ACIAD2889 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 863f305fdc4c55f9d6b667ecc653e145.TrEMBL.fasta
           13 sequences; 4,486 total letters



Query= ACIAD2889

Length=346
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F8K3 Uncharacterized protein [Acinetobacter baylyi (strain AT...   687    0.0   
  A0A1P8EEG5 Uncharacterized protein [Acinetobacter soli]              504    0.0   
  N9BUJ5 Uncharacterized protein [Acinetobacter soli NIPH 2899]        500    0.0   
  A0A0M1I263 Uncharacterized protein [Acinetobacter sp. C15]           498    3e-180
  A0A009ZPH2 Uncharacterized protein [Acinetobacter sp. 479375]        479    2e-172
  N9DAR3 Uncharacterized protein [Acinetobacter ursingii ANC 3649]     477    8e-172
  N9SD71 Uncharacterized protein [Acinetobacter ursingii NIPH 706]     476    3e-171
  R8Y198 Uncharacterized protein [Acinetobacter calcoaceticus ANC...   409    5e-145
  D0S0Q3 Uncharacterized protein [Acinetobacter calcoaceticus RUH...   408    9e-145
  A0A0Q5FP67 Uncharacterized protein [Acinetobacter sp. Leaf130]       408    9e-145
  A0A1H8TFP6 Uncharacterized protein [Acinetobacter sp. yr461]         406    4e-144
  A0A0A8XMG4 Uncharacterized protein [Acinetobacter calcoaceticus]     406    4e-144
  T1R424 Uncharacterized protein [uncultured bacterium]               65.1    4e-15 


> Q6F8K3 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=345

 Score =  687 bits (1774),  Expect = 0.0
 Identities = 345/345 (100%), Positives = 345/345 (100%), Gaps = 0/345 (0%)

Query  1    MTKDQTSSSEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDLE  60
            MTKDQTSSSEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDLE
Sbjct  1    MTKDQTSSSEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDLE  60

Query  61   QLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLEL  120
            QLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLEL
Sbjct  61   QLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLEL  120

Query  121  EHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIKR  180
            EHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIKR
Sbjct  121  EHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIKR  180

Query  181  FSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQYISKID  240
            FSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQYISKID
Sbjct  181  FSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQYISKID  240

Query  241  PLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIKT  300
            PLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIKT
Sbjct  241  PLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIKT  300

Query  301  EALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQN  345
            EALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQN
Sbjct  301  EALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQN  345


> A0A1P8EEG5 Uncharacterized protein [Acinetobacter soli]
Length=344

 Score =  504 bits (1297),  Expect = 0.0
 Identities = 244/345 (71%), Positives = 292/345 (85%), Gaps = 1/345 (0%)

Query  1    MTKDQTSSSEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDLE  60
            MTKDQTSSS QLAQALLLEQVRY++ QL A+HS EY+QH+ HLIFQS Q L LNQV+D++
Sbjct  1    MTKDQTSSSAQLAQALLLEQVRYFKSQLCAEHSSEYLQHLSHLIFQSLQQLKLNQVIDMQ  60

Query  61   QLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLEL  120
            QL+ VV+RYA EMQLGADLLEFIGE+SKQI++SALKS STLNDL+SD QF+IWL+KFLEL
Sbjct  61   QLEMVVRRYAFEMQLGADLLEFIGEISKQIYLSALKSPSTLNDLVSDQQFDIWLAKFLEL  120

Query  121  EHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIKR  180
            +++R+Y N FLR SPAI+QLCHFIAT+ I  KLP FLQ  +  E  T    + WQQ +K 
Sbjct  121  DNIRLYFNTFLRHSPAIEQLCHFIATSAIHHKLPRFLQPASGNESSTTL-QARWQQNLKS  179

Query  181  FSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQYISKID  240
            FS K QQRIEQK+EDYLA  IQ+QLAEL++LSNDDLEDL+R +WDD+K+KTVY+YISKI+
Sbjct  180  FSHKHQQRIEQKIEDYLARLIQQQLAELSVLSNDDLEDLLRTLWDDVKDKTVYEYISKIN  239

Query  241  PLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIKT  300
            PLD+EEFFVL+YEYWKELRQQPF+QNL+LRGVEVFY FY  +TLQDL YGIGLNE DI T
Sbjct  240  PLDIEEFFVLVYEYWKELRQQPFIQNLVLRGVEVFYEFYRDDTLQDLFYGIGLNEQDIYT  299

