ACIAD3041 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 0d2832f5ed9a958c5752bf87f2a1d361.SwissProt.fasta
           22 sequences; 16,047 total letters



Query= ACIAD3041

Length=794
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F873 Phenylalanine--tRNA ligase beta subunit [Acinetobacter b...  1550    0.0   
  Q4FQ66 Phenylalanine--tRNA ligase beta subunit [Psychrobacter a...   811    0.0   
  Q7N3Q1 Phenylalanine--tRNA ligase beta subunit [Photorhabdus la...   738    0.0   
  Q83L36 Phenylalanine--tRNA ligase beta subunit [Shigella flexneri]   734    0.0   
  Q5E5G5 Phenylalanine--tRNA ligase beta subunit [Aliivibrio fisc...   733    0.0   
  Q4KEV9 Phenylalanine--tRNA ligase beta subunit [Pseudomonas flu...   731    0.0   
  Q8XE32 Phenylalanine--tRNA ligase beta subunit [Escherichia col...   731    0.0   
  Q2SDJ7 Phenylalanine--tRNA ligase beta subunit [Hahella chejuen...   731    0.0   
  P57859 Phenylalanine--tRNA ligase beta subunit [Pasteurella mul...   731    0.0   
  Q3Z261 Phenylalanine--tRNA ligase beta subunit [Shigella sonnei...   730    0.0   
  P07395 Phenylalanine--tRNA ligase beta subunit [Escherichia col...   730    0.0   
  Q321K5 Phenylalanine--tRNA ligase beta subunit [Shigella boydii...   729    0.0   
  P15434 Phenylalanine--tRNA ligase beta subunit [Salmonella typh...   714    0.0   
  P17922 Phenylalanine--tRNA ligase beta subunit [Bacillus subtil...   528    6e-178
  Q9AGR3 Phenylalanine--tRNA ligase beta subunit [Staphylococcus ...   442    4e-145
  Q5SGX1 Phenylalanine--tRNA ligase beta subunit [Thermus thermop...   374    2e-119
  P27002 Phenylalanine--tRNA ligase beta subunit [Thermus thermop...   374    2e-119
  O34943 Putative tRNA-binding protein YtpR [Bacillus subtilis (s...  91.7    3e-23 
  Q76KA7 Phenylalanine--tRNA ligase beta subunit [Thermococcus ko...  75.1    9e-17 
  Q9WUA2 Phenylalanine--tRNA ligase beta subunit [Mus musculus]       74.7    1e-16 
  Q9NSD9 Phenylalanine--tRNA ligase beta subunit [Homo sapiens]       73.6    3e-16 
  Q9VCA5 Phenylalanine--tRNA ligase beta subunit [Drosophila mela...  72.8    5e-16 


> Q6F873 Phenylalanine--tRNA ligase beta subunit [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=793

 Score = 1550 bits (4014),  Expect = 0.0
 Identities = 793/793 (100%), Positives = 793/793 (100%), Gaps = 0/793 (0%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD
Sbjct  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC
Sbjct  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
            GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA
Sbjct  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS  240
            VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS
Sbjct  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALAAS  240

Query  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI  300
            GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI
Sbjct  241  GIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDI  300

Query  301  MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE  360
            MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE
Sbjct  301  MVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFE  360

Query  361  RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV  420
            RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV
Sbjct  361  RGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYEV  420

Query  421  ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK  480
            ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK
Sbjct  421  ETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLPK  480

Query  481  IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL  540
            IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL
Sbjct  481  IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISSDL  540

Query  541  AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS  600
            AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS
Sbjct  541  AVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSS  600

Query  601  VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL  660
            VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL
Sbjct  601  VPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIGYL  660

Query  661  GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720
            GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI
Sbjct  661  GRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINVSDI  720

Query  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE  780
            QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE
Sbjct  721  QQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDNIIE  780

Query  781  VLENTYQATLRAS  793
            VLENTYQATLRAS
Sbjct  781  VLENTYQATLRAS  793


> Q4FQ66 Phenylalanine--tRNA ligase beta subunit [Psychrobacter 
arcticus (strain DSM 17307 / VKM B-2377 / 273-4)]
Length=801

 Score =  811 bits (2094),  Expect = 0.0
 Identities = 441/807 (55%), Positives = 558/807 (69%), Gaps = 20/807 (2%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MKISE WLR WVNP   S  LADQLTM GLE+D+   VA+ F+GVVVGEV++VEQHPDAD
Sbjct  1    MKISEQWLRQWVNPNNSSEQLADQLTMAGLEIDDRFAVARAFSGVVVGEVISVEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGE----FKIKKGKLRGIESQ  116
            +LRVT VNIG  EPLQIVCGAPN+ VGMK PVAT+GAVLP +    FKIK G LRG++S 
Sbjct  61   KLRVTQVNIGAVEPLQIVCGAPNVTVGMKVPVATVGAVLPSDDGTGFKIKNGNLRGVDSN  120

Query  117  GMLCGASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIA  176
            GMLCGASEIDL D IDGLLELP DAP+G +IREYL LD+ I+DISITPNRGDCFS+RGIA
Sbjct  121  GMLCGASEIDLTDNIDGLLELPTDAPIGTDIREYLGLDNQILDISITPNRGDCFSVRGIA  180

Query  177  RDLAVLNQLEVTPPDIQAVEATLNEQKQVHLET---EGAPRYLGRIIKNVNVKATTPEWM  233
            R+++V+N L +  P+I      ++ +    +     E  PRY  + I N++    TP+WM
Sbjct  181  REISVINDLPLQMPNIPDNNQVIHNEAMPAVTVSAVEACPRYFLQSISNIDRTIDTPKWM  240

Query  234  AQALAASGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQN  293
              AL  SG+R+H+ LVDVTNYVLMELGQP+HAFD   + G I VR A  +E +TLLN+Q 
Sbjct  241  QDALVQSGLRSHNFLVDVTNYVLMELGQPLHAFDADTIVGDIVVRLAQPEETITLLNEQT  300

Query  294  VELNEDIMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHT  353
            + L  D +VIADD   LA+AGIMGG  SSVTD T +I LESAFF PLAIA RARRFGLHT
Sbjct  301  ISLTGDELVIADDKGALALAGIMGGQRSSVTDSTTNIVLESAFFNPLAIAARARRFGLHT  360

Query  354  DSSQRFERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVS  413
            D+SQRFERGVDFELP LA+ RA  LI    G + G I   EN+  LP R  I L   +V 
Sbjct  361  DASQRFERGVDFELPALALARAVDLITSVTGSQAGQIVAMENSDHLPARAPITLPITKVR  420

Query  414  QLLGYEVETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDN  473
             ++G E+E   +   LT+LG +V  +A    +   PS+RFD++I +DLIEE+ARI+GYDN
Sbjct  421  DVIGIEIEPVVMVRILTQLGFKVEQQAD-SLICTPPSYRFDMSIKEDLIEEIARIYGYDN  479

Query  474  IQIRLPKIDVKLAKYQDHLEL-GQLRQTIATLGYQEAISFSFADLKLEKQLNPDV--NPL  530
            I   LP + V +  Y D  +L  +++  +   GY EAISFSF+D KLE  L+       L
Sbjct  480  IPSILPHLQVSM-DYDDTADLTHEMKLALVDNGYMEAISFSFSDAKLEALLDDKALGEVL  538

Query  531  ALANPISSDLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTP  590
            ALANPISSDLAVMR TLLSSL+PCVQ+NLNRQQ+RVRFFE GL F      S+ DL QTP
Sbjct  539  ALANPISSDLAVMRRTLLSSLLPCVQYNLNRQQSRVRFFETGLSF---VGHSVSDLVQTP  595

Query  591  TLALIAVGSSVPEQWHGKTQPMDFFDLKHDIEQILAA--GRVKVEYVRSERAWLHPGQSA  648
            ++A++AVG    EQ + + + +DF+DLKHDIEQ+L A     ++ Y RS+ A+LHPGQSA
Sbjct  596  SIAIVAVGDVWDEQAY-QNRALDFYDLKHDIEQLLPAKIDNARIRYERSQLAFLHPGQSA  654

Query  649  EILIAGQSIGYLGRLHPSLENDLDLGVTWVAELDQQAILQSYVSN--FTELSRFPSVRRD  706
            ++ I  Q +G+LG+LHP+    LDL  TWVA+L    +L         T  S+FP VRRD
Sbjct  655  KLYIDDQYVGWLGQLHPNTAKQLDLTTTWVAQLSLAPLLTLAREQHAITTPSKFPQVRRD  714

Query  707  IALLISDKINVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTL  766
            IA+L+   I++  ++  I++  G LL   WLFDVY G+ V  G+RSLAFAL+WQ  ++TL
Sbjct  715  IAILVDSDISLQTLESTIRKASGTLLTDLWLFDVYQGEKVPAGQRSLAFALIWQDKTQTL  774

Query  767  EDAEIKSGMDNIIEVLENTYQATLRAS  793
             D  +K+  D +++ L   + A LR S
Sbjct  775  SDDAVKTATDKVVQALTVEHSAQLRDS  801


> Q7N3Q1 Phenylalanine--tRNA ligase beta subunit [Photorhabdus 
laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / 
TT01)]
Length=795

 Score =  738 bits (1906),  Expect = 0.0
 Identities = 392/796 (49%), Positives = 542/796 (68%), Gaps = 7/796 (1%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SE WLR WVNPAI S TL+DQ+TM+GLEVD +  VA  F GVVVGEV+   QHP+AD
Sbjct  1    MKFSELWLREWVNPAISSETLSDQITMIGLEVDGVEAVAGQFHGVVVGEVVQCAQHPNAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +LRVT VN+G    L IVCGAPN R+G+K  VAT+GAVLPG+FKIK  KLRG  S+GMLC
Sbjct  61   KLRVTKVNVGGERLLDIVCGAPNCRLGLKVAVATVGAVLPGDFKIKAAKLRGEPSEGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
              SE+ + +  DG++ELP DAP+G+++REYLKLDD +I+ISITPNR DC SI G+ARD+A
Sbjct  121  SFSELGISEDHDGIIELPIDAPLGVDLREYLKLDDKVIEISITPNRADCLSIIGVARDVA  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLE-TEGAPRYLGRIIKNVNVKATTPEWMAQALAA  239
            V N++ ++ P I+AV+ T +    + +E TE  PRYLGR+IKN+NVKA TP+WM + L  
Sbjct  181  VANKMPLSEPQIEAVKPTTDAIFPIRVEATEACPRYLGRVIKNINVKAATPQWMREKLRR  240

Query  240  SGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNED  299
             GIR+   +VDVTNYVL+ELGQP+HAFDL +LNG+I VR A   EKL LL+     L+ D
Sbjct  241  GGIRSIDPIVDVTNYVLLELGQPLHAFDLERLNGSITVRMAKQDEKLVLLDGTEANLSTD  300

Query  300  IMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRF  359
             +VI+D+ + +A+AGI GG  S V ++TQ+I LE AFFAPLAIAGRARR+GLHTD+S R+
Sbjct  301  TLVISDEKQAVAMAGIFGGEHSGVNEETQNILLECAFFAPLAIAGRARRYGLHTDASHRY  360

Query  360  ERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYE  419
            ERGVD +L   A+ R +QL+    GGE GPI    + + LP+   I L ++++ +L+G+ 
Sbjct  361  ERGVDPQLQHKAIERTTQLLIDICGGEAGPIIDVTDESQLPQSATITLRREKLDRLIGHY  420

Query  420  VETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLP  479
            +  + + D LT LGC+V ++ +  W  VAPS RFD+ I +DL+EEVARI+GY+NI     
Sbjct  421  IPDEQVGDILTHLGCKVTIQ-ENCWQAVAPSWRFDVEIEEDLVEEVARIYGYNNIPDVPI  479

Query  480  KIDVKLAKYQD-HLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISS  538
            + D+ + K+++  L L +++  +   GYQEAI++SF D K++  L+P    L L NPIS+
Sbjct  480  RADLIMKKHRETDLSLQRVKTVLVDRGYQEAITYSFVDPKIQALLHPQQQALMLPNPISA  539

