   RLRVTTVNIGSGEPLQIVCGAPNVRVGMKAPVATIGAVLPGDFKIKKGKLRGIESHGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
            GASEIDLEDKIDGLLELPEDAP+G+NIREYLKLDDN+IDISITPNRGDCFS+RGIAR++ 
Sbjct  121  GASEIDLEDKIDGLLELPEDAPIGVNIREYLKLDDNVIDISITPNRGDCFSVRGIAREIG  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS  240
            V+NQL VT P+IQ V AT+ ++K V + T+GAPRYLGRIIKNVNVKA TPEWM QAL  S
Sbjct  181  VINQLPVTQPEIQPVAATIADEKAVVVTTQGAPRYLGRIIKNVNVKAATPEWMEQALTRS  240

Query  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI  300
            G+RTHSILVD+TNYVL+ELGQPMHAFDLAKL GA+ VRQA+AQEKL LLN+Q VELNED+
Sbjct  241  GVRTHSILVDITNYVLLELGQPMHAFDLAKLEGAVQVRQATAQEKLQLLNEQEVELNEDV  300

Query  301  MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE  360
            MVIADDAK LAIAGIMGGL SSVTDDTQDIFLESAFF PLAIAGRARRFGLHTDSSQRFE
Sbjct  301  MVIADDAKALAIAGIMGGLASSVTDDTQDIFLESAFFNPLAIAGRARRFGLHTDSSQRFE  360

Query  361  RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV  420
            RGVDFELP+LAMNRASQLIQQ AGGEFGP+TVAE T LLPKREAIELNQ QV QLLGY V
Sbjct  361  RGVDFELPILAMNRASQLIQQLAGGEFGPVTVAEQTDLLPKREAIELNQAQVDQLLGYTV  420

Query  421  ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK  480
             +DFI DALTRLGC V VKAQGEW VV PSHR+D+ IYQDLIEEVARIHGYDNIQI LPK
Sbjct  421  ASDFITDALTRLGCTVTVKAQGEWSVVPPSHRYDMAIYQDLIEEVARIHGYDNIQISLPK  480

Query  481  IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL  540
            IDV+LA YQD  EL QLRQTIATLGYQEAISFSFADLKLEKQLNP+V PLALANPISSDL
Sbjct  481  IDVQLATYQDRFELAQLRQTIATLGYQEAISFSFADLKLEKQLNPNVQPLALANPISSDL  540

Query  541  AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS  600
            AVMRSTLLSSLIPCVQ+NLNRQQNRVRFFELGLRFDYQNA +I +L+Q PTLALIAVGSS
Sbjct  541  AVMRSTLLSSLIPCVQYNLNRQQNRVRFFELGLRFDYQNATNIDELKQIPTLALIAVGSS  600

Query  601  VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL  660
             PEQWH KTQPMDFFDLK ++EQILAAGRVKV+Y RS R WLHPGQSAEI+  GQSIGYL
Sbjct  601  APEQWHVKTQPMDFFDLKGEVEQILAAGRVKVQYQRSTREWLHPGQSAEIVADGQSIGYL  660

Query  661  GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720
            GRLHPSLEN+LDLG TWVAELDQ A+LQSYVSNFTELSRFPSVRRDIALLI DKI V +I
Sbjct  661  GRLHPSLENELDLGTTWVAELDQTAVLQSYVSNFTELSRFPSVRRDIALLIDDKIEVKEI  720

Query  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE  780
            QQLI+QTGG+LLDSTWLFDVYTGQGVE GKRSLAFALLWQH SRTLEDAEIKSGMD+IIE
Sbjct  721  QQLIQQTGGELLDSTWLFDVYTGQGVEAGKRSLAFALLWQHASRTLEDAEIKSGMDHIIE  780

Query  781  VLENTYQATLRAS  793
            VL+NTYQATLRAS
Sbjct  781  VLQNTYQATLRAS  793


> A0A143IWZ5 Phenylalanine--tRNA ligase beta subunit [Acinetobacter 
pittii]
Length=793