Query  301  EALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQN  345
            E  RFYPK++R  +Q+ LLEPLL+ +L PFY R  TL+LIEQHQ+
Sbjct  300  EVQRFYPKLIRVLDQEGLLEPLLVNVLSPFYARSETLSLIEQHQS  344


> N9BUJ5 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=344

 Score =  500 bits (1288),  Expect = 0.0
 Identities = 242/345 (70%), Positives = 291/345 (84%), Gaps = 1/345 (0%)

Query  1    MTKDQTSSSEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDLE  60
            MTKDQTSSS QLAQALLLEQV Y++ QL A+HS EY+QH+ HLIFQS Q L L+QV+D++
Sbjct  1    MTKDQTSSSAQLAQALLLEQVHYFKSQLCAEHSSEYLQHLSHLIFQSLQQLKLHQVIDMQ  60

Query  61   QLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLEL  120
            QL+ VV+RYA EMQLGADLLEFIGE+SKQI++SALKS STLNDL+SD QF+IWL+KFLEL
Sbjct  61   QLEMVVRRYAFEMQLGADLLEFIGEISKQIYLSALKSPSTLNDLVSDQQFDIWLAKFLEL  120

Query  121  EHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIKR  180
            +++R Y N FLR SPAI+QLCHFIAT+ I  KLP FLQ  +  E  T   H+ WQQ +K 
Sbjct  121  DNIRFYFNTFLRHSPAIEQLCHFIATSAIHHKLPRFLQPASGNESSTTL-HARWQQSLKS  179

Query  181  FSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQYISKID  240
            FS K QQRIEQK+EDYLA  IQ+QLAEL++LSNDDLEDL+R +WDD+K+KTVY+YISKI+
Sbjct  180  FSHKHQQRIEQKIEDYLARLIQQQLAELSVLSNDDLEDLLRTLWDDVKDKTVYEYISKIN  239

Query  241  PLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIKT  300
            PLD+EEFFVL+YEYWKELRQQPF+QNL+LRGVEVFY FY  +TLQDL YGIGLNE DI T
Sbjct  240  PLDIEEFFVLVYEYWKELRQQPFIQNLVLRGVEVFYEFYRDDTLQDLFYGIGLNEQDIYT  299

Query  301  EALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQN  345
            E  RFYPK++R  +++ LLEPLL+ +L PFY R  TL+LIEQHQ+
Sbjct  300  EVQRFYPKLIRVLDREGLLEPLLVNVLSPFYARSETLSLIEQHQS  344


> A0A0M1I263 Uncharacterized protein [Acinetobacter sp. C15]
Length=344

 Score =  498 bits (1283),  Expect = 3e-180
 Identities = 241/345 (70%), Positives = 291/345 (84%), Gaps = 1/345 (0%)

Query  1    MTKDQTSSSEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDLE  60
            MTKDQTSSS QLAQALLLEQV Y++ QL A+HS EY+QH+ HLIFQS Q L L+QV+D++
Sbjct  1    MTKDQTSSSAQLAQALLLEQVHYFKSQLCAEHSSEYLQHLSHLIFQSLQQLKLHQVIDMQ  60

Query  61   QLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLEL  120
            QL+ VV+RYA EMQLGADLLEFIGE+SKQI++SALKS STLNDL+SD QF+IWL+KFLEL
Sbjct  61   QLEMVVRRYAFEMQLGADLLEFIGEISKQIYLSALKSPSTLNDLVSDQQFDIWLAKFLEL  120

Query  121  EHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIKR  180
            +++R+Y N FLR SPAI+QLCHFIAT+ I  KLP FLQ  +  E  T    + WQQ +K 
Sbjct  121  DNIRLYFNTFLRHSPAIEQLCHFIATSAIHHKLPRFLQPASGNESSTTL-QARWQQNLKS  179

Query  181  FSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQYISKID  240
            FS K QQRIEQK+EDYLA  IQ+QLAEL++LSNDDLEDL+R +WDD+K+KTVY+YISKI+
Sbjct  180  FSHKHQQRIEQKIEDYLARLIQQQLAELSVLSNDDLEDLLRTLWDDVKDKTVYEYISKIN  239