Query  539  DLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVG  598
            D++ MR +LL+ L+  V +N NRQQNRVR FE GLRF     A    ++Q   L  +  G
Sbjct  540  DMSAMRLSLLTGLLTTVVYNQNRQQNRVRLFETGLRFVPDENAD-QGIRQELMLGGVITG  598

Query  599  SSVPEQWHGKTQPMDFFDLKHDIEQIL-AAGRV-KVEYVRSERAWLHPGQSAEILIAGQS  656
            +   E W  + Q +DFFD+K D+E +L   G++ K+ +       LHPGQSA I +  + 
Sbjct  599  NRFEEHWSLEKQSVDFFDMKGDLEAVLELTGKLSKISFRADVNPALHPGQSAGIYLENEY  658

Query  657  IGYLGRLHPSLENDLDL-GVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKI  715
            IGY+G +HP LE  LDL G T V E+    +    V +  E+SRFPS RRDIA+++ + +
Sbjct  659  IGYIGVVHPELERKLDLNGRTVVFEVLWNKLASRVVPDAKEISRFPSNRRDIAIVVPENV  718

Query  716  NVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGM  775
             V D+    K+ G + +    LFDVY G+GV EG +SLA + + Q  +RTLE+ EI + +
Sbjct  719  AVEDVLAECKKVGVNHIVGINLFDVYCGKGVAEGHKSLAISFILQDTARTLEEEEIAATI  778

Query  776  DNIIEVLENTYQATLR  791
            +  + VL+  +QA+LR
Sbjct  779  NKCVAVLKQRFQASLR  794


> Q83L36 Phenylalanine--tRNA ligase beta subunit [Shigella flexneri]
Length=795

 Score =  734 bits (1894),  Expect = 0.0
 Identities = 393/796 (49%), Positives = 533/796 (67%), Gaps = 7/796 (1%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SE WLR WVNPAIDS TLA+Q+TM GLEVD + PVA  F GVVVGEV+   QHP+AD
Sbjct  1    MKFSELWLREWVNPAIDSDTLANQITMAGLEVDGVEPVAGSFHGVVVGEVVECAQHPNAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +LRVT VN+G    L IVCGAPN R G++  VATIGAVLPG+FKIK  KLRG  S+GMLC
Sbjct  61   KLRVTKVNVGGDRLLDIVCGAPNCRQGLRVAVATIGAVLPGDFKIKAAKLRGEPSEGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
              SE+ + D   G++ELP DAP+G +IREYLKLDDN I+IS+TPNR DC  I G+ARD+A
Sbjct  121  SFSELGISDDHSGIIELPADAPIGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARDVA  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLET-EGAPRYLGRIIKNVNVKATTPEWMAQALAA  239
            VLNQL +  P+I  V AT+++   + +E  E  PRYLGR++K +NVKA TP WM + L  
Sbjct  181  VLNQLPLVEPEIVPVGATIDDTLPITVEAPEACPRYLGRVVKGINVKAPTPLWMKEKLRR  240

Query  240  SGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNED  299
             GIR+   +VDVTNYVL+ELGQPMHAFD  ++ G I VR A   E L LL+    +LN D
Sbjct  241  CGIRSIDAVVDVTNYVLLELGQPMHAFDKDRIEGGIVVRMAKEGETLVLLDGTEAKLNAD  300

Query  300  IMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRF  359
             +VIAD  K LA+ GI GG  S V D+TQ++ LE AFF+PL+I GRARR GLHTD+S R+
Sbjct  301  TLVIADHNKALAMGGIFGGEHSGVNDETQNVLLECAFFSPLSITGRARRHGLHTDASHRY  360

Query  360  ERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYE  419
            ERGVD  L   AM RA++L+    GGE GP+    N A LPKR  I L + ++ +L+G+ 
Sbjct  361  ERGVDPVLQHKAMERATRLLIDICGGEAGPVIDITNEATLPKRATITLRRSKLDRLIGHH  420

Query  420  VETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLP  479
            +  + + D L RLGC+V  + + EW  VAPS RFD+ I +DL+EEVAR++GY+NI     
Sbjct  421  IADEQVTDILRRLGCEV-TEGKDEWQAVAPSWRFDMEIEEDLVEEVARVYGYNNIPDEPV  479

Query  480  KIDVKLAKYQD-HLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISS  538
            +  + +  +++  L L +++  +   GYQE I++SF D K+++ ++P V  L LA+PIS 
Sbjct  480  QASLIMGTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIHPGVEALLLASPISV  539

Query  539  DLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVG  598
            +++ MR +L + L+  V +N NRQQNRVR FE GLRF     A +  ++Q   LA +  G
Sbjct  540  EMSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAPL-GIRQDLMLAGVICG  598

Query  599  SSVPEQWHGKTQPMDFFDLKHDIEQIL-AAGRV-KVEYVRSERAWLHPGQSAEILIAGQS  656
            +   E W+   + +DF+DLK D+E +L   G++ +VE+       LHPGQSA I + G+ 
Sbjct  599  NRYEEHWNLAKETVDFYDLKGDLESVLDLTGKLNEVEFRAEANPALHPGQSAAIYLKGER  658

Query  657  IGYLGRLHPSLENDLDL-GVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKI  715
            IG++G +HP LE  LDL G T V EL+   +    V    E+SRFP+ RRDIA+++++ +
Sbjct  659  IGFVGVVHPELERKLDLNGRTLVFELEWNKLADRVVPQAREISRFPANRRDIAVVVAENV  718

Query  716  NVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGM  775
              +DI    K+ G + +    LFDVY G+GV EG +SLA +L+ Q  SRTLE+ EI + +
Sbjct  719  PAADILSECKKVGVNQVVGVNLFDVYRGKGVAEGYKSLAISLILQDTSRTLEEEEIAATV  778

Query  776  DNIIEVLENTYQATLR  791
               +E L+  +QA+LR
Sbjct  779  AKCVEALKERFQASLR  794


> Q5E5G5 Phenylalanine--tRNA ligase beta subunit [Aliivibrio fischeri 
(strain ATCC 700601 / ES114)]
Length=795

 Score =  733 bits (1892),  Expect = 0.0
 Identities = 397/799 (50%), Positives = 524/799 (66%), Gaps = 13/799 (2%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SESWLR WV PAI+S  LA Q+TM GLEVDE+APVA  FTGV VG+V+   QHPDAD
Sbjct  1    MKFSESWLREWVKPAINSEELAHQITMAGLEVDEVAPVAGEFTGVKVGKVVECGQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +LRVT ++IG  E L IVCGA N R+G+   VAT+GAVLPG FKIKK KLRG+ S GMLC
Sbjct  61   KLRVTKIDIGEEELLDIVCGASNCRLGLTVAVATVGAVLPGNFKIKKAKLRGVPSHGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
              SE+ ++ + +G+LELPE   +G ++R+ L+L+D  ID+ +T NR DCFSIRG+AR++ 
Sbjct  121  SFSELGIDVESEGILELPEGTTLGADVRDILELNDVAIDVDLTANRADCFSIRGLAREVG  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLE-TEGAPRYLGRIIKNVNVKATTPEWMAQALAA  239
            VLN+ +VT P I AV  ++ +   + ++ TE  PRYLGR+IKNVN KA TP WM + L  
Sbjct  181  VLNRADVTEPTIAAVATSIEDAVSIEVKATEACPRYLGRVIKNVNAKAETPIWMQEKLRR  240

Query  240  SGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNED  299
             GIR+   +VD+TNYV++E GQPMHAFDLAK++G I VR A   EKLTLL+    +LN++
Sbjct  241  CGIRSIDAIVDITNYVMLEQGQPMHAFDLAKIDGGIVVRMAEQDEKLTLLDGNEAKLNDN  300

Query  300  IMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRF  359
             +VIAD  K LAIAGI GG ES VT +T DI LE AFFAP  I GRAR +GLHTDSS RF
Sbjct  301  TLVIADQNKALAIAGIFGGQESGVTSETTDIMLECAFFAPDHIRGRARAYGLHTDSSLRF  360

Query  360  ERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYE  419
            ERGVD  L   AM RA+QL+ +  GGE  P+   E+ A LPK   +EL + ++  LLG+ 
Sbjct  361  ERGVDSTLQAAAMERATQLLVELCGGEVAPVVAVESEADLPKANTVELRRSKLDGLLGHH  420

Query  420  VETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLP  479
            + +  + + LTRLGC V     G W   +PS RFDI I QDLIEEV RI+GY+NI  + P
Sbjct  421  IPSTDVVEILTRLGCAVESTDTG-WTASSPSWRFDIAIEQDLIEEVGRIYGYNNIPNQAP  479

Query  480  KIDVKLAKYQDHLELGQ----LRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANP  535
               V      DH E  Q    +R  +   GY EAI++SF + + +K + P++ PL L  P
Sbjct  480  ---VAALNMNDHKEANQPLKRVRDLLVDRGYHEAITYSFVEPEQQKLIVPEIEPLILPFP  536

Query  536  ISSDLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALI  595
            IS++++ MR +L + LI  V HN  RQQ RVR FE GLRF  + +A  + ++Q   LA I
Sbjct  537  ISAEMSAMRLSLWTGLINTVVHNQKRQQPRVRLFESGLRFIPEESAE-NGMRQEMMLAGI  595

Query  596  AVGSSVPEQWHGKTQPMDFFDLKHDIEQI--LAAGRVKVEYVRSERAWLHPGQSAEILIA  653
              G+   E W   T  +DFFDLK D+E +  L A  +  E+  ++   LHPGQ+A I++ 
Sbjct  596  IAGTRGEEHWDIATNTVDFFDLKGDLEAVLELTANELAYEFKAAKHPALHPGQTAAIVVD  655

Query  654  GQSIGYLGRLHPSLENDLDL-GVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLIS  712
            G+ +G++G +HP LE    L G T + E++  AI    +     +S+FP+ RRDIA++  
Sbjct  656  GKEVGFIGTVHPELERKFGLNGRTIMFEIEWDAINTRVIPEAASVSKFPANRRDIAIVAD  715

Query  713  DKINVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIK  772
            + I   DI      +GG+LL S  LFDVY GQGVEEGK+SLA AL  Q   RTLE+A+I 
Sbjct  716  EAIASGDIVAECLASGGELLTSAKLFDVYRGQGVEEGKKSLAIALTLQSVERTLEEADIT  775

Query  773  SGMDNIIEVLENTYQATLR  791
            S +D I+  +   + ATLR
Sbjct  776  SAVDAIVAAIGEKFSATLR  794


> Q4KEV9 Phenylalanine--tRNA ligase beta subunit [Pseudomonas fluorescens 
(strain ATCC BAA-477 / NRRL B-23932 / Pf-5)]
Length=792

 Score =  731 bits (1888),  Expect = 0.0
 Identities = 385/796 (48%), Positives = 523/796 (66%), Gaps = 10/796 (1%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SE WLR WV+P +    L  +L+M GLEVD + P A  F+GVVVGEVL+ EQHPDAD
Sbjct  1    MKFSEQWLRGWVSPQVSRDELVARLSMAGLEVDSVTPAAGDFSGVVVGEVLSTEQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +LRV  V+ G+ E  Q+VCGAPN+R G+K P A IGA LPG+FKIKK KLRG+ES GMLC
Sbjct  61   KLRVCQVSNGS-ETFQVVCGAPNVRPGLKVPFAMIGAQLPGDFKIKKAKLRGVESNGMLC  119

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
              +E+ + +  DGL+ELP DAPVG ++R YL LDD  I++ +TPNRGDC S+ G+AR++ 
Sbjct  120  SQAELQIGEGNDGLMELPVDAPVGEDVRTYLSLDDASIEVDLTPNRGDCLSLAGMAREVG  179