 Score = 1359 bits (3517),  Expect = 0.0
 Identities = 680/793 (86%), Positives = 730/793 (92%), Gaps = 0/793 (0%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MKISE+WLRTWVNPAIDS TL+DQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD
Sbjct  1    MKISENWLRTWVNPAIDSETLSDQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            RLRVTTVNIG+GEPLQIVCGAPN+R GMKAPVATIGAVLPG+FKIKKGKLRG+ESQGMLC
Sbjct  61   RLRVTTVNIGSGEPLQIVCGAPNVRAGMKAPVATIGAVLPGDFKIKKGKLRGVESQGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
            GASEIDLEDKIDGLLELP DAPVG+NIREYLKLDDN+IDISITPNRGDCFSIRGIAR++A
Sbjct  121  GASEIDLEDKIDGLLELPADAPVGVNIREYLKLDDNVIDISITPNRGDCFSIRGIAREIA  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS  240
            V+NQL++  PDI+ V+AT+ ++K+V + TEGAPRYLGR+IKNVNVKA TPEWM QALA S
Sbjct  181  VINQLQINEPDIKTVDATIADEKKVVISTEGAPRYLGRVIKNVNVKAATPEWMEQALARS  240

Query  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI  300
            GIRTHSILVDVTNYVLMELGQPMHAFDLAK+ G +HVRQA  QEKL LLNDQ VEL EDI
Sbjct  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKIEGTVHVRQAQPQEKLQLLNDQEVELQEDI  300

Query  301  MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE  360
            MVIADD K LAIAGIMGGL SSVTDDT DIFLESAFFAPLAIAGRARRFGLHTDSSQR+E
Sbjct  301  MVIADDQKALAIAGIMGGLASSVTDDTTDIFLESAFFAPLAIAGRARRFGLHTDSSQRYE  360

Query  361  RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV  420
            RGVDFELPL+AMNRASQLIQ+ AGGEFGPITVAE T +LPKREAIEL Q QV QLLGY+V
Sbjct  361  RGVDFELPLIAMNRASQLIQELAGGEFGPITVAEKTEILPKREAIELKQAQVDQLLGYQV  420

Query  421  ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK  480
              DFIADAL RLGC+V VKA+GEW VV PSHR+D+ IYQDLIEEVARI GYDNIQI LP 
Sbjct  421  TADFIADALNRLGCEVTVKAEGEWSVVPPSHRYDMAIYQDLIEEVARIDGYDNIQISLPS  480

Query  481  IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL  540
            +DV+LAKYQD  E+ +LRQTI TLGYQEAISFSFAD KLEKQLNP VNPL LANPISSDL
Sbjct  481  MDVQLAKYQDRFEIAELRQTIVTLGYQEAISFSFADAKLEKQLNPQVNPLMLANPISSDL  540

Query  541  AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS  600
            A MRSTLLSSLIPCVQ+NLNRQQ+RVRFFELGLRFDYQNA SI DL+Q PTLAL+AVGS 
Sbjct  541  AAMRSTLLSSLIPCVQYNLNRQQSRVRFFELGLRFDYQNAKSIEDLKQIPTLALVAVGSQ  600

Query  601  VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL  660
             PE WH K QPMDFFD K +IE+ILAAGRVKVEYVRSERAWLHPGQSAEIL+ GQSIGYL
Sbjct  601  QPESWHVKPQPMDFFDFKGEIEEILAAGRVKVEYVRSERAWLHPGQSAEILVDGQSIGYL  660

Query  661  GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720
            GRLHPSLEN+LDL  TWVAELDQ A+LQSYVSNFTELSRFPS+RRDIALLISD INV DI
Sbjct  661  GRLHPSLENELDLSTTWVAELDQTAVLQSYVSNFTELSRFPSIRRDIALLISDNINVRDI  720

Query  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE  780
            QQLI++TGG+LLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNII+
Sbjct  721  QQLIEKTGGELLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIQ  780

Query  781  VLENTYQATLRAS  793
            VLENTYQATLRAS
Sbjct  781  VLENTYQATLRAS  793


> A0A009QUA6 Phenylalanine--tRNA ligase beta subunit [Acinetobacter 
sp. 809848]
Length=793