Query  241  PLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIKT  300
            PLD+EEFFVL+YEYWKELRQQPF+QNL+LRGVEVFY FY  +TLQDL YGIGLNE DI T
Sbjct  240  PLDIEEFFVLVYEYWKELRQQPFIQNLVLRGVEVFYEFYRDDTLQDLFYGIGLNEQDIYT  299

Query  301  EALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQN  345
            E  RFYPK++R  +++ LLEPLL+ +L PFY R  TL+LIEQHQ+
Sbjct  300  EVQRFYPKLIRVLDREGLLEPLLVNVLSPFYARSETLSLIEQHQS  344


> A0A009ZPH2 Uncharacterized protein [Acinetobacter sp. 479375]
Length=354

 Score =  479 bits (1232),  Expect = 2e-172
 Identities = 233/348 (67%), Positives = 291/348 (84%), Gaps = 6/348 (2%)

Query  2    TKDQT------SSSEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQ  55
            +KDQT      S SEQLAQALLLEQVRY++QQL+ +HSPEY+QHI HLIF ++Q+L L Q
Sbjct  3    SKDQTVTDQTLSPSEQLAQALLLEQVRYFKQQLTGEHSPEYLQHITHLIFNTSQHLTLGQ  62

Query  56   VVDLEQLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLS  115
            VV LEQLQ VV+RYALEMQLGA LLEFIGE++++I++  L+S++T+NDL+SD+QFEIWLS
Sbjct  63   VVSLEQLQDVVKRYALEMQLGAGLLEFIGEIAQKIYLYMLQSTATVNDLVSDYQFEIWLS  122

Query  116  KFLELEHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQ  175
            KFLEL++VRVYLN FL+ SPAI+QLC FIATTV+Q KLP      N + H  +   S W+
Sbjct  123  KFLELDNVRVYLNQFLKSSPAIRQLCQFIATTVLQNKLPVLFTTSNSKSHLPERAESEWK  182

Query  176  QRIKRFSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQY  235
            +++ +FS  QQQR+EQKLEDYLA FIQ+QLA L+ILSN+DLE LIR+IWDD+KEKT+YQY
Sbjct  183  RKLLQFSSIQQQRLEQKLEDYLAEFIQQQLAGLSILSNEDLEILIRDIWDDVKEKTIYQY  242

Query  236  ISKIDPLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNE  295
             S++ P+D+EEFFVLIYEYWKELRQ P MQNLIL GVEVFYRFYE ETLQDLL+G+GL E
Sbjct  243  ASQLKPIDIEEFFVLIYEYWKELRQSPLMQNLILHGVEVFYRFYEDETLQDLLFGVGLTE  302

Query  296  SDIKTEALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQH  343
             DI+TEALRFYPK ++A ++Q+LLEPL+  +LKPFY+R  TL +I +H
Sbjct  303  QDIQTEALRFYPKAIQALDEQDLLEPLIFNLLKPFYLRSDTLNMISKH  350


> N9DAR3 Uncharacterized protein [Acinetobacter ursingii ANC 3649]
Length=354

 Score =  477 bits (1228),  Expect = 8e-172
 Identities = 232/348 (67%), Positives = 291/348 (84%), Gaps = 6/348 (2%)

Query  2    TKDQT------SSSEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQ  55
            +KDQT      S SEQLAQALLLEQVRY++QQL+ +HSPEY+QHI HLIF ++Q+L L Q
Sbjct  3    SKDQTVTDQTLSPSEQLAQALLLEQVRYFKQQLAGEHSPEYLQHITHLIFNTSQHLTLGQ  62

Query  56   VVDLEQLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLS  115
            VV LEQLQ VV+RYALEMQLGA LLEFIGE++++I++  L+S++T+NDL+SD+QFEIWLS
Sbjct  63   VVSLEQLQDVVKRYALEMQLGAGLLEFIGEIAQKIYLYTLQSTATVNDLVSDYQFEIWLS  122

Query  116  KFLELEHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQ  175
            KFLEL++VRVYLN FL+ SPAI+QLC FIATTV+Q KLP      N +    +   S W+
Sbjct  123  KFLELDNVRVYLNQFLKSSPAIRQLCQFIATTVLQNKLPVLFTTSNSKSQLPERAESEWK  182