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLETEGA-PRYLGRIIKNVNVKATTPEWMAQALAA  239
             L   +V  P++ A+ A  +E + V +    A PRYLGR+++NV++   TP WM + L  
Sbjct  180  ALYAAKVQRPEVPAIPAAHDEVRPVEVLAPAACPRYLGRVVRNVDLSKPTPLWMVERLRR  239

Query  240  SGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNED  299
            + +R+    VD+TNYV++ELGQP+HAFDLA++NG I VR A   EKL LL+ Q V L  D
Sbjct  240  ADVRSIDAAVDITNYVMLELGQPLHAFDLAEINGGIRVRMAEEGEKLVLLDGQEVTLRSD  299

Query  300  IMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRF  359
             +VIAD  + LAIAG+MGG  S VT +T+D+FLESAFF  +A+AG+AR +GLHTD+S R+
Sbjct  300  TLVIADHTRALAIAGVMGGEHSGVTANTRDVFLESAFFDQIAVAGKARSYGLHTDASHRY  359

Query  360  ERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYE  419
            ERGVD++L   AM RA+ L+ +  GG+ GPI    +   LP    + L  ++++Q+LG E
Sbjct  360  ERGVDWQLAREAMERATGLLLEITGGDAGPIIETLSEQHLPSVAPVTLRAERITQMLGME  419

Query  420  VETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLP  479
            ++   +   LT LG  V     G+W V  PSHRFDI++  DLIEE+AR++GY+ + +R P
Sbjct  420  IDGLEVERLLTALGLTVTADGAGQWRVEVPSHRFDISLEVDLIEELARLYGYNRLPVRYP  479

Query  480  KIDV-KLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISS  538
            +  +   AK +   +L  LR+ +   GYQEAI++SF D KL +  NP V PL LANPIS+
Sbjct  480  QARLAPQAKAEAEGDLPALRRLLVARGYQEAITYSFIDPKLFELFNPGVEPLLLANPISA  539

Query  539  DLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVG  598
            D+AVMRS+L   L+  +QHNLNRQQ+RVR FE GLRF       +  L+Q P LA +  G
Sbjct  540  DMAVMRSSLWPGLVKALQHNLNRQQDRVRMFESGLRF----VGQLEGLKQQPMLAGVVCG  595

Query  599  SSVPEQWHGKTQPMDFFDLKHDIEQILA-AGRVKV-EYVRSERAWLHPGQSAEILIAGQS  656
            S +PE W      +DFFD+K D+E +L  AG +    +V  +   LHPGQ+A I   G+ 
Sbjct  596  SRLPEGWAQGRDGVDFFDVKADVEAVLGFAGALDAFTFVPGKHPALHPGQTARIERDGRE  655

Query  657  IGYLGRLHPSLENDLDLG-VTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKI  715
            +G+LG +HP L  +L L    +V EL    + Q  +  F ELSRFP VRRD+ALL    +
Sbjct  656  VGFLGAIHPELAKNLGLDRPVYVFELVLSEVAQGRLPKFHELSRFPEVRRDLALLADRDV  715

Query  716  NVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGM  775
              S +  +I++  G+ L    LFDVY G+G++  ++SLA  L WQHPSRTL D E+ S  
Sbjct  716  AASSVLDVIRENAGEWLTDLRLFDVYQGKGIDPHRKSLAVGLTWQHPSRTLNDDEVNSTT  775

Query  776  DNIIEVLENTYQATLR  791
             NI+  LE    ATLR
Sbjct  776  QNILTSLEQRLNATLR  791


> Q8XE32 Phenylalanine--tRNA ligase beta subunit [Escherichia coli 
O157:H7]
Length=795

 Score =  731 bits (1888),  Expect = 0.0
 Identities = 391/796 (49%), Positives = 532/796 (67%), Gaps = 7/796 (1%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SE WLR WVNPAIDS  LA+Q+TM GLEVD + PVA  F GVVVGEV+   QHP+AD
Sbjct  1    MKFSELWLREWVNPAIDSDALANQITMAGLEVDGVEPVAGSFHGVVVGEVVECAQHPNAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +LRVT VN+G    L IVCGAPN R G++  VATIGAVLPG+FKIK  KLRG  S+GMLC
Sbjct  61   KLRVTKVNVGGDRLLDIVCGAPNCRQGLRVAVATIGAVLPGDFKIKAAKLRGEPSEGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
              SE+ + D  +G++ELP DAP+G +IREYLKLDDN I+IS+TPNR DC  I G+ARD+A
Sbjct  121  SFSELGISDDHNGIIELPADAPIGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARDVA  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLET-EGAPRYLGRIIKNVNVKATTPEWMAQALAA  239
            VLNQL +  P+I  V AT+++   + +E  E  PRYLGR++K +NVKA TP WM + L  
Sbjct  181  VLNQLPLVEPEIVPVGATIDDTLPITVEAPEACPRYLGRVVKGINVKAPTPLWMKEKLRR  240

Query  240  SGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNED  299
             GIR+   +VDVTNYVL+ELGQPMHAFD  ++ G I VR A   E L LL+    +LN D
Sbjct  241  CGIRSIDAVVDVTNYVLLELGQPMHAFDKDRIEGGIVVRMAKEGETLVLLDGTEAKLNAD  300

Query  300  IMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRF  359
             +VIAD  K LA+ GI GG  S V D+TQ++ LE AFF+PL+I GRARR GLHTD+S R+
Sbjct  301  TLVIADHNKALAMGGIFGGEHSGVNDETQNVLLECAFFSPLSITGRARRHGLHTDASHRY  360

Query  360  ERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYE  419
            ERGVD  L   AM RA++L+    GGE GP+    N A LPKR  I L + ++ +L+G+ 
Sbjct  361  ERGVDPALQYKAMERATRLLIDICGGEAGPVIDITNEATLPKRATITLRRSKLDRLIGHH  420

Query  420  VETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLP  479
            +  + + D L RLGC+V  + + EW  VAPS RFD+ I +DL+EEVAR++GY+NI     
Sbjct  421  IADEQVTDILRRLGCEV-TEGKDEWQAVAPSWRFDMEIEEDLVEEVARVYGYNNIPDEPV  479

Query  480  KIDVKLAKYQD-HLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISS  538
            +  + +  +++  L L +++  +   GYQE I++SF D K+++ ++P V  L L +PIS 
Sbjct  480  QASLIMGTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIHPGVEALLLPSPISV  539

Query  539  DLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVG  598
            +++ MR +L + L+  V +N NRQQNRVR FE GLRF     A +  ++Q   LA +  G
Sbjct  540  EMSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAPL-GIRQDLMLAGVICG  598

Query  599  SSVPEQWHGKTQPMDFFDLKHDIEQIL-AAGRV-KVEYVRSERAWLHPGQSAEILIAGQS  656
            +   E W+   + +DF+DLK D+E +L   G++ +VE+       LHPGQSA I + G+ 
Sbjct  599  NRYEEHWNLAKETVDFYDLKGDLESVLDLTGKLNEVEFRAEANPALHPGQSAAIYLKGER  658

Query  657  IGYLGRLHPSLENDLDL-GVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKI  715
            IG++G +HP LE  LDL G T V EL+   +    V    E+SRFP+ RRDIA+++++ +
Sbjct  659  IGFVGVVHPELERKLDLNGRTLVFELEWNKLADRVVPQAREISRFPANRRDIAVVVAENV  718

Query  716  NVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGM  775
              +DI    K+ G + +    LFDVY G+GV EG +SLA +L+ Q  SRTLE+ EI + +
Sbjct  719  PAADILSECKKVGVNQVVGVNLFDVYRGKGVAEGYKSLAISLILQDTSRTLEEEEIAATV  778

Query  776  DNIIEVLENTYQATLR  791
               +E L+  +QA+LR
Sbjct  779  AKCVEALKERFQASLR  794


> Q2SDJ7 Phenylalanine--tRNA ligase beta subunit [Hahella chejuensis 
(strain KCTC 2396)]
Length=790

 Score =  731 bits (1887),  Expect = 0.0
 Identities = 378/795 (48%), Positives = 530/795 (67%), Gaps = 8/795 (1%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SE WLR WV+P + S  L  Q+TM GLEVD    VAKPF+G+VVGEVL+VE HPDAD
Sbjct  1    MKFSEYWLREWVDPQLSSEALVQQITMAGLEVDAAERVAKPFSGIVVGEVLSVEPHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +LRV  V+ G  E  Q+VCGAPN+  GMK P A IGAVL G+FKIKK KLRG+ESQGMLC
Sbjct  61   KLRVCKVSDGQ-EEFQVVCGAPNVAAGMKVPFAKIGAVLSGDFKIKKAKLRGVESQGMLC  119

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
               E+ L +K DGL+ L  DAPVG+++R YLKLDDNIID+ +TPNR DC SI G+AR++A
Sbjct  120  SEEELTLAEKSDGLMPLAADAPVGVDVRSYLKLDDNIIDVDLTPNRSDCLSILGMAREVA  179

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLET-EGAPRYLGRIIKNVNVKATTPEWMAQALAA  239
             LN++    P+++   A +++   V +E  E  PRY+GR+IK V++ A TP+WM + L  
Sbjct  180  ALNKIPFEAPEVKKTAAVIDDVFPVRVEAPEACPRYVGRVIKGVDLSAPTPQWMVEKLRR  239

Query  240  SGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNED  299
            SGIR+   +VDVTN+V++ELGQPMHAFDL +L   I VR  +  EKL LL+ Q + +N D
Sbjct  240  SGIRSIDAVVDVTNFVMIELGQPMHAFDLNELADGIVVRMPTPGEKLVLLDGQEITINPD  299

Query  300  IMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRF  359
             +VIAD+ K LA+AG+MGG  S V++ T+DIFLESAFFAPL +AG+AR +GLHTDSS RF
Sbjct  300  TLVIADNEKPLALAGVMGGEHSGVSEKTKDIFLESAFFAPLHLAGKARSYGLHTDSSHRF  359

Query  360  ERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYE  419
            ERGVD+     A+ RA++L+ +  GG+ GP+T   +   LP +  + L   +V +LLG  
Sbjct  360  ERGVDYAHQARAIERATELLLEIVGGQPGPVTEICSKEHLPAKALVNLRHARVDELLGVH  419

Query  420  VETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLP  479
            ++   + + L RLG  V   A+  W   AP+HRFDI+I  DLIEEVAR++GY+ + +  P
Sbjct  420  LDRTRVEEMLARLGLGVHKVAKDGWTFSAPTHRFDISIEVDLIEEVARLYGYNKLPVTEP  479

Query  480  KIDVKLAKY-QDHLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISS  538
               + +    +  + L +L+  + + GYQEAI+++F D K+   L P+ + + LANPI+S
Sbjct  480  MAPLGIKPLPESKVSLRRLKLHLVSRGYQEAITYTFVDQKVLSLLTPEEDTITLANPIAS  539

Query  539  DLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVG  598
            D+A MR+TL + L+    +N NRQQNR+R FE GLRF  +       +QQ P LA + +G
Sbjct  540  DMAAMRTTLWAGLLQTALYNQNRQQNRIRLFESGLRFLKRGG----QIQQDPMLAGLIMG  595

Query  599  SSVPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPGQSAEILIAGQSIG  658
            +S+PE W  K + +DF+D+K D+E +L      + +  ++   LHPGQ+AE+L  GQ IG
Sbjct  596  ASMPEGWESKKRTVDFYDVKGDLESLLEIPGCNLSFRSAQHPALHPGQTAEVLKDGQPIG  655

Query  659  YLGRLHPSLENDLDL-GVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKINV  717
             LG LHP +   L+L G  ++ EL   +I    V +F  +SRFP +RRD+A++I ++   
Sbjct  656  VLGALHPRIAKTLNLNGPLYLFELCLNSIADGQVPSFKGVSRFPEIRRDLAIVIDEQTPY  715

Query  718  SDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGMDN  777
            +D+   I Q+ G+      LFDVY G+ V   K+SLA +++W+HP RTL D EI    DN
Sbjct  716  ADVALAIAQSAGEWRVHHELFDVYHGESVGADKKSLAISIVWRHPERTLRDEEITEAFDN  775