 Score = 1358 bits (3515),  Expect = 0.0
 Identities = 680/793 (86%), Positives = 731/793 (92%), Gaps = 0/793 (0%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MKISE+WLRTWVNPAIDS TL+DQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD
Sbjct  1    MKISENWLRTWVNPAIDSETLSDQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            RLRVTTVNIG+GEPLQIVCGAPN+R GMKAPVATIGAVLPG+FKIKKGKLRG+ESQGMLC
Sbjct  61   RLRVTTVNIGSGEPLQIVCGAPNVRAGMKAPVATIGAVLPGDFKIKKGKLRGVESQGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
            GASEIDLEDKIDGLLELP DAPVG+NIREYLKLDDN+IDISITPNRGDCFSIRGIAR++A
Sbjct  121  GASEIDLEDKIDGLLELPADAPVGINIREYLKLDDNVIDISITPNRGDCFSIRGIAREIA  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS  240
            V+NQL++  PDI++VEAT+ ++K+V + TEG PRYLGR+IKNVNVKA TPEWM QALA S
Sbjct  181  VINQLQMNEPDIKSVEATIADEKKVVISTEGTPRYLGRVIKNVNVKAATPEWMEQALARS  240

Query  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI  300
            GIRTHSILVDVTNYVLMELGQPMHAFDLAK+ G +HVRQA  QEKL LLNDQ VEL EDI
Sbjct  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKIEGTVHVRQAQPQEKLQLLNDQEVELQEDI  300

Query  301  MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE  360
            MVIADD K LAIAGIMGGL SSVTDDT DIFLESAFFAPLAIAGRARRFGLHTDSSQR+E
Sbjct  301  MVIADDQKALAIAGIMGGLASSVTDDTTDIFLESAFFAPLAIAGRARRFGLHTDSSQRYE  360

Query  361  RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV  420
            RGVDFELPL+AMNRASQLIQ+ AGGEFGPITVAE T +LPKREAIEL Q QV QLLGY++
Sbjct  361  RGVDFELPLIAMNRASQLIQELAGGEFGPITVAEKTEILPKREAIELKQAQVDQLLGYQL  420

Query  421  ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK  480
              DFIADALTRLGC+V VKA+GEW VV PSHR+D+ IYQDLIEEVARI GYDNIQI LP 
Sbjct  421  TADFIADALTRLGCEVTVKAEGEWNVVPPSHRYDMAIYQDLIEEVARIDGYDNIQISLPS  480

Query  481  IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL  540
            +DV+LAKYQD  E+ +LRQTI TLGYQEAISFSFAD KLEKQLNP VNPL LANPISSDL
Sbjct  481  MDVQLAKYQDRFEIAELRQTIVTLGYQEAISFSFADAKLEKQLNPQVNPLMLANPISSDL  540

Query  541  AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS  600
            A MRSTLLSSLIPCVQ+NLNRQQ+RVRFFELGLRFDYQNA SI DL+Q PTLAL+AVGS 
Sbjct  541  AAMRSTLLSSLIPCVQYNLNRQQSRVRFFELGLRFDYQNAKSIEDLKQIPTLALVAVGSQ  600

Query  601  VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL  660
             PE WH K QPMDFFD K +IE+ILAAGRVKVEYVRSERAWLHPGQSAEIL+ GQSIGYL
Sbjct  601  QPESWHVKPQPMDFFDFKGEIEEILAAGRVKVEYVRSERAWLHPGQSAEILVDGQSIGYL  660

Query  661  GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720
            GRLHPSLEN+LDL  TWVAELDQ A+LQSYVSNFTELSRFPS+RRDIALLISD INV DI
Sbjct  661  GRLHPSLENELDLTTTWVAELDQTAVLQSYVSNFTELSRFPSIRRDIALLISDNINVRDI  720

Query  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE  780
            QQLI++TGG+LLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNII+
Sbjct  721  QQLIEKTGGELLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIQ  780

Query  781  VLENTYQATLRAS  793
            VLENTYQATLRAS
Sbjct  781  VLENTYQATLRAS  793


> A0A0U1ZDM2 Phenylalanine--tRNA ligase beta subunit [uncultured 
Rhodobacterales bacterium]
Length=797