Query  176  QRIKRFSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQY  235
            +++++FS  QQQR+EQKLEDYLA FIQ+QLA L+ILSN+DLE LIR+IWDD+KEKT+YQY
Sbjct  183  RKLRQFSSIQQQRLEQKLEDYLAEFIQQQLAGLSILSNEDLEILIRDIWDDVKEKTIYQY  242

Query  236  ISKIDPLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNE  295
             S++ P+D+EEFFVLIYEYWKELRQ P MQNLIL GVEVFYRFYE ETLQDLL+G+GL E
Sbjct  243  ASQLKPIDIEEFFVLIYEYWKELRQSPLMQNLILHGVEVFYRFYEDETLQDLLFGVGLTE  302

Query  296  SDIKTEALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQH  343
             DI+TEALRFYPK ++A ++Q+LLEPL+  +LKPFY+R  TL +I +H
Sbjct  303  QDIQTEALRFYPKAIQALDEQDLLEPLIFNLLKPFYLRSDTLNVISKH  350


> N9SD71 Uncharacterized protein [Acinetobacter ursingii NIPH 706]
Length=354

 Score =  476 bits (1224),  Expect = 3e-171
 Identities = 232/348 (67%), Positives = 291/348 (84%), Gaps = 6/348 (2%)

Query  2    TKDQT------SSSEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQ  55
            +KDQT      S SEQLAQALLLEQVRY++QQL+ +HSPEY+QHI HLIF ++Q+L L Q
Sbjct  3    SKDQTVTDQTLSPSEQLAQALLLEQVRYFKQQLTGEHSPEYLQHITHLIFNTSQHLTLGQ  62

Query  56   VVDLEQLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLS  115
            VV LEQLQ VV+RYALEMQLGA LLEFIGE++++I++  L+S++T+NDL+SD+QFEIWLS
Sbjct  63   VVSLEQLQDVVKRYALEMQLGAGLLEFIGEIAQKIYLYTLQSTATVNDLVSDYQFEIWLS  122

Query  116  KFLELEHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQ  175
            KFLEL++VRVYLN FL+ SPAI+QLC FIATTV+Q KLP      N +    +   S W+
Sbjct  123  KFLELDNVRVYLNQFLKSSPAIRQLCQFIATTVLQNKLPVLFTTLNSKSQLPERAGSEWK  182

Query  176  QRIKRFSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQY  235
            +++++FS  QQQR+EQKLEDYLA FIQ+QLA L+ILSN+DLE LIR+IWDD+KEKT+YQY
Sbjct  183  RKLRQFSSIQQQRLEQKLEDYLAEFIQQQLAGLSILSNEDLEILIRDIWDDVKEKTIYQY  242

Query  236  ISKIDPLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNE  295
             S++ P+D+EEFFVLIYEYWKELRQ P MQNLIL GVEVFYRFYE ETLQDLL+G+GL E
Sbjct  243  ASQLKPIDIEEFFVLIYEYWKELRQSPLMQNLILHGVEVFYRFYEDETLQDLLFGVGLTE  302

Query  296  SDIKTEALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQH  343
             DI+TEALRFYPK ++A ++Q+LLEPL+  +LKPFY+R  TL +I +H
Sbjct  303  QDIQTEALRFYPKAIQALDEQDLLEPLIFNLLKPFYLRSDTLNVISKH  350


> R8Y198 Uncharacterized protein [Acinetobacter calcoaceticus ANC 
3811]
Length=342

 Score =  409 bits (1050),  Expect = 5e-145
 Identities = 199/346 (58%), Positives = 268/346 (77%), Gaps = 6/346 (2%)

Query  1    MTKDQTSS-SEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDL  59
            MT+ + SS +  LAQALLLEQV ++++QLS ++SP Y Q    L  Q    + L++VVDL
Sbjct  1    MTEQKNSSKTTTLAQALLLEQVEFFKKQLSIENSPIYFQQFIQLFMQHADEIKLHEVVDL  60

Query  60   EQLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLE  119
            EQLQAVV+RYA EMQLGA LLEFIGE++++I++SA+KS   L DL+SDHQFE+WLSKFLE
Sbjct  61   EQLQAVVKRYAFEMQLGAGLLEFIGEIAQRIYLSAMKSPIQLQDLVSDHQFEMWLSKFLE  120