Query  778  IIEVLENTYQATLRA  792
            +++ L N + A+LR+
Sbjct  776  VVKELGNRFGASLRS  790


> P57859 Phenylalanine--tRNA ligase beta subunit [Pasteurella multocida 
(strain Pm70)]
Length=795

 Score =  731 bits (1887),  Expect = 0.0
 Identities = 385/796 (48%), Positives = 533/796 (67%), Gaps = 7/796 (1%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SESW+R WVNPAI +  L DQ+TMLGLEVD +  VA  F+GVVVGEV+   QHPDAD
Sbjct  1    MKFSESWVREWVNPAISTAQLCDQITMLGLEVDGVEKVAGDFSGVVVGEVVECAQHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +LRVT VN+G    L IVCGAPN R G+K   AT GAVLPG+FKIKK KLRG  S+GMLC
Sbjct  61   KLRVTKVNVGGDRLLDIVCGAPNCRQGLKVACATEGAVLPGDFKIKKTKLRGQPSEGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
              SE+ ++ +  G++ELP++APVG N+R+YL LDDN ++IS+TPNR DC SI GIAR++ 
Sbjct  121  SFSELGIDVESSGIIELPQNAPVGTNLRDYLTLDDNTVEISLTPNRADCLSIAGIAREIG  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLET-EGAPRYLGRIIKNVNVKATTPEWMAQALAA  239
            V+N+L V  P  ++V+AT+ ++  + L   E  PRYL R++KNVNV+A +P W+ + L  
Sbjct  181  VVNKLAVNTPHFESVKATITDKVDIQLHAPEACPRYLLRVVKNVNVQAPSPMWLQEKLRR  240

Query  240  SGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNED  299
             GIR+   +VDVTNY+L+ELGQPMHAFD AK+   + VR A + E L LL+    +L ++
Sbjct  241  CGIRSIDPVVDVTNYILLELGQPMHAFDAAKVAQPVQVRMAKSGEALVLLDGSTAKLKDN  300

Query  300  IMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRF  359
             ++IAD    LA+AGI GG  S V  +T+DI LE+AFFAPLAIAGRAR++GLHTDSS RF
Sbjct  301  TLLIADQNGPLAMAGIFGGQASGVNAETKDIILEAAFFAPLAIAGRARQYGLHTDSSHRF  360

Query  360  ERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYE  419
            ERGVDFEL   AM RA+ L+ +  GGE G I    + A LPK   + L ++++  LLG+ 
Sbjct  361  ERGVDFELQRQAMERATALLVEICGGEVGDICEVASDAFLPKLNQVSLRREKLDALLGHH  420

Query  420  VETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLP  479
            +ET+ + D LTRLG QV+  A   W V + S RFDI I +DL+EE+ARI+GY++I  + P
Sbjct  421  IETETVTDILTRLGLQVSY-ANDVWQVTSASWRFDIEIEEDLVEEIARIYGYNSIPNKAP  479

Query  480  KIDVKLAKYQD-HLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISS  538
               +++ ++++  L+L +++  +    YQEAI++SF D K++  L+P  + L L NPIS 
Sbjct  480  LAHLRMREHKEADLDLARIKTALVDADYQEAITYSFVDPKIQSVLHPQQDALVLPNPISV  539

Query  539  DLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVG  598
            +++ MR +LLS L+  VQ+N NRQQ RVR FE GLRF     A    ++Q   LA +  G
Sbjct  540  EMSAMRLSLLSGLLGAVQYNQNRQQTRVRLFETGLRFIPDTQAEF-GVRQEFVLAAVMTG  598

Query  599  SSVPEQWHGKTQPMDFFDLKHDIEQILA--AGRVKVEYVRSERAWLHPGQSAEILIAGQS  656
            +   E W GK + +DFFDLK D+E IL+    R  V++V      LHPGQSA I++ G+ 
Sbjct  599  NKKAEHWAGKAESVDFFDLKGDLESILSLTGTRNLVKFVAKSYPALHPGQSAAIMLNGEE  658

Query  657  IGYLGRLHPSLENDLDL-GVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKI  715
            IG++G LHP+    L L G T V E+  QAI    V    E+SRFP+ RRD+A+++++ +
Sbjct  659  IGFIGTLHPNAAKQLGLNGKTVVFEILWQAIATRQVVQAKEISRFPANRRDLAIVVAESV  718

Query  716  NVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGM  775
              SD+    ++  G+ L    LFDVY G GV EG +SLA +L+ Q   +TLE+ +I + +
Sbjct  719  AASDVLDACREVAGETLTQVNLFDVYQGNGVAEGHKSLAISLIIQDNEKTLEEDDINAVV  778

Query  776  DNIIEVLENTYQATLR  791
              ++  L+  + A LR
Sbjct  779  SVVLSELKQRFNAYLR  794


> Q3Z261 Phenylalanine--tRNA ligase beta subunit [Shigella sonnei 
(strain Ss046)]
Length=795

 Score =  730 bits (1885),  Expect = 0.0
 Identities = 391/796 (49%), Positives = 531/796 (67%), Gaps = 7/796 (1%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SE WLR WVNPAIDS  LA+Q+TM GLEVD + PVA  F GVVVGEV+   QHP+AD
Sbjct  1    MKFSELWLREWVNPAIDSDALANQITMAGLEVDGVEPVAGSFHGVVVGEVVECAQHPNAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +LRVT VN+G    L IVCGAPN R G++  VATIGAVLPG+FKIK  KLRG  S+GMLC
Sbjct  61   KLRVTKVNVGGDRLLDIVCGAPNCRQGLRVAVATIGAVLPGDFKIKAAKLRGEPSEGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
              SE+ + D   G++ELP DAP+G +IREYLKLDDN I+IS+TPNR DC  I G+ARD+A
Sbjct  121  SFSELGISDDHSGIIELPADAPIGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARDVA  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLET-EGAPRYLGRIIKNVNVKATTPEWMAQALAA  239
            VLNQL +  P+I  V AT+++   + +E  E  PRYLGR++K +NVKA TP WM + L  
Sbjct  181  VLNQLPLVEPEIVPVGATIDDTLPITVEAPEACPRYLGRVVKGINVKAPTPLWMKEKLRR  240

Query  240  SGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNED  299
             GIR+   +VDVTNYVL+ELGQPMHAFD  ++ G I VR A   E L LL+    +LN D
Sbjct  241  CGIRSIDAVVDVTNYVLLELGQPMHAFDKDRIEGGIVVRMAKEGETLVLLDGTEAKLNAD  300

Query  300  IMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRF  359
             +VIAD  K LA+ GI GG  S V D+TQ++ LE AFF+PL+I GRARR GLHTD+S R+
Sbjct  301  TLVIADHNKALAMGGIFGGEHSGVNDETQNVLLECAFFSPLSITGRARRHGLHTDASHRY  360

Query  360  ERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYE  419
            ERGVD  L   AM RA++L+    GGE GP+    N A LPKR  I L + ++ +L+G+ 
Sbjct  361  ERGVDPALQHKAMERATRLLIDICGGEAGPVIDITNEATLPKRATITLRRSKLDRLIGHH  420

Query  420  VETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLP  479
            +  + + D L RLGC+V  + + EW  VAPS RFD+ I +DL+EEVAR++GY+NI     
Sbjct  421  IADEQVTDILRRLGCEV-TEGKDEWQAVAPSWRFDMEIEEDLVEEVARVYGYNNIPDEPV  479

Query  480  KIDVKLAKYQD-HLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISS  538
            +  + +  +++  L L +++  +   GYQE I++SF D K+++ ++P V  L L +PIS 
Sbjct  480  QASLIMGTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIHPGVEALLLPSPISV  539

Query  539  DLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVG  598
            +++ MR +L + L+  V +N NRQQNRVR FE GLRF     A +  ++Q   LA +  G
Sbjct  540  EMSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAPL-GIRQDLMLAGVICG  598

Query  599  SSVPEQWHGKTQPMDFFDLKHDIEQIL-AAGRV-KVEYVRSERAWLHPGQSAEILIAGQS  656
            +   E W+   + +DF+DLK D+E +L   G++ +VE+       LHPGQSA I + G+ 
Sbjct  599  NRYEEHWNLAKETVDFYDLKGDLESVLDLTGKLNEVEFRAEANPALHPGQSAAIYLKGER  658

Query  657  IGYLGRLHPSLENDLDL-GVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKI  715
            IG++G +HP LE  LDL G T V EL+   +    V    E+SRFP+ RRDIA+++++ +
Sbjct  659  IGFVGVVHPELERKLDLNGRTLVFELEWNKLADRVVPQAREISRFPANRRDIAVVVAENV  718

Query  716  NVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGM  775
              +DI    K+ G + +    LFDVY G+GV EG +SLA +L+ Q  SRTLE+ EI + +
Sbjct  719  PAADILSECKKVGVNQVVGVNLFDVYRGKGVAEGYKSLAISLILQDTSRTLEEEEIAATV  778

Query  776  DNIIEVLENTYQATLR  791
               +E L+  +QA+LR
Sbjct  779  AKCVEALKERFQASLR  794


> P07395 Phenylalanine--tRNA ligase beta subunit [Escherichia coli 
(strain K12)]
Length=795

 Score =  730 bits (1885),  Expect = 0.0
 Identities = 391/796 (49%), Positives = 531/796 (67%), Gaps = 7/796 (1%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SE WLR WVNPAIDS  LA+Q+TM GLEVD + PVA  F GVVVGEV+   QHP+AD
Sbjct  1    MKFSELWLREWVNPAIDSDALANQITMAGLEVDGVEPVAGSFHGVVVGEVVECAQHPNAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +LRVT VN+G    L IVCGAPN R G++  VATIGAVLPG+FKIK  KLRG  S+GMLC
Sbjct  61   KLRVTKVNVGGDRLLDIVCGAPNCRQGLRVAVATIGAVLPGDFKIKAAKLRGEPSEGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
              SE+ + D   G++ELP DAP+G +IREYLKLDDN I+IS+TPNR DC  I G+ARD+A
Sbjct  121  SFSELGISDDHSGIIELPADAPIGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARDVA  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLET-EGAPRYLGRIIKNVNVKATTPEWMAQALAA  239
            VLNQL +  P+I  V AT+++   + +E  E  PRYLGR++K +NVKA TP WM + L  
Sbjct  181  VLNQLPLVQPEIVPVGATIDDTLPITVEAPEACPRYLGRVVKGINVKAPTPLWMKEKLRR  240

Query  240  SGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNED  299
             GIR+   +VDVTNYVL+ELGQPMHAFD  ++ G I VR A   E L LL+    +LN D
Sbjct  241  CGIRSIDAVVDVTNYVLLELGQPMHAFDKDRIEGGIVVRMAKEGETLVLLDGTEAKLNAD  300

Query  300  IMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRF  359
             +VIAD  K LA+ GI GG  S V D+TQ++ LE AFF+PL+I GRARR GLHTD+S R+
Sbjct  301  TLVIADHNKALAMGGIFGGEHSGVNDETQNVLLECAFFSPLSITGRARRHGLHTDASHRY  360

Query  360  ERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYE  419
            ERGVD  L   AM RA++L+    GGE GP+    N A LPKR  I L + ++ +L+G+ 
Sbjct  361  ERGVDPALQHKAMERATRLLIDICGGEAGPVIDITNEATLPKRATITLRRSKLDRLIGHH  420

Query  420  VETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLP  479
            +  + + D L RLGC+V  + + EW  VAPS RFD+ I +DL+EEVAR++GY+NI     
Sbjct  421  IADEQVTDILRRLGCEV-TEGKDEWQAVAPSWRFDMEIEEDLVEEVARVYGYNNIPDEPV  479

Query  480  KIDVKLAKYQD-HLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISS  538
            +  + +  +++  L L +++  +   GYQE I++SF D K+++ ++P V  L L +PIS 
Sbjct  480  QASLIMGTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIHPGVEALLLPSPISV  539

Query  539  DLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVG  598
            +++ MR +L + L+  V +N NRQQNRVR FE GLRF     A +  ++Q   LA +  G
Sbjct  540  EMSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAPL-GIRQDLMLAGVICG  598

Query  599  SSVPEQWHGKTQPMDFFDLKHDIEQIL-AAGRV-KVEYVRSERAWLHPGQSAEILIAGQS  656
            +   E W+   + +DF+DLK D+E +L   G++ +VE+       LHPGQSA I + G+ 
Sbjct  599  NRYEEHWNLAKETVDFYDLKGDLESVLDLTGKLNEVEFRAEANPALHPGQSAAIYLKGER  658

Query  657  IGYLGRLHPSLENDLDL-GVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKI  715
            IG++G +HP LE  LDL G T V EL+   +    V    E+SRFP+ RRDIA+++++ +
Sbjct  659  IGFVGVVHPELERKLDLNGRTLVFELEWNKLADRVVPQAREISRFPANRRDIAVVVAENV  718

Query  716  NVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGM  775
              +DI    K+ G + +    LFDVY G+GV EG +SLA +L+ Q  SRTLE+ EI + +
Sbjct  719  PAADILSECKKVGVNQVVGVNLFDVYRGKGVAEGYKSLAISLILQDTSRTLEEEEIAATV  778

Query  776  DNIIEVLENTYQATLR  791
               +E L+  +QA+LR
Sbjct  779  AKCVEALKERFQASLR  794


> Q321K5 Phenylalanine--tRNA ligase beta subunit [Shigella boydii 
serotype 4 (strain Sb227)]
Length=795

 Score =  729 bits (1881),  Expect = 0.0
 Identities = 391/796 (49%), Positives = 530/796 (67%), Gaps = 7/796 (1%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SE WLR WVNPAIDS  LA+Q+TM GLEVD + PVA  F GVVVGEV+   QHP+AD
Sbjct  1    MKFSELWLREWVNPAIDSDALANQITMAGLEVDGVEPVAGSFHGVVVGEVVECAQHPNAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +LRVT VN+G    L IVCGAPN R G++  VATIGAVLPG+FKIK  KLRG  S+GMLC
Sbjct  61   KLRVTKVNVGGDRLLDIVCGAPNCRQGLRVAVATIGAVLPGDFKIKAAKLRGEPSEGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
              SE+ + D   G++ELP DAP+G +IREYLKLDDN I+IS+TPNR DC  I G+ARD+A
Sbjct  121  SFSELGISDDHSGIIELPADAPIGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARDVA  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLET-EGAPRYLGRIIKNVNVKATTPEWMAQALAA  239
            VLNQL +  P+I  V AT+++   + +E  E  PRYLGR++K +NVKA TP WM + L  
Sbjct  181  VLNQLPLVEPEIVPVGATIDDTLPITVEAPEACPRYLGRVVKGINVKAPTPLWMKEKLRR  240

Query  240  SGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNED  299
             GIR+   +VDVTNYVL+ELGQPMHAFD  ++ G I VR A   E L LL+    +LN D
Sbjct  241  CGIRSIDAVVDVTNYVLLELGQPMHAFDKDRIEGGIVVRMAKEGETLVLLDGTEAKLNAD  300

Query  300  IMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRF  359
             +VIAD  K LA+ GI GG  S V D+TQ++ LE AFF+PL+I GRARR GLHTD+S R+
Sbjct  301  TLVIADHNKALAMGGIFGGEHSGVNDETQNVLLECAFFSPLSITGRARRHGLHTDASHRY  360

Query  360  ERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYE  419
            ERGVD  L   AM RA++L+    GGE GP+    N A LPKR  I L + ++  L+G+ 
Sbjct  361  ERGVDPALQHKAMERATRLLIDICGGEAGPVIDITNEATLPKRATITLRRSKLDCLIGHH  420

Query  420  VETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLP  479
            +  + + D L RLGC+V  + + EW  VAPS RFD+ I +DL+EEVAR++GY+NI     
Sbjct  421  IADEQVTDILRRLGCEV-TEGKDEWQAVAPSWRFDMEIEEDLVEEVARVYGYNNIPDEPV  479

Query  480  KIDVKLAKYQD-HLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISS  538
            +  + +  +++  L L +++  +   GYQE I++SF D K+++ ++P V  L L +PIS 
Sbjct  480  QASLIMGTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIHPGVEALLLPSPISV  539

Query  539  DLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVG  598
            +++ MR +L + L+  V +N NRQQNRVR FE GLRF     A +  ++Q   LA +  G
Sbjct  540  EMSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAPL-GIRQDLMLAGVICG  598

Query  599  SSVPEQWHGKTQPMDFFDLKHDIEQIL-AAGRV-KVEYVRSERAWLHPGQSAEILIAGQS  656
            +   E W+   + +DF+DLK D+E +L   G++ +VE+       LHPGQSA I + G+ 
Sbjct  599  NRYEEHWNLAKETVDFYDLKGDLESVLDLTGKLNEVEFRAEANPALHPGQSAAIYLKGER  658

Query  657  IGYLGRLHPSLENDLDL-GVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKI  715
            IG++G +HP LE  LDL G T V EL+   +    V    E+SRFP+ RRDIA+++++ +
Sbjct  659  IGFVGVVHPELERKLDLNGRTLVFELEWNKLADRVVPQAREISRFPANRRDIAVVVAENV  718

Query  716  NVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGM  775
              +DI    K+ G + +    LFDVY G+GV EG +SLA +L+ Q  SRTLE+ EI + +
Sbjct  719  PAADILSECKKVGVNQVVGVNLFDVYRGKGVAEGYKSLAISLILQDTSRTLEEEEIAATV  778

Query  776  DNIIEVLENTYQATLR  791
               +E L+  +QA+LR
Sbjct  779  AKCVEALKERFQASLR  794


> P15434 Phenylalanine--tRNA ligase beta subunit [Salmonella typhimurium 
(strain LT2 / SGSC1412 / ATCC 700720)]
Length=795

 Score =  714 bits (1842),  Expect = 0.0
 Identities = 380/796 (48%), Positives = 526/796 (66%), Gaps = 7/796 (1%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            MK SE WLR WVNPAIDS  LA+Q+TM GLEVD + PVA  F GVVVGEV+   QHP+AD
Sbjct  1    MKFSELWLREWVNPAIDSDALANQITMAGLEVDGVEPVAGSFNGVVVGEVVECAQHPNAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +LRVT VN+G    L IVCGAPN R G+K  VATIGA+LPG+FKIK  KLRG  S+GMLC
Sbjct  61   KLRVTKVNVGGERLLDIVCGAPNCRQGLKVAVATIGAILPGDFKIKAAKLRGEPSEGMLC  120

Query  121  GASEIDLEDKIDGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARDLA  180
              SE+ + D   G++ELP DAP+G +IREYLKLDDN I+IS+TPNR DC  I G+ARD+A
Sbjct  121  SFSELGISDDHSGIIELPADAPLGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARDVA  180

Query  181  VLNQLEVTPPDIQAVEATLNEQKQVHLE-TEGAPRYLGRIIKNVNVKATTPEWMAQALAA  239
            VLN+  +  P++  V AT+++   + +E  +  PRYLGR++K +NV A TP WM + L  
Sbjct  181  VLNKAPLQEPEMAPVTATISDTLPITVEAADACPRYLGRVVKGINVNAPTPLWMKEKLRR  240

Query  240  SGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNED  299
             GIR+   +VDVTNYVL+ELGQPMHAFD  +++G I VR A   E + LL+     LN D
Sbjct  241  CGIRSIDAVVDVTNYVLLELGQPMHAFDKDRIDGGIVVRMAKEGETVVLLDGSEATLNAD  300

Query  300  IMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRF  359
             +VIAD  K L IAGI GG  S V  +TQ++ LE A+F PL+I GRARR GLHTD+S R+
Sbjct  301  TLVIADHHKALGIAGIFGGEHSGVNGETQNVLLECAYFNPLSITGRARRHGLHTDASHRY  360

Query  360  ERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQLLGYE  419
            ERGVD  L   A+ RA++L+    GG+ GPI    N A LPKR  I L + ++ +L+G+ 
Sbjct  361  ERGVDPALQYKAIERATRLLLDICGGDAGPIIDVSNEATLPKRATITLRRSKLDRLIGHH  420

Query  420  VETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIRLP  479
            +  + ++D L RLGC+V  + Q EW  VAP+ RFD+ I +DL+EEVAR++GY+NI     
Sbjct  421  IADEQVSDILRRLGCEV-TEGQDEWKAVAPTWRFDMEIEEDLVEEVARVYGYNNIPDEPI  479

Query  480  KIDVKLAKYQD-HLELGQLRQTIATLGYQEAISFSFADLKLEKQLNPDVNPLALANPISS  538
            +  + +  +++  L L +++  +   GYQE I++SF D K+++ ++P    L L NPIS 
Sbjct  480  QAGLIMGTHREADLSLKRVKTMLNDKGYQEVITYSFVDPKVQQLIHPGAEALLLPNPISV  539

Query  539  DLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVG  598
            +++ MR +L S L+  V +N NRQQNRVR FE GLRF     A++  ++Q   LA +  G
Sbjct  540  EMSAMRLSLWSGLLATVVYNQNRQQNRVRIFETGLRFVPDTQANL-GIRQDLMLAGVICG  598

Query  599  SSVPEQWHGKTQPMDFFDLKHDIEQIL-AAGRV-KVEYVRSERAWLHPGQSAEILIAGQS  656
            +   E W+   + +DF+DLK D+E +L   G++  +++       LHPGQSA I +  + 
Sbjct  599  NRYDEHWNLAKETVDFYDLKGDLEAVLDLTGKLGDIQFKAEMNPALHPGQSAAIYLKDER  658

Query  657  IGYLGRLHPSLENDLDL-GVTWVAELDQQAILQSYVSNFTELSRFPSVRRDIALLISDKI  715
            IG++G +HP LE  LDL G T V EL+   +    V    E+SRFP+ RRDIA+++++ +
Sbjct  659  IGFIGVVHPELERKLDLNGRTLVFELEWNKLADRIVPQAREISRFPANRRDIAVVVAENV  718

Query  716  NVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPSRTLEDAEIKSGM  775
              +DI    K+ G + +    LFDVY G+GV EG +SLA +L+ Q  +RTLE+ EI + +
Sbjct  719  PAADILSECKKVGVNQVVGVNLFDVYRGKGVAEGYKSLAISLILQDTNRTLEEEEIAATV  778

Query  776  DNIIEVLENTYQATLR  791
               +E L+  +QA+LR
Sbjct  779  AKCVEALKERFQASLR  794


> P17922 Phenylalanine--tRNA ligase beta subunit [Bacillus subtilis 
(strain 168)]
Length=804

 Score =  528 bits (1359),  Expect = 6e-178
 Identities = 317/815 (39%), Positives = 482/815 (59%), Gaps = 36/815 (4%)

Query  1    MKISESWLRTWVN-PAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDA  59
            M +S  WL  +V+   +D   LA+++T  G+EV+ +    +   GVV+G VL  EQHP+A
Sbjct  1    MFVSYKWLEDYVDLKGMDPAVLAEKITRAGIEVEGIEYKGEGIKGVVIGHVLEREQHPNA  60

Query  60   DRLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGML  119
            D+L    V+IG   P+QI+CGAPN+  G K  VAT+GAVLPG FKIKK KLRG ES GM+
Sbjct  61   DKLNKCLVDIGAEAPVQIICGAPNVDKGQKVAVATVGAVLPGNFKIKKAKLRGEESNGMI  120

Query  120  CGASEIDLEDKI------DGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIR  173
            C   E+ +E K+      +G+   P DA  G +    L+LDD I+++ +TPNR D  ++ 
Sbjct  121  CSLQELGIESKLVAKEYAEGIFVFPNDAETGSDALAALQLDDAILELGLTPNRADAMNML  180