 Score =  371 bits (952),  Expect = 3e-118
 Identities = 263/803 (33%), Positives = 406/803 (51%), Gaps = 43/803 (5%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK + SWL+  +     +  +A  LT LGLEV+ +    +      +G V     HPDAD
Sbjct  1    MKFTLSWLKRHLETTATAEEIAAALTDLGLEVESIDNPLEALKAFRLGHVTEATPHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPG-EFKIKKGKLRGIESQGML  119
            RLRV  V   +G P QI+CGAPN R G+   +AT G  +PG    I  GK+RG+ES GM+
Sbjct  61   RLRVCRVETADG-PKQIICGAPNARAGITVVIATPGDYIPGIATTIGVGKIRGVESHGMM  119

Query  120  CGASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDN-----IIDISITPNRGDCFSIRG  174
            C   E+ L D+ DG++ELP    VG    ++L  +D      +I+I++TPNR D   +RG
Sbjct  120  CSEREMGLSDEHDGIIELPSGR-VGERFTDWLAENDPAKVDPVIEIAVTPNRPDALGVRG  178

Query  175  IARDLAVLNQLEVTPPDIQAVEATLNEQKQVHLETE---GAPRYLGRIIKNVNVKATTPE  231
            IARDLA      +   D++ V A+      V ++ +   G P + GR+I+ V     +P 
Sbjct  179  IARDLAARGLGTLKAQDVEPVPASFTTDFTVTIDADTLDGCPLFCGRVIRGVK-NGPSPR  237

Query  232  WMAQALAASGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLND  291
            W+  AL A G+R  S+LVDVTN+   +  +P+H FDL K++G + V +A+  E L  L++
Sbjct  238  WLQDALRAIGLRPISLLVDVTNFFTFDRNRPLHVFDLDKISGNLRVHRAAGGETLVALDE  297

Query  292  QNVELNEDIMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGL  351
            +   L    MVI+DD    +IAGI+GGL++   D T ++F+ESA++ P+ IA   R   +
Sbjct  298  KEYALRPGQMVISDDNGPESIAGIIGGLKTGCDDSTVNVFVESAYWNPVEIALTGRALRV  357

Query  352  HTDSSQRFERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKR-EAIELNQQ  410
             +D+  RFERGVD       +  A ++I   AGG+   + VA     +PK   A  L   
Sbjct  358  VSDARYRFERGVDPAFTPEGLEHAVRMITDHAGGKASRMIVAGE---VPKTGRAYRLAPD  414

Query  411  QVSQLLGYEVETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARI--  468
            +V +L+G ++  +     L  LG     + +G+ +   PS R D+T   DL+EEVAR+  
Sbjct  415  RVRRLVGMDIPAETQRATLKALG----FRLEGD-IAHVPSWRPDVTGEADLVEEVARVAS  469

Query  469  -HGYDNIQIRLPKIDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDV  527
              G   + +  P                  R+TIA LGY E +S+SF D K  +      
Sbjct  470  LAGLKGVPLPRPAGVTGAVLTPAQRRERTARRTIAALGYSECVSYSFIDRKSAEMFGGRD  529

Query  528  NPLALANPISSDLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQ  587
             P+ L NPIS +++ MR +LL  L+     N  R    +  FE+G      +     D  
Sbjct  530  APV-LENPISGEMSHMRPSLLPGLMQAAARNQARGVADLALFEIG---PVWHGGEPED--  583

Query  588  QTPTLALIAVGSSVPEQWHGKTQPMDFFDLKHDIEQILAA-----GRVKVEYVRSERAWL  642
            Q      + VG + P    G  +PMD FD K DIE +L A     GR+     R    W 
Sbjct  584  QALVATGLLVGHTGPRDHLGSRRPMDMFDAKADIEALLGALGAPVGRLGAS--RDVNPWW  641