Query  120  LEHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIK  179
            +EH+ +YLN FLR SP++QQLC +IAT+ +++KLP FL      ++H +     WQ ++K
Sbjct  121  MEHIPLYLNQFLRSSPSVQQLCQYIATSTLEQKLPKFLSTSRVDDYHFE-----WQHKLK  175

Query  180  RFSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQYISKI  239
            +FS  QQQR+E KLE ++A+FI EQL EL++LS++DLE LIR++W+DL+ K +Y+++ ++
Sbjct  176  KFSFLQQQRLEHKLETWIASFIHEQLTELSLLSSEDLESLIRHVWEDLRHKKMYEFMKQL  235

Query  240  DPLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIK  299
             PLDVEEFFVLIYEYWKELRQ  FMQ+LIL GVEVFY FY+ E+L ++L  IGL E+D++
Sbjct  236  TPLDVEEFFVLIYEYWKELRQSQFMQDLILYGVEVFYDFYKDESLFEVLSEIGLTETDLQ  295

Query  300  TEALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQN  345
            TEALRFYPKV+ AF +  +LEPLL  IL PFY    TL +IE+H N
Sbjct  296  TEALRFYPKVMNAFNEHGILEPLLQTILAPFYQSSKTLDIIEKHFN  341


> D0S0Q3 Uncharacterized protein [Acinetobacter calcoaceticus RUH2202]
Length=342

 Score =  408 bits (1048),  Expect = 9e-145
 Identities = 199/346 (58%), Positives = 266/346 (77%), Gaps = 6/346 (2%)

Query  1    MTKDQTSS-SEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDL  59
            MT+ + SS +  LAQALLLEQV ++++QLS ++SP Y +    L  Q    + L++VVDL
Sbjct  1    MTEQKNSSKTTTLAQALLLEQVEFFKKQLSIENSPIYFRQFIQLFMQHADEIKLHEVVDL  60

Query  60   EQLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLE  119
            EQLQAVV+RYA EMQLGA LLEFIGE++++I+++ALKS   L DL+SDHQFE+WLSKFLE
Sbjct  61   EQLQAVVKRYAFEMQLGAGLLEFIGEIAQRIYLTALKSPIQLQDLVSDHQFEMWLSKFLE  120

Query  120  LEHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIK  179
            +EH+  YLN FLR SPA+QQLC +IAT+ +++K+P FL      ++H +     WQ ++K
Sbjct  121  MEHIPHYLNQFLRTSPAVQQLCQYIATSTLEQKIPKFLNASRVDDYHFE-----WQHKLK  175

Query  180  RFSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQYISKI  239
            +FS  QQQR+E KLE ++A+FI EQL EL++LS +DLE LIR++W+DLK K +Y+++ ++
Sbjct  176  KFSFLQQQRLEHKLESWIASFIHEQLTELSLLSTEDLESLIRHVWEDLKHKKMYEFMKQL  235

Query  240  DPLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIK  299
             PLDVEEFFVLIYEYWKELRQ  FMQ+LIL GVEVFY FY+ E+L ++L  IGL E+D++
Sbjct  236  TPLDVEEFFVLIYEYWKELRQSQFMQDLILYGVEVFYEFYKDESLFEVLSEIGLTETDLQ  295

Query  300  TEALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQN  345
            TEALRFYPKV+  F +  +LEPLL  IL PFY  P TL +IE+H N
Sbjct  296  TEALRFYPKVMNVFNEHGILEPLLQAILAPFYQSPKTLDMIEKHFN  341


> A0A0Q5FP67 Uncharacterized protein [Acinetobacter sp. Leaf130]
Length=342

 Score =  408 bits (1048),  Expect = 9e-145
 Identities = 199/346 (58%), Positives = 265/346 (77%), Gaps = 6/346 (2%)

Query  1    MTKDQTSSSE-QLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDL  59
            MT+ + SS    LAQALLLEQV ++++QLS ++SP Y Q    L  Q    + L++VVDL
Sbjct  1    MTEQKNSSKTITLAQALLLEQVEFFKKQLSIENSPIYFQQFIQLFMQHADEIKLHEVVDL  60

Query  60   EQLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLE  119
            EQLQAVV+RYA EMQLGA LLEFIGE++++I++SA+KS   L DL+SDHQFE+WLSKFLE
Sbjct  61   EQLQAVVKRYAFEMQLGAGLLEFIGEIAQRIYLSAMKSPIQLQDLVSDHQFEMWLSKFLE  120