Query  174  GIARDLAVLNQLEVTPP--DIQAVEATLNEQKQVHLETEGA-PRYLGRIIKNVNVKATTP  230
            G+A ++A +   EV  P  D  A     ++   V +E + A P Y  +IIKNV + A +P
Sbjct  181  GVAYEVAAILDTEVKLPQTDYPAASEQASDYISVKIEDQEANPLYTAKIIKNVTI-APSP  239

Query  231  EWMAQALAASGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNG-AIHVRQASAQEKLTLL  289
             WM   L  +GIR H+ +VD+TN+VL+E GQP+HAFD  +     + VR+A+  E +  L
Sbjct  240  LWMQTKLMNAGIRPHNNVVDITNFVLLEYGQPLHAFDYDRFGSKEVVVRKAAENEMIVTL  299

Query  290  NDQNVELNEDIMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRF  349
            +DQ  +L+ D +VI +  K  A+AG+MGG ES V +DT+ I LE+A+F    +   ++  
Sbjct  300  DDQERKLSADHLVITNGTKAQAVAGVMGGAESEVQEDTKTILLEAAYFNGQKVRKASKDL  359

Query  350  GLHTDSSQRFERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQ  409
            GL ++SS RFE+G+D     LA  RA+QLI  +AGGE    TV E+  L  +   I ++ 
Sbjct  360  GLRSESSVRFEKGIDPARVRLAAERAAQLIHLYAGGEVLAGTVEED-HLTIEANNIHVSA  418

Query  410  QQVSQLLGYEVETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIH  469
             +VS +LG  +  + +     RLG  V  +A    VV  PS R DITI +DLIEE AR++
Sbjct  419  DKVSSVLGLTISKEELISIYKRLGFTVG-EADDLLVVTVPSRRGDITIEEDLIEEAARLY  477

Query  470  GYDNIQIRLPK---IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLK------LE  520
            GYDNI   LP+       L  YQ   +  ++R+ +   G  +AI++S  + K      +E
Sbjct  478  GYDNIPSTLPETAGTTGGLTPYQ--AKRRKVRRFLEGAGLSQAITYSLTNEKKATAFAIE  535

Query  521  KQLNPDVNPLALANPISSDLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNA  580
            K LN       LA P+S + +++R +L+ +L+  V +NL RQ + V  +E+G  F  +  
Sbjct  536  KSLN-----TVLALPMSEERSILRHSLVPNLLDSVSYNLARQTDSVALYEVGSVFLTKEE  590

Query  581  ASIHDLQQTPTLALIAVGSSVPEQWHGKTQPMDFFDLKHDIEQILAAGRV--KVEYVRSE  638
             +     +T  +A    G    + W G+ +P+DFF +K  +E +L    V   +E+V+SE
Sbjct  591  DT--KPVETERVAGAVTGLWRKQLWQGEKKPVDFFVVKGIVEGLLDKLNVLDSIEFVQSE  648

Query  639  RAWLHPGQSAEILIAGQSIGYLGRLHPSLENDLDLGVTWVAELDQQAILQSYVSN--FTE  696
            R  LHPG++A IL+ G  IG++G++HPSLE +LD+  T+V ELD  A+L +  +   +T 
Sbjct  649  RKQLHPGRTANILLNGSLIGFIGQVHPSLEKELDIKETYVFELDLHALLAAETAPLVYTA  708

Query  697  LSRFPSVRRDIALLISDKINVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFA  756
            + ++PSV RDIAL+    +    ++ +IK+ GG LL    +FDVY G+ +EEGK+S+AF+
Sbjct  709  IPKYPSVTRDIALVTDKTVTSGQLESVIKEAGGKLLKEVTVFDVYEGEHMEEGKKSVAFS  768

Query  757  LLWQHPSRTLEDAEIKSGMDNIIEVLENTYQATLR  791
            L + +P +TL + E+      +++ LE+TYQA LR
Sbjct  769  LQYVNPEQTLTEEEVTKAHSKVLKALEDTYQAVLR  803


> Q9AGR3 Phenylalanine--tRNA ligase beta subunit [Staphylococcus 
aureus]
Length=800

 Score =  442 bits (1137),  Expect = 4e-145
 Identities = 275/788 (35%), Positives = 432/788 (55%), Gaps = 24/788 (3%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            M IS  WL+ +V      + LA+++T  G+EVD+L    K    +VVG V + E+HPDAD
Sbjct  1    MLISNEWLKEYVTIDDSVSDLAERITRTGIEVDDLIDYTKDIKNLVVGFVKSKEKHPDAD  60

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKIKKGKLRGIESQGMLC  120
            +L V  V+IG  EP+QIVCGAPN+  G    VA +G  LPG  KIK+ KLRG  S+GM+C
Sbjct  61   KLNVCQVDIGEDEPVQIVCGAPNVDAGQYVIVAKVGGRLPGGIKIKRAKLRGERSEGMIC  120

Query  121  GASEIDLEDKI------DGLLELPEDAPVGLNIREYLKLDDNIIDISITPNRGDCFSIRG  174
               EI +           G+    E    G +  + L LDD +++  +TPNR D  S+ G
Sbjct  121  SLQEIGISSNYIPKSFESGIYVFSESQVPGTDALQALYLDDQVMEFDLTPNRADALSMIG  180

Query  175  IARDLAVLNQLEVTPPDIQA--VEATLNEQKQVHLETEG-APRYLGRIIKNVNVKATTPE  231
             A ++A L   ++T P+  +  +E + N++  V +E E   P Y  R++ +V ++  +P 
Sbjct  181  TAYEVAALYNTKMTKPETTSNELELSANDELTVTIENEDKVPYYSARVVHDVTIE-PSPI  239

Query  232  WMAQALAASGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNG-AIHVRQASAQEKLTLLN  290
            WM   L  +GIR  + +VD++NYVL+E GQP+H FD   +    I VRQA+  EK+T L+
Sbjct  240  WMQARLIKAGIRPINNVVDISNYVLLEYGQPLHMFDQDAIGSQQIVVRQANEGEKMTTLD  299

Query  291  DQNVELNEDIMVIADDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFG  350
            D   EL    +VI +    +A+AG+MGG  S V + T +I +E A F P++I   +RR  
Sbjct  300  DTERELLTSDIVITNGQTPIALAGVMGGDFSEVKEQTSNIVIEGAIFDPVSIRHTSRRLN  359

Query  351  LHTDSSQRFERGVDFELPLLAMNRASQLIQQFAGGEF--GPITVAENTALLPKREAIELN  408
            L ++SS RFE+G+  E    A++RA  L+Q +A G+     ++  E  A +     I++ 
Sbjct  360  LRSESSSRFEKGIATEFVDEAVDRACYLLQTYANGKVLKDRVSSGELGAFI---TPIDIT  416

Query  409  QQQVSQLLGYEVETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARI  468
              ++++ +G+++  + I     +LG    +       V+ PS R DITI +DLIEEVARI
Sbjct  417  ADKINRTIGFDLSQNDIVTIFNQLGFDTEIN-DDVITVLVPSRRKDITIKEDLIEEVARI  475

Query  469  HGYDNIQIRLPKID-VKLAKYQD-HLELGQLRQTIATLGYQEAISFSFADLKLEKQLN-P  525
            +GYD+I   LP  D V   +  D   +   +++ +   G  +AI++S    +     +  
Sbjct  476  YGYDDIPSTLPVFDKVTSGQLTDRQYKTRMVKEVLEGAGLDQAITYSLVSKEDATAFSMQ  535

Query  526  DVNPLALANPISSDLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHD  585
                + L  P+S   A +R +LL  LI    +N+ R+   V+ FE+G  F       + D
Sbjct  536  QRQTIDLLMPMSEAHASLRQSLLPHLIEVASYNVARKNKDVKLFEIGNVFFANGEGELPD  595

Query  586  LQQTPTLALIAVGSSVPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERAWLHPG  645
              Q   L+ I  G  V  QW GK + +DF+  K  ++++     ++  Y R++   LHPG
Sbjct  596  --QVEYLSGILTGDYVVNQWQGKKETVDFYLAKGVVDRVSEKLNLEFSYRRADIDGLHPG  653

Query  646  QSAEILIAGQSIGYLGRLHPSLENDLDLGVTWVAELDQQAILQSYVS--NFTELSRFPSV  703
            ++AEIL+  + +G++G LHP+L  D DL  T+V EL+  A++   V   N+  + RFP +
Sbjct  654  RTAEILLENKVVGFIGELHPTLAADNDLKRTYVFELNFDALMAVSVGYINYQPIPRFPGM  713

Query  704  RRDIALLISDKINVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQHPS  763
             RDIAL +   I  +D+   I   GG++L  T +FDVY G+ +E+GK+S+A  L +    
Sbjct  714  SRDIALEVDQNIPAADLLSTIHAHGGNILKDTLVFDVYQGEHLEKGKKSIAIRLNYLDTE  773

Query  764  RTLEDAEI  771
             TL D  +
Sbjct  774  ETLTDERV  781


> Q5SGX1 Phenylalanine--tRNA ligase beta subunit [Thermus thermophilus 
(strain HB8 / ATCC 27634 / DSM 579)]
Length=785

 Score =  374 bits (961),  Expect = 2e-119
 Identities = 272/802 (34%), Positives = 415/802 (52%), Gaps = 50/802 (6%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            M++  SWL+ +V        L ++L  LG E D +  V     GVV   VL  E HP   
Sbjct  1    MRVPFSWLKAYVPELESPEVLEERLAGLGFETDRIERVFPIPRGVVFARVL--EAHP-IP  57

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPG-EFKIKKGKLRGIESQGML  119
              R+  + +  G  +++V GA N R G+   +A  G  LPG   K+ +  ++G+ S GM 
Sbjct  58   GTRLKRLVLDAGRTVEVVSGAENARKGIGVALALPGTELPGLGQKVGERVIQGVRSFGMA  117

Query  120  CGASEIDLEDKIDGLLELPEDA-PVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARD  178
                E+ + +   GLLE PEDA P G  + E    ++ ++D+ +TPNR D   + G+ARD
Sbjct  118  LSPRELGVGEYGGGLLEFPEDALPPGTPLSEAWP-EEVVLDLEVTPNRPDALGLLGLARD  176

Query  179  LAVLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALA  238
            L  L    V P      EA          + EGAP +       + V A +P WM +AL 
Sbjct  177  LHALGYALVEPEAALKAEALPLPFALKVEDPEGAPHFTLGYAFGLRV-APSPLWMQRALF  235

Query  239  ASGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNE  298
            A+G+R  + +VDVTNYV++E  QPMHAFDL  +   I VR+A   E+L  L+     L+ 
Sbjct  236  AAGMRPINNVVDVTNYVMLERAQPMHAFDLRFVGEGIAVRRAREGERLKTLDGVERTLHP  295

Query  299  DIMVIA----DDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTD  354
            + +VIA    +++  L +AG+MGG ES V +DT+ I LE A F P++I   ARR GL T+
Sbjct  296  EDLVIAGWRGEESFPLGLAGVMGGAESEVREDTEAIALEVACFDPVSIRKTARRHGLRTE  355

Query  355  SSQRFERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQ  414
            +S RFERGVD    + A  RA  L+Q  AG       +   +   P  EAI    +  ++
Sbjct  356  ASHRFERGVDPLGQVPAQRRALSLLQALAGARVAEALLEAGSPKPP--EAIPFRPEYANR  413

Query  415  LLGYEV-ETDFIADALTRLGCQVAVKAQGE---WVVVAPSHRFDITIYQDLIEEVARIHG  470
            LLG    E + IA  L RLGC+V    +GE   + V  PSHR D+ + +DL+EEVARI G
Sbjct  414  LLGTSYPEAEQIA-ILKRLGCRV----EGEGPTYRVTPPSHRLDLRLEEDLVEEVARIQG  468