Query  643  HPGQSAEILIAGQSI-GYLGRLHPSLENDLDLG---VTWVAELDQQAILQSYVSNFTEL-  697
            HPG++A +L+  +++ G  G LHP +   + +    V +    D   + ++  +  + L 
Sbjct  642  HPGRAARLLLGPKTVLGAFGVLHPGVVAAMGVRGPVVAFAVHPDNIPLPRNRSTGRSALK  701

Query  698  -SRFPSVRRDIALLISDKINVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFA  756
             S   +V RD A ++   +  S +          L++   +FD +TG G+ EG++SLA +
Sbjct  702  ASDLQAVERDFAFVVDSGVAASTLVAAAAGADKALIEEVRVFDEFTGGGLGEGRKSLAIS  761

Query  757  LLWQHPSRTLEDAEIKSGMDNII  779
            +  Q   +TL D +I++    I+
Sbjct  762  VRLQPTDKTLTDKDIEAVSAKIV  784


> G3CQZ9 Phenylalanine--tRNA ligase beta subunit [uncultured bacterium]
Length=585

 Score =  211 bits (537),  Expect = 9e-62
 Identities = 173/579 (30%), Positives = 282/579 (49%), Gaps = 38/579 (7%)

Query  207  LETEGAPRYLGRIIKNVNVKATTPEWMAQALAASGIRTHSILVDVTNYVLMELGQPMHAF  266
            L+ +   R+   +I  + VK +  EWMA+ L A+G+R  S +VDV+NYV++EL QP HA+
Sbjct  11   LDGDRCARFTSTVISGIEVKPSA-EWMARRLTAAGMRPISNVVDVSNYVMLELNQPNHAY  69

Query  267  DLAKLNG-AIHVRQASAQEKLTLLNDQNVELNEDIMVIADDAKV-LAIAGIMGGLESSVT  324
            DL  L G    +R+A A E+LT L+ +      D + I D   V + + GIMGGL++ ++
Sbjct  70   DLDTLGGRGFRIRRARAGEQLTTLDGEVRTFTSDDLFICDANDVPIGVGGIMGGLDTEIS  129

Query  325  DDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFERGVD-FELPLLAMNRASQLIQQFA  383
            D T  + LE A+F+ + I     R  L +++S RFERGVD + +P LA+ R  +L+ +  
Sbjct  130  DSTTTVALEMAWFSLVGIGQTVTRTNLRSEASARFERGVDPYGMP-LAIARFVELLAETC  188

Query  384  GG---EFGPITVAENTALLPKREAIELNQQQVSQLLGYEVETDFIADALTRLGCQVAVKA  440
                   G + V  +  L  +  +  +    V+++LG    TD  AD L RL   +    
Sbjct  189  PNLVVHAGAVDVRSDD-LPAEHRSTPVRISAVNRILG----TDLTADDLPRLLDPIGFTV  243

Query  441  QGEW---VVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK--IDVKLAKYQDHLELG  495
             G      VV PS R D     D+IEEVAR +GYD +   +PK  +  +L+  Q    L 
Sbjct  244  SGAGDTRDVVLPSWRLDSAEEVDVIEEVARHYGYDRLGKTVPKSVVHGELSVRQRRRRLA  303

Query  496  QLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDLAVMRSTLLSSLIPCV  555
              RQ +  LG  EA+   F       +     + L + NP+ ++ +V+R++L   L+  +
Sbjct  304  --RQVLLGLGISEAMPNPFLAPDTLAKAGLPGDALRITNPLVAEESVLRTSLRPGLLRAI  361

Query  556  QHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSSVPEQWHGKTQPMDFF  615
             +N + ++  V  FE+G  +   +     + +    L ++  G   P       +  D  
Sbjct  362  AYNESHRRPGVALFEIGHVYPPADGELPGEYE---ALTVVLAGREAPTAMAVWRELADAL  418

Query  616  DLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYLGRLHPSLENDLDLGV  675
                 I+Q                A LH  +SA +      +G +G + P +    D+  
Sbjct  419  GTGARIDQ------------SKVPAGLHATRSATLQAGRDPLGAVGEVAPDVLASFDVTE  466