Query  120  LEHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIK  179
            +EH+  YLN FLR SPA+QQLC +IAT+ +++K+P FL      ++H +     WQ ++K
Sbjct  121  MEHIPHYLNQFLRTSPAVQQLCQYIATSTLEQKIPKFLNASRVDDYHFE-----WQHKLK  175

Query  180  RFSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQYISKI  239
            +FS  QQQR+E KLE ++A+FI EQL EL++LS +DLE LIR++W+DL+ K +Y+++ ++
Sbjct  176  KFSFLQQQRLEHKLETWIASFIHEQLTELSLLSTEDLESLIRHVWEDLRHKKMYEFMKQL  235

Query  240  DPLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIK  299
             PLDVEEFFVLIYEYWKELRQ  FMQ+LIL GVEVFY FY+ E+L ++L  IGL E+D++
Sbjct  236  TPLDVEEFFVLIYEYWKELRQSQFMQDLILYGVEVFYEFYKDESLFEVLSEIGLTETDLQ  295

Query  300  TEALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQN  345
            TEALRFYPKV+  F +  +LEPLL  IL PFY  P TL +IE+H N
Sbjct  296  TEALRFYPKVMNVFNEHGILEPLLQAILAPFYQSPKTLDMIEKHFN  341


> A0A1H8TFP6 Uncharacterized protein [Acinetobacter sp. yr461]
Length=342

 Score =  406 bits (1044),  Expect = 4e-144
 Identities = 198/346 (57%), Positives = 266/346 (77%), Gaps = 6/346 (2%)

Query  1    MTKDQTSS-SEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDL  59
            MT+ + SS +  LAQALLLEQV ++++QLS ++SP Y +    L  Q    + L++VVDL
Sbjct  1    MTEQKNSSKTTTLAQALLLEQVEFFKKQLSIENSPIYFRQFIQLFMQHADEIKLHEVVDL  60

Query  60   EQLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLE  119
            EQLQAVV+RYA EMQLGA LLEFIGE++++I+++ALKS   L DL+SDHQFE+WLSKFLE
Sbjct  61   EQLQAVVKRYAFEMQLGAGLLEFIGEIAQRIYLTALKSPIQLQDLVSDHQFEMWLSKFLE  120

Query  120  LEHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIK  179
            +EH+  YLN FLR SPA+QQLC +IAT+ +++K+P FL      ++H +     WQ ++K
Sbjct  121  MEHIPHYLNQFLRTSPAVQQLCQYIATSTLEQKIPKFLNASRVDDYHFE-----WQHKLK  175

Query  180  RFSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQYISKI  239
            +FS  QQQR+E KLE ++A+FI EQL EL++LS +DLE LIR++W+DL+ K +Y+++ ++
Sbjct  176  KFSFLQQQRLEHKLETWIASFIHEQLTELSLLSTEDLESLIRHVWEDLRHKKMYEFMKQL  235

Query  240  DPLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIK  299
             PLDVEEFFVLIYEYWKELRQ  FMQ+LIL GVEVFY FY+ E+L ++L  IGL E+D++
Sbjct  236  TPLDVEEFFVLIYEYWKELRQSQFMQDLILYGVEVFYEFYKDESLFEVLSEIGLTETDLQ  295

Query  300  TEALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQN  345
            TEALRFYPKV+  F +  +LEPLL  IL PFY  P TL +IE+H N
Sbjct  296  TEALRFYPKVMNVFNEHGILEPLLQAILAPFYQSPKTLDMIEKHFN  341


> A0A0A8XMG4 Uncharacterized protein [Acinetobacter calcoaceticus]
Length=342

 Score =  406 bits (1044),  Expect = 4e-144
 Identities = 198/346 (57%), Positives = 266/346 (77%), Gaps = 6/346 (2%)

Query  1    MTKDQTSS-SEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDL  59
            MT+ + SS +  LAQALLLEQV ++++QLS ++SP Y +    L  Q    + L++VVDL
Sbjct  1    MTEQKNSSKTTTLAQALLLEQVEFFKKQLSIENSPIYFRQFIQLFMQHADEIKLHEVVDL  60