Query  471  YDNIQIRLPK---------IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEK  521
            Y+ I + LP          ++    K Q      +LR+ ++ LG+QE  ++SF D +  +
Sbjct  469  YETIPLALPAFFPAPDNRGVEAPYRKEQ------RLREVLSGLGFQEVYTYSFMDPEDAR  522

Query  522  QLNPDVNPLALANPISSDLAVMRSTLLSSLIPCVQHNLNRQQ-NRVRFFELGLRFDYQNA  580
            +   D   L L NP++ + A +R+ L   L+  ++ NL+  +  R   FE+G  F     
Sbjct  523  RFRLDPPRLLLLNPLAPEKAALRTHLFPGLVRVLKENLDLDRPERALLFEVGRVF-----  577

Query  581  ASIHDLQQTPTLALIAVGSSVPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERA  640
                + ++T  LA +  G  V   W  K +   +F LK  +E + A   +          
Sbjct  578  ---REREET-HLAGLLFGEGVGLPW-AKERLSGYFLLKGYLEALFARLGLAFRVEAQAFP  632

Query  641  WLHPGQSAEILIAGQSIGYLGRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRF  700
            +LHPG S  +L+ G+ +G+LG LHP +  +L+L    + EL  +  L      F + SR 
Sbjct  633  FLHPGVSGRVLVEGEEVGFLGALHPEIAQELELPPVHLFEL--RLPLPDKPLAFQDPSRH  690

Query  701  PSVRRDIALLISDKINVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQ  760
            P+  RD+A+++       +++ L+++  G  L+S  LFD+Y G  + EG +SLAF L ++
Sbjct  691  PAAFRDLAVVVPAPTPYGEVEALVREAAGPYLESLALFDLYQGPPLPEGHKSLAFHLRFR  750

Query  761  HPSRTLEDAEIKSGMDNIIEVL  782
            HP RTL D E++  +  + E L
Sbjct  751  HPKRTLRDEEVEEAVSRVAEAL  772


> P27002 Phenylalanine--tRNA ligase beta subunit [Thermus thermophilus]
Length=785

 Score =  374 bits (961),  Expect = 2e-119
 Identities = 272/802 (34%), Positives = 415/802 (52%), Gaps = 50/802 (6%)

Query  1    MKISESWLRTWVNPAIDSTTLADQLTMLGLEVDELAPVAKPFTGVVVGEVLTVEQHPDAD  60
            M++  SWL+ +V        L ++L  LG E D +  V     GVV   VL  E HP   
Sbjct  1    MRVPFSWLKAYVPELESPEVLEERLAGLGFETDRIERVFPIPRGVVFARVL--EAHP-IP  57

Query  61   RLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPG-EFKIKKGKLRGIESQGML  119
              R+  + +  G  +++V GA N R G+   +A  G  LPG   K+ +  ++G+ S GM 
Sbjct  58   GTRLKRLVLDAGRTVEVVSGAENARKGIGVALALPGTELPGLGQKVGERVIQGVRSFGMA  117

Query  120  CGASEIDLEDKIDGLLELPEDA-PVGLNIREYLKLDDNIIDISITPNRGDCFSIRGIARD  178
                E+ + +   GLLE PEDA P G  + E    ++ ++D+ +TPNR D   + G+ARD
Sbjct  118  LSPRELGVGEYGGGLLEFPEDALPPGTPLSEAWP-EEVVLDLEVTPNRPDALGLLGLARD  176

Query  179  LAVLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRIIKNVNVKATTPEWMAQALA  238
            L  L    V P      EA          + EGAP +       + V A +P WM +AL 
Sbjct  177  LHALGYALVEPEAALKAEALPLPFALKVEDPEGAPHFTLGYAFGLRV-APSPLWMQRALF  235

Query  239  ASGIRTHSILVDVTNYVLMELGQPMHAFDLAKLNGAIHVRQASAQEKLTLLNDQNVELNE  298
            A+G+R  + +VDVTNYV++E  QPMHAFDL  +   I VR+A   E+L  L+     L+ 
Sbjct  236  AAGMRPINNVVDVTNYVMLERAQPMHAFDLRFVGEGIAVRRAREGERLKTLDGVERTLHP  295

Query  299  DIMVIA----DDAKVLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTD  354
            + +VIA    +++  L +AG+MGG ES V +DT+ I LE A F P++I   ARR GL T+
Sbjct  296  EDLVIAGWRGEESFPLGLAGVMGGAESEVREDTEAIALEVACFDPVSIRKTARRHGLRTE  355

Query  355  SSQRFERGVDFELPLLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVSQ  414
            +S RFERGVD    + A  RA  L+Q  AG       +   +   P  EAI    +  ++
Sbjct  356  ASHRFERGVDPLGQVPAQRRALSLLQALAGARVAEALLEAGSPKPP--EAIPFRPEYANR  413

Query  415  LLGYEV-ETDFIADALTRLGCQVAVKAQGE---WVVVAPSHRFDITIYQDLIEEVARIHG  470
            LLG    E + IA  L RLGC+V    +GE   + V  PSHR D+ + +DL+EEVARI G
Sbjct  414  LLGTSYPEAEQIA-ILKRLGCRV----EGEGPTYRVTPPSHRLDLRLEEDLVEEVARIQG  468

Query  471  YDNIQIRLPK---------IDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEK  521
            Y+ I + LP          ++    K Q      +LR+ ++ LG+QE  ++SF D +  +
Sbjct  469  YETIPLALPAFFPAPDNRGVEAPYRKEQ------RLREVLSGLGFQEVYTYSFMDPEDAR  522

Query  522  QLNPDVNPLALANPISSDLAVMRSTLLSSLIPCVQHNLNRQQ-NRVRFFELGLRFDYQNA  580
            +   D   L L NP++ + A +R+ L   L+  ++ NL+  +  R   FE+G  F     
Sbjct  523  RFRLDPPRLLLLNPLAPEKAALRTHLFPGLVRVLKENLDLDRPERALLFEVGRVF-----  577

Query  581  ASIHDLQQTPTLALIAVGSSVPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVEYVRSERA  640
                + ++T  LA +  G  V   W  K +   +F LK  +E + A   +          
Sbjct  578  ---REREET-HLAGLLFGEGVGLPW-AKERLSGYFLLKGYLEALFARLGLAFRVEAQAFP  632

Query  641  WLHPGQSAEILIAGQSIGYLGRLHPSLENDLDLGVTWVAELDQQAILQSYVSNFTELSRF  700
            +LHPG S  +L+ G+ +G+LG LHP +  +L+L    + EL  +  L      F + SR 
Sbjct  633  FLHPGVSGRVLVEGEEVGFLGALHPEIAQELELPPVHLFEL--RLPLPDKPLAFQDPSRH  690

Query  701  PSVRRDIALLISDKINVSDIQQLIKQTGGDLLDSTWLFDVYTGQGVEEGKRSLAFALLWQ  760
            P+  RD+A+++       +++ L+++  G  L+S  LFD+Y G  + EG +SLAF L ++
Sbjct  691  PAAFRDLAVVVPAPTPYGEVEALVREAAGPYLESLALFDLYQGPPLPEGHKSLAFHLRFR  750

Query  761  HPSRTLEDAEIKSGMDNIIEVL  782
            HP RTL D E++  +  + E L
Sbjct  751  HPKRTLRDEEVEEAVSRVAEAL  772


> O34943 Putative tRNA-binding protein YtpR [Bacillus subtilis 
(strain 168)]
Length=201

 Score = 91.7 bits (226),  Expect = 3e-23
 Identities = 51/101 (50%), Positives = 64/101 (63%), Gaps = 3/101 (3%)

Query  46   VVGEVLTVEQHPDADRLRVTTVNIGNGEPLQIVCGAPNLRVGMKAPVATIGAVLPGEFKI  105
            VVG V + E+HP+AD+L V  VN+G  E LQIVCGAPN+  G K  VA +GAV+P    I
Sbjct  97   VVGYVESKEKHPNADKLSVCKVNVGE-ETLQIVCGAPNVDQGQKVVVAKVGAVMPSGLVI  155

Query  106  KKGKLRGIESQGMLCGASEIDLED--KIDGLLELPEDAPVG  144
            K  +LRG+ S GM+C A E+DL D     G+L L  D   G
Sbjct  156  KDAELRGVPSSGMICSAKELDLPDAPAEKGILVLEGDYEAG  196


> Q76KA7 Phenylalanine--tRNA ligase beta subunit [Thermococcus 
kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)]
Length=574

 Score = 75.1 bits (183),  Expect = 9e-17
 Identities = 97/457 (21%), Positives = 193/457 (42%), Gaps = 103/457 (23%)

Query  266  FDLAKLNGAIHVRQASAQEKLTLLN-DQNVELNEDI--------------------MVIA  304
            FD  K+   I+ R A   EK   L  D+ + L E +                    +++ 
Sbjct  145  FDFDKVKPPIYYRAAEKTEKFVPLGYDEEMTLEEILEKHEKGREYGHLIKDKPYYPLLVD  204

Query  305  DDAKVLAIAGIMGGLESS-VTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFERGV  363
             + KVL++  ++    +  VT +T+++F++                            G 
Sbjct  205  SEGKVLSMPPVINSETTGRVTTETKNVFVDIT--------------------------GW  238

Query  364  DFELPLLAMNRASQLIQQFAGGEFGPITVA------ENTALLPKREAIELNQQQVSQLLG  417
            D    +LA+N     + +  GG+   + V       E   L PK   +EL+   + +L G
Sbjct  239  DLNKVMLALNVVVTALAE-RGGKIKSVKVVYPDFEIETPDLTPKEFEVELDY--IRKLAG  295

Query  418  YEVETDFIADALTRLGCQVAVKAQGEWVVVAPSHRFDITIYQDLIEEVARIHGYDNIQIR  477
             E+    I + L R+  +V ++ +   +   P+ R DI   +D++E+V   +GY+ I+  
Sbjct  296  LELSDGEIKELLERMMYEVELENRRAKLRY-PAFRDDIMHARDVLEDVLIAYGYNEIEPE  354

Query  478  LPKIDV-----KLAKYQDHLELGQLRQTIATLGYQEAISFSFADLKLEKQL---------  523
             PK+ V     K  +++D      +R+ +   G QE ++F+  + + +            
Sbjct  355  EPKLAVQGRGDKFIEFED-----AVRELMVGFGLQEVMTFNLTNREAQYDRMNLPCGEHQ  409

Query  524  --------NPDVNPLALANPISSDLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRF  575
                    +P    + + NPIS   + +R+ L+ SL+  +  N + +  + + FE+G   
Sbjct  410  EECRDYFNHPPAELVEIENPISPKWSALRNWLIPSLLDFLSQNTHEEYPQ-KLFEVG---  465

Query  576  DYQNAASIHDLQQTPTLA--LIAVGSSVPEQWHGKTQPMDFFDLKHDIEQILAAGRVKVE  633
                A  I + ++T T++   +AV  + P         + F + K  +E ++     + E
Sbjct  466  ---KATLIDESRETKTVSESKLAVALAHPR--------VTFTEAKEILEGVMRHLGFEYE  514

Query  634  YVRSERAWLHPGQSAEILIAGQSIGYLGRLHPS-LEN  669
               +E     PG+  +I++ G++IG +G +HP+ LEN
Sbjct  515  LEEAEHPSFIPGRVGKIIVNGETIGVIGEIHPAVLEN  551


> Q9WUA2 Phenylalanine--tRNA ligase beta subunit [Mus musculus]
Length=589

 Score = 74.7 bits (182),  Expect = 1e-16
 Identities = 126/550 (23%), Positives = 216/550 (39%), Gaps = 76/550 (14%)

Query  160  ISITPNRGDCFSIRGIARDLAVLNQLEVTPPDIQAVEATLNEQKQVHLETEGAPRYLGRI  219
            I +  NR D   + G+AR L V  +  +  P  + V    + QK V  E     R     
Sbjct  65   IDVPANRYDLLCLEGLARGLQVFKE-RIKAPVYKRVMPKGDIQKLVITEETAKVRPFAVA  123

