ACIAD2889 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: d525684aecdc3c907fea2fca6e25949e.SwissProt.fasta
           3 sequences; 2,004 total letters



Query= ACIAD2889

Length=346
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P57654 ATP-dependent DNA helicase Rep [Buchnera aphidicola subs...  37.4    2e-06
  P49869 Probable nuclear hormone receptor HR38 [Drosophila melan...  37.0    3e-06
  Q9C9G7 Transcription factor MYB62 [Arabidopsis thaliana]            35.0    8e-06


> P57654 ATP-dependent DNA helicase Rep [Buchnera aphidicola subsp. 
Acyrthosiphon pisum (strain APS)]
Length=645

 Score = 37.4 bits (85),  Expect = 2e-06
 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 0/38 (0%)

Query  82   FIGEVSKQIFISALKSSSTLNDLISDHQFEIWLSKFLE  119
            FI ++ K    S LK S+ ++D++ D ++E WLSKFL+
Sbjct  456  FISKIEKFTAWSCLKPSNIIDDIVDDLEYEKWLSKFLK  493


> P49869 Probable nuclear hormone receptor HR38 [Drosophila melanogaster]
Length=1073

 Score = 37.0 bits (84),  Expect = 3e-06
 Identities = 24/83 (29%), Positives = 42/83 (51%), Gaps = 4/83 (5%)

Query  146  TTVIQKKLPGFLQNPNF---QEHHTQHPHSSWQQRIKRFSLKQQQRIEQKLEDYLATFIQ  202
            TT       G  Q+ N    Q+HH Q      QQ+ ++   +QQ+ ++Q+ +  L +  Q
Sbjct  269  TTTTSASAAGHHQHHNHLLHQQHHNQQQQQQQQQQQQQQQQQQQEHLQQQHQQQLVSPQQ  328

Query  203  EQLAELTILSNDDLEDLIRNIWD  225
              L   T+LS+++ + LI N+ D
Sbjct  329  HLLKSETLLSHEE-DQLISNLTD  350


 Score = 17.7 bits (34),  Expect = 2.8
 Identities = 7/21 (33%), Positives = 10/21 (48%), Gaps = 0/21 (0%)

Query  150  QKKLPGFLQNPNFQEHHTQHP  170
            Q+     LQ+    + H QHP
Sbjct  62   QQSHTSHLQHAQQHQTHQQHP  82


 Score = 17.7 bits (34),  Expect = 2.8
 Identities = 47/215 (22%), Positives = 78/215 (36%), Gaps = 15/215 (7%)

Query  5    QTSSSEQLAQALLLEQVRYYQQQLSADHSPEYIQHICHLIFQSTQYLNLNQVVDLEQLQA  64
            QT+S+     A      +++   L   H  +  Q       Q  Q     Q    E LQ 
Sbjct  264  QTASTTTTTSASAAGHHQHHNHLLHQQHHNQQQQQ------QQQQQQQQQQQQQQEHLQQ  317

Query  65   VVQRYALEMQLGADLLEFIGEVSKQIFISALKSSSTLN--DLISDHQFEIWLSKFLELEH  122
              Q+  +  Q      E +    +   IS L  SS ++  +L SD  F    +  L    
Sbjct  318  QHQQQLVSPQQHLLKSETLLSHEEDQLISNLTDSSVVSHSELFSDLFFPSDSNNSLLSPT  377

Query  123  VRVYLNNFLRD-SPAIQQLCHFIATTVIQKKLPGFLQNPNFQEHHTQ----HPHSSWQQR  177
               Y +N   D + +I+ L     T +  K+L    +     E   Q       SS    
Sbjct  378  TSGYPDNPAEDLTSSIENLTKL--TCLRDKRLSSIPEQQLSSEQEQQLCLLSLRSSSDPA  435

Query  178  IKRFSLKQQQRIEQKLEDYLATFIQEQLAELTILS  212
            I   + +QQQ+ +Q+ +       Q+Q  +L ++S
Sbjct  436  IALHAQQQQQQQQQQQQQQQQHQQQQQHLQLQLIS  470


> Q9C9G7 Transcription factor MYB62 [Arabidopsis thaliana]
Length=286

 Score = 35.0 bits (79),  Expect = 8e-06
 Identities = 17/55 (31%), Positives = 29/55 (53%), Gaps = 1/55 (2%)

Query  171  HSSWQQRIKRFSLKQQQRIEQKLEDYLATFIQEQLAELTILSNDD-LEDLIRNIW  224
            HS W  R  + +     R + ++++Y  T +Q+Q  +L I SN D   D +R+ W
Sbjct  89   HSKWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKQARQLNIESNSDKFFDAVRSFW  143



Lambda      K        H        a         alpha
   0.324    0.138    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 573705


  Database: d525684aecdc3c907fea2fca6e25949e.SwissProt.fasta
    Posted date:  Oct 1, 2020  6:33 AM
  Number of letters in database: 2,004
  Number of sequences in database:  3



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40