Query  676  -TWVAELDQQAIL--QSYVSNFTELSRFPSVRRDIALLISDKINVSDIQQLIKQTGGDLL  732
               + ELD   IL  +   + +   SR+PS   D++ ++ ++I    + + ++Q  G+LL
Sbjct  467  RVAILELDLDQILDREPKPTQWKPTSRYPSSDLDLSFVVPEEIPAEKVDKAVRQGAGNLL  526

Query  733  DSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEI  771
                LFDVY G+ V EG RSLA+ +  Q P R L DA+I
Sbjct  527  VDIDLFDVYRGERVAEGSRSLAYRVRLQAPDRNLTDADI  565


> Q8RPZ7 Phenylalanyl-tRNA-synthetase beta-subunit [Azotobacter 
vinelandii]
Length=161

 Score =  193 bits (490),  Expect = 6e-60
 Identities = 98/163 (60%), Positives = 121/163 (74%), Gaps = 3/163 (2%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SE WLR WVNP +    L  +L+M GLEVD +APVA  F+GVVVGE+L+ E HPDAD
Sbjct  1    MKFSEQWLRDWVNPQVSRDELVARLSMAGLEVDSVAPVAGDFSGVVVGEILSSEPHPDAD  60

Query  61   RLRVTTVNIGNG-EPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGML  119
            +LRV  V  GNG E  Q+VCGAPN R G+K P A +GAVL  +FKIKK KLRG+ES GML
Sbjct  61   KLRVCRV--GNGSEVFQVVCGAPNARPGIKIPFAMLGAVLGEDFKIKKAKLRGVESFGML  118

Query  120  CGASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISI  162
            C A+E+ + ++ DGLLELP DAP+GL+IR YL LDD  I++ +
Sbjct  119  CSAAELKISEENDGLLELPADAPLGLDIRTYLNLDDASIEVDL  161


> Q9K4Q4 Putative phenylalanyl-tRNA synthetase chain B [Myxococcus 
xanthus]
Length=113

 Score = 72.8 bits (177),  Expect = 9e-18
 Identities = 33/102 (32%), Positives = 64/102 (63%), Gaps = 0/102 (0%)

Query  691  VSNFTELSRFPSVRRDIALLISDKINVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGK  750
            V  +  L RFP+V RD+A+++  ++   +++++I + G  L++   +FDVYTG+ + +G+
Sbjct  12   VPAYRSLPRFPAVLRDLAVVVPLELPNDEVRRVILEVGKPLVEDAQVFDVYTGEQIPQGR  71

Query  751  RSLAFALLWQHPSRTLEDAEIKSGMDNIIEVLENTYQATLRA  792
            ++LA+AL ++   RTL D E+      I++ ++    A LRA
Sbjct  72   KNLAYALRYRSAERTLTDVEVNEAHQRIVDEVKQRLGAALRA  113


> G9C4N1 Phenylalanyl-tRNA synthetase beta subunit [Pasteuria penetrans]
Length=129

 Score = 68.9 bits (167),  Expect = 3e-16
 Identities = 38/106 (36%), Positives = 60/106 (57%), Gaps = 3/106 (3%)

Query  686  ILQSYVSNFTELSRFPSVRRDIALLISDKINVSDIQQLIKQTGGDLLDSTWLFDVYTGQG  745
            ++Q   S F   SRFPSV RDI+L++   I V+ +   I+   G LL +  LFDV++   
Sbjct  24   LMQHRQSTFRPWSRFPSVHRDISLVVDKGIPVASVTMAIRTFAGSLLKTVSLFDVFS---  80

Query  746  VEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIEVLENTYQATLR  791
              E ++SLA+ L++Q   +TL + E++   D ++  L     ATLR
Sbjct  81   FSENQQSLAYTLIYQSDEKTLTEGEVQMAYDQLVTSLAMEIGATLR  126


> Q46107 Phenylalanyl-tRNA synthetase beta chain [Campylobacter 
jejuni]
Length=101

 Score = 51.2 bits (121),  Expect = 1e-10
 Identities = 26/86 (30%), Positives = 50/86 (58%), Gaps = 1/86 (1%)