Query  220  IKNVNVKATTPEWMA----QALAASGIRTHSILVDVTNYVLMELGQPM-----HAFDLAK  270
                N+K T   + +    Q      I     LV +  + L  L  P         D+ K
Sbjct  124  AVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSDI-K  182

Query  271  LNGAIHVRQASAQEKLTLLNDQN--------VELNEDIMVIAD-DAKVLAIAGIMGGLES  321
                   ++ +A E + +    N        +E      VI D +  VL++  I+ G  S
Sbjct  183  FKPLNKTKEYTACELMNIYKTDNHLKHYLHIIESKPLYPVIYDSNGVVLSMPPIINGNHS  242

Query  322  SVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFERGVDFELPLLAMNRASQLIQQ  381
             +T +T++IF+E                            G DF    + ++    +  +
Sbjct  243  KITVNTRNIFIECT--------------------------GTDFTKAKIVLDIIVTMFSE  276

Query  382  FAGGEF--------GPITVAENTALLPKREAIELNQQQVSQLLGYEVETDFIADALTRLG  433
                +F         P   +     LP R+ + +    +++ +G       +A  LTR+ 
Sbjct  277  HCENQFTVEAVEVVSPNGKSSTFPELPYRKEM-VRADLINKKVGIRETPANLAKLLTRMC  335

Query  434  CQVAVKAQGEWVVVA-PSHRFDITIYQDLIEEVARIHGYDNIQIRLPKIDVKLAKYQDHL  492
             +  V   G  + V  P  R D+    D++E+ A  +GY+NIQ+ LPK      ++  + 
Sbjct  336  LKSEVIGDGNQIEVEIPPTRADVIHACDIVEDAAIAYGYNNIQMTLPKTYTIANQFPLNK  395

Query  493  ELGQLRQTIATLGYQEAISFSFADLK-LEKQLNPDVN---PLALANPISSDLAVMRSTLL  548
                LR  +A  G+ EA++F+    + +  +L  D++    + ++NP +++  V R+TLL
Sbjct  396  LTELLRLDMAAAGFTEALTFALCSQEDIADKLGLDISATKAVHISNPKTAEFQVARTTLL  455

Query  549  SSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSSVPEQWHGK  608
              L+  +  N  +    ++ FE+    D     S  D+       L AV       ++ K
Sbjct  456  PGLLKTIAAN-RKMPLPLKLFEIS---DVVVKDSGKDVGAKNYRHLCAV-------YYNK  504

Query  609  TQPMDFF-DLKHDIEQIL--AAGRVKVEYV--RSERAWLHPGQSAEILIAGQSIGYLGRL  663
            T   +    L   I Q+L    G     Y+   S  +   PG+ AEI + GQSIG LG L
Sbjct  505  TPGFEIIHGLLDRIMQLLDVPPGEESGGYMIKASAGSAFFPGRCAEIFVGGQSIGKLGVL  564

Query  664  HPSLENDLDL  673
            HP +    +L
Sbjct  565  HPDVITKFEL  574


 Score = 25.4 bits (54),  Expect = 0.23
 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 6/71 (8%)

Query  126  DLEDKIDGLLELPEDAPVGLN---IREYLKLDDNIIDISITPNRGDCFSIRGIARDLAV-  181
            DL +K  G+ E P +    L    ++  +  D N I++ I P R D      I  D A+ 
Sbjct  312  DLINKKVGIRETPANLAKLLTRMCLKSEVIGDGNQIEVEIPPTRADVIHACDIVEDAAIA  371

Query  182  --LNQLEVTPP  190
               N +++T P
Sbjct  372  YGYNNIQMTLP  382


 Score = 21.9 bits (45),  Expect = 2.6
 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 0/26 (0%)

Query  761  HPSRTLEDAEIKSGMDNIIEVLENTY  786
            H    +EDA I  G +NI   L  TY
Sbjct  360  HACDIVEDAAIAYGYNNIQMTLPKTY  385


> Q9NSD9 Phenylalanine--tRNA ligase beta subunit [Homo sapiens]
Length=589

 Score = 73.6 bits (179),  Expect = 3e-16
 Identities = 91/385 (24%), Positives = 161/385 (42%), Gaps = 60/385 (16%)

Query  309  VLAIAGIMGGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFERGVDFELP  368
            VL++  I+ G  S +T +T++IF+E                            G DF   
Sbjct  230  VLSMPPIINGDHSRITVNTRNIFIECT--------------------------GTDFTKA  263

Query  369  LLAMNRASQLIQQFAGGEFGPITVAENTALLPKREAIELNQ----------QQVSQLLGY  418
             + ++    +  ++   +F   TV     + P  ++    +            +++ +G 
Sbjct  264  KIVLDIIVTMFSEYCENQF---TVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGI  320

Query  419  EVETDFIADALTRLGCQVAVKAQGEWVVVA-PSHRFDITIYQDLIEEVARIHGYDNIQIR  477
                + +A  LTR+  +  V   G  + +  P  R DI    D++E+ A  +GY+NIQ+ 
Sbjct  321  RETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIHACDIVEDAAIAYGYNNIQMT  380

Query  478  LPKIDVKLAKYQDHLELGQLRQTIATLGYQEAISFSFADLK-LEKQLNPDVNP---LALA  533
            LPK      ++  +     LR  +A  G+ EA++F+    + +  +L  D++    + ++
Sbjct  381  LPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQEDIADKLGVDISATKAVHIS  440

Query  534  NPISSDLAVMRSTLLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLA  593
            NP +++  V R+TLL  L+  +  N  +    ++ FE+    D     S  D+       
Sbjct  441  NPKTAEFQVARTTLLPGLLKTIAAN-RKMPLPLKLFEIS---DIVIKDSNTDVGAKNYRH  496

Query  594  LIAVGSSVPEQWHGKTQPMDFFD-LKHDIEQILAA--GRVKVEYV--RSERAWLHPGQSA  648
            L AV       ++ K    +    L   I Q+L    G  K  YV   SE     PG+ A
Sbjct  497  LCAV-------YYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVIKASEGPAFFPGRCA  549

Query  649  EILIAGQSIGYLGRLHPSLENDLDL  673
            EI   GQS+G LG LHP +    +L
Sbjct  550  EIFARGQSVGKLGVLHPDVITKFEL  574


 Score = 31.6 bits (70),  Expect = 0.003
 Identities = 26/72 (36%), Positives = 34/72 (47%), Gaps = 8/72 (11%)

Query  126  DLEDKIDGLLELPEDAPVGLNIREYLKL----DDNIIDISITPNRGDCFSIRGIARDLAV  181
            DL +K  G+ E PE+    L  R YLK     D N I+I I P R D      I  D A+
Sbjct  312  DLINKKVGIRETPENL-AKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIHACDIVEDAAI  370

Query  182  ---LNQLEVTPP  190
                N +++T P
Sbjct  371  AYGYNNIQMTLP  382


 Score = 21.9 bits (45),  Expect = 2.6
 Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 0/26 (0%)

Query  761  HPSRTLEDAEIKSGMDNIIEVLENTY  786
            H    +EDA I  G +NI   L  TY
Sbjct  360  HACDIVEDAAIAYGYNNIQMTLPKTY  385


> Q9VCA5 Phenylalanine--tRNA ligase beta subunit [Drosophila melanogaster]
Length=589

 Score = 72.8 bits (177),  Expect = 5e-16
 Identities = 120/553 (22%), Positives = 231/553 (42%), Gaps = 71/553 (13%)

Query  154  DDNIIDISITPNRGDCFSIRGIARDLAVLNQLEVTPPDIQAVEATLNEQKQVHLET-EGA  212
            ++ I  I I  NR D   + G+   L V  Q ++ PP  Q VE    +  ++   T +  
Sbjct  60   EEIIYRIDIPANRYDLLCLEGLVTGLLVF-QGKLKPPKFQFVELAKRQVLKIDPSTAQIR  118

Query  213  PRYLGRIIKNVN-VKATTPEWM-AQALAASGIRTHSILVDVTNYVLMELGQPMH----AF  266
            P  +  +++NV   +A+   ++  Q      I     LV +  + L  L  P      A 
Sbjct  119  PYAVAAVLRNVTFTQASYNSFIDLQDKLHQNICRKRTLVAIGTHDLDTLQGPFSYEALAP  178

Query  267  DLAKLNGAIHVRQASAQEKLTLLNDQNVELNEDIMVIAD--------DAK--VLAIAGIM  316
            D  K       ++ +  E +   +  + +L + + +I +        DA   VL++  I+
Sbjct  179  DQIKFKPLNQTKEMTGSELMDFYST-HAQLKQYLPIIRESPVYPVIYDANRVVLSLPPII  237

Query  317  GGLESSVTDDTQDIFLESAFFAPLAIAGRARRFGLHTDSSQRFERGVDFELPLLAMNRAS  376
             G  S +T  T+++F+E                   TD ++         L  +    + 
Sbjct  238  NGDHSKITLKTKNVFIECTA----------------TDRTK-----AKVVLDTIVCLFSE  276

Query  377  QLIQQFAGGEFGPITVAENTALLPKREAIELNQQQVS-----QLLGYEVETDFIADALTR  431
               Q+F      P  V +    +     +E+ ++++S       +G +   + +AD LTR
Sbjct  277  HCAQKFT---VEPCDVVQPDGSVISYPELEVREERISVKRANAYIGIDEPAEKLADMLTR  333

Query  432  LGCQVAVKAQGEWVVVA-PSHRFDITIYQDLIEEVARIHGYDNIQIRLPKIDVKLAKYQD  490
            +   +  K  G+ +VV  P  R D+    D+ E+VA  +GY+NI+  LP       ++  
Sbjct  334  M--YLEAKVDGDSLVVKIPPTRHDVIHACDIYEDVAIAYGYNNIKKSLPAFMQIAKQFPL  391

Query  491  HLELGQLRQTIATLGYQEAISFSFADL-KLEKQLNPDVNPLA---LANPISSDLAVMRST  546
            +    QLR+ +A  G+ EA++F+      + ++LN +++ L    + NP + +  V+R+T
Sbjct  392  NKLTEQLREQVAQAGFTEALTFTLCSRDDIGRKLNKNIDALPAVHIGNPKTLEFQVVRTT  451

Query  547  LLSSLIPCVQHNLNRQQNRVRFFELGLRFDYQNAASIHDLQQTPTLALIAVGSSVPEQWH  606
            LL  L+  +  N  +    ++ FE+        +  +    +    A+    ++  E  H
Sbjct  452  LLPGLLKTLVAN-RKMPLPLKLFEISDVVVADESTEVGARNERRVCAVNCNKTAGFEVVH  510

Query  607  GKTQPMDFFDLKHDIEQIL-----AAGRVKVEYVR-SERAWLHPGQSAEILIAGQSIGYL  660
            G         L   + Q+L     +A   K  Y++ +E     PG+ A ++  G  IG +
Sbjct  511  G---------LLDRVMQLLSVPWKSASGTKGYYLQATEDPSYFPGRCANVMYDGVVIGKI  561

Query  661  GRLHPSLENDLDL  673
            G LHP++    +L
Sbjct  562  GVLHPTVLQAFEL  574


 Score = 21.2 bits (43),  Expect = 4.6
 Identities = 13/49 (27%), Positives = 23/49 (47%), Gaps = 2/49 (4%)

Query  135  LELPEDAPVGLNIREYL--KLDDNIIDISITPNRGDCFSIRGIARDLAV  181
            ++ P +    +  R YL  K+D + + + I P R D      I  D+A+
Sbjct  320  IDEPAEKLADMLTRMYLEAKVDGDSLVVKIPPTRHDVIHACDIYEDVAI  368



Lambda      K        H        a         alpha
   0.319    0.136    0.390    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10747956


  Database: 0d2832f5ed9a958c5752bf87f2a1d361.SwissProt.fasta
    Posted date:  Sep 28, 2020  2:31 PM
  Number of letters in database: 16,047
  Number of sequences in database:  22



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40