Query  60   EQLQAVVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLE  119
            EQLQAVV+RYA EMQLGA LLEFIGE++++I+++ALKS   L DL+SDHQFE+WLSKFLE
Sbjct  61   EQLQAVVKRYAFEMQLGAGLLEFIGEIAQRIYLTALKSPIQLQDLVSDHQFEMWLSKFLE  120

Query  120  LEHVRVYLNNFLRDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIK  179
            +EH+  YLN FLR SPA+QQLC +IAT+ +++K+P FL      ++H +     WQ ++K
Sbjct  121  MEHIPHYLNQFLRTSPAVQQLCQYIATSTLEQKIPKFLNASRVDDYHFE-----WQHKLK  175

Query  180  RFSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDDLEDLIRNIWDDLKEKTVYQYISKI  239
            +FS  QQQR+E KLE ++A+FI EQL EL++LS +DLE LIR++W+DL+ K +Y+++ ++
Sbjct  176  KFSFLQQQRLEHKLETWIASFIHEQLTELSLLSTEDLESLIRHVWEDLRHKKMYEFMKQL  235

Query  240  DPLDVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIK  299
             PLDVEEFFVLIYEYWKELRQ  FMQ+LIL GVEVFY FY+ E+L ++L  IGL E+D++
Sbjct  236  TPLDVEEFFVLIYEYWKELRQSQFMQDLILYGVEVFYEFYKDESLFEVLSEIGLTETDLQ  295

Query  300  TEALRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQN  345
            TEALRFYPKV+  F +  +LEPLL  IL PFY  P TL +IE+H N
Sbjct  296  TEALRFYPKVMNVFNEHGILEPLLQTILAPFYQSPKTLDMIEKHFN  341


> T1R424 Uncharacterized protein [uncultured bacterium]
Length=337

 Score = 65.1 bits (157),  Expect = 4e-15
 Identities = 70/342 (20%), Positives = 132/342 (39%), Gaps = 21/342 (6%)

Query  12   LAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDLEQLQAVVQRYAL  71
            + + L+  Q+ +  QQ S     E IQ      +   +   L  +   EQ+  ++++  L
Sbjct  6    MIEQLIDAQLDFLDQQFSQS---ETIQQEFSQFYHWIRLQQLQHIWSFEQIYTLIEKQIL  62

Query  72   EMQLGADLLEFIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLELEHVRVYLNNFL  131
                 + L+E I E  +   I  L   +T+ ++I     +            R  L   +
Sbjct  63   NTPASSFLVEQIAEHIRFALIHPLNDETTIEEIIPVLTIDTIAQYVASKSGHRQRLIKTI  122

Query  132  RDSPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQHPHSSWQQRIKRFSLKQQQRIEQ  191
             ++PA   L     T +IQ  +  +L N    +      H      +K      +   + 
Sbjct  123  VNNPAFSALI----TQLIQHSIQDYLDNSVISKRVPGVGHF-----MKMGKSVLETVTDS  173

Query  192  KLEDYLATFIQEQLAELTILS--------NDD-LEDLIRNIWDDLKEKTVYQYISKIDPL  242
             L D +  ++Q+ + +++ +S        ND+ L     NIW  +K   V    + ++  
Sbjct  174  NLNDTVGHYLQKNILKISQMSERVLNQHFNDEKLYHFQANIWHKIKVMPVSVLKNYVEVQ  233

Query  243  DVEEFFVLIYEYWKELRQQPFMQNLILRGVEVFYRFYEHETLQDLLYGIGLNESDIKTEA  302
            D+ +   + +E W  LRQ P+M+  +  GV  +Y   +  T   LL  + +NES I+ E 
Sbjct  234  DLTQTVGMGHEIWDHLRQTPYMKQQVHDGVYAWYARNQERTFDQLLRDLNINESLIQNEL  293

Query  303  LRFYPKVLRAFEQQNLLEPLLMQILKPFYIRPATLALIEQHQ  344
                  VL+       L       L+ FY     + ++   Q
Sbjct  294  SLLLTPVLKRLIDTGYLRQRARIHLEKFYYSDQVMNILNHEQ  335



Lambda      K        H        a         alpha
   0.324    0.138    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1166400


  Database: 863f305fdc4c55f9d6b667ecc653e145.TrEMBL.fasta
    Posted date:  Oct 1, 2020  5:40 AM
  Number of letters in database: 4,486
  Number of sequences in database:  13



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40