Query  663  LHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDIQQ  722
            LH  +EN+ DL  T++ ELD   I Q +       S+FP++ RD+++LI      + I+ 
Sbjct  1    LHLKIENERDLPKTYICELDLDLIRQDF-KIAKPYSKFPAITRDLSVLIPKGFEYNQIKN  59

Query  723  LIKQTGGDLLDSTWLFDVYTGQGVEE  748
             I++   ++L++  L D+Y+ + ++E
Sbjct  60   CIEELNLEILENFRLVDIYSDENLKE  85


> O58271 tRNA-binding domain-containing protein [Pyrococcus horikoshii 
(strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 
/ OT-3)]
Length=241

 Score = 48.5 bits (114),  Expect = 4e-09
 Identities = 36/99 (36%), Positives = 52/99 (53%), Gaps = 11/99 (11%)

Query  45   VVVGEVLTVEQHPDADRLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFK  104
            +VVGEV++V +HP ADRL VT VNIG    + +V     ++ G +  V    A+LP    
Sbjct  138  IVVGEVMSVGKHPSADRLLVTNVNIGE-RAVTVVTNDLTVKEGNRVAV----ALLPPR--  190

Query  105  IKKGKLRGIESQGMLCGASEIDLEDKIDGLLELPEDAPV  143
                   GI S+GM  GA E  L++    +  LP+  P+
Sbjct  191  ----NFFGIVSEGMFLGAGEGVLKNVKGEIGGLPKGIPL  225


> A0A1Q1NKL1 Tyrosine--tRNA ligase [Bombyx mori]
Length=524

 Score = 49.7 bits (117),  Expect = 4e-09
 Identities = 36/104 (35%), Positives = 56/104 (54%), Gaps = 8/104 (8%)

Query  32   VDELAPVAKPFTGVVVGEVLTVEQHPDADRLRVTTVNIGNGEPLQIVCGAPNLRVGMKAP  91
            VD++ P       + VG ++ V +HPDAD L V  +++G  EP  IV G  N  V ++  
Sbjct  355  VDDVTPSK---LDIRVGHIVEVSRHPDADALYVEKIDVGEDEPRTIVSGLVNF-VPIEEM  410

Query  92   VATIGAVLPGEFKIKKGKLRGIESQGMLCGASEIDLEDKIDGLL  135
                  VL     +K  K+RG+ES+GM+  AS +D   +++ LL
Sbjct  411  QDRDVVVL---CNLKAAKMRGVESKGMVLCAS-VDEPKQVEPLL  450


> Q8KR35 YdjD [Lactococcus lactis subsp. cremoris]
Length=207

 Score = 47.8 bits (112),  Expect = 5e-09
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query  83   NLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLCGASEIDLEDKID--GLLELPED  140
            N  +G+K   A  GA++P    I  G LRG++S GMLC A E++L D  D  G++EL   
Sbjct  133  NASLGLKTVAALPGAMMPNGALIFPGALRGVQSYGMLCSARELELPDAPDVRGIIELSSA  192

Query  141  APVG  144
               G
Sbjct  193  LAAG  196


> B7U9W7 p43 protein [Hirudo medicinalis]
Length=318

 Score = 47.0 bits (110),  Expect = 2e-08
 Identities = 30/98 (31%), Positives = 55/98 (56%), Gaps = 8/98 (8%)

Query  47   VGEVLTVEQHPDADRLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIK  106
            +G+++ V++HPDAD L V  V++G G+   I+ G     V ++     +   L     +K
Sbjct  165  IGKIVAVDKHPDADSLYVEQVDLGEGKNRTIISGLVK-HVPIEQMQGRLAVFLT---NLK  220

Query  107  KGKLRGIESQGMLCGASEIDLEDKIDGLLELPEDAPVG  144
              K+RGI S+GM+  A   ++ +K++ ++E P  A +G
Sbjct  221  PAKMRGIMSEGMIMCA---NVPEKVE-IIEPPAGAAIG  254



Lambda      K        H        a         alpha
   0.319    0.136    0.390    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6756120


  Database: eb7040d05b19fd2039b649c09a755c86.TrEMBL.fasta
    Posted date:  Sep 28, 2020  1:43 PM
  Number of letters in database: 10,313
  Number of sequences in database:  19



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40