ACIAD2805 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: f2adf90550cc6c2c66fd36eb1ce23db4.TrEMBL.fasta
           8 sequences; 725 total letters



Query= ACIAD2805

Length=92
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F8S2 Uncharacterized protein [Acinetobacter baylyi (strain AT...   185    1e-65
  A0A1A7R661 Uncharacterized protein [Acinetobacter gandensis]         104    3e-34
  K9BM17 Uncharacterized protein [Acinetobacter sp. WC-323]           79.7    2e-24
  N9MIP9 Uncharacterized protein [Acinetobacter sp. ANC 4105]         75.5    7e-23
  N9QA96 Uncharacterized protein [Acinetobacter sp. NIPH 2100]        70.9    4e-21
  A0A178FXT9 Uncharacterized protein [Acinetobacter sp. SFC]          70.5    7e-21
  A0A1Y3CH48 Uncharacterized protein [Acinetobacter sp. ANC 4470]     69.7    1e-20
  A0A1Y3D7I4 Uncharacterized protein [Acinetobacter sp. ANC 4973]     68.9    2e-20


> Q6F8S2 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=91

 Score =  185 bits (469),  Expect = 1e-65
 Identities = 91/91 (100%), Positives = 91/91 (100%), Gaps = 0/91 (0%)

Query  1   MNMTLIEALVSRDQFSHEDIFFVEEPWTLHSKIQVVIMDVDGRTKIEVDGRTYLYFLEIF  60
           MNMTLIEALVSRDQFSHEDIFFVEEPWTLHSKIQVVIMDVDGRTKIEVDGRTYLYFLEIF
Sbjct  1   MNMTLIEALVSRDQFSHEDIFFVEEPWTLHSKIQVVIMDVDGRTKIEVDGRTYLYFLEIF  60

Query  61  LINELFEDLEDQNINFEEKCQRVISYAINDA  91
           LINELFEDLEDQNINFEEKCQRVISYAINDA
Sbjct  61  LINELFEDLEDQNINFEEKCQRVISYAINDA  91


> A0A1A7R661 Uncharacterized protein [Acinetobacter gandensis]
Length=88

 Score =  104 bits (260),  Expect = 3e-34
 Identities = 50/89 (56%), Positives = 66/89 (74%), Gaps = 1/89 (1%)

Query  3   MTLIEALVSRDQFSHEDIFFVEEPWTLHSKIQVVIMDVDGRTKIEVDGRTYLYFLEIFLI  62
           M LI  L   +Q S EDI FVEEPWT+ +  Q+V  + D +T I ++G+ Y YFLEIF+I
Sbjct  1   MKLINYLQQLNQKSSEDILFVEEPWTIEANTQIVTAERD-QTVININGKRYTYFLEIFII  59

Query  63  NELFEDLEDQNINFEEKCQRVISYAINDA  91
           NELFEDL+++N+ FE+KCQR+I YA NDA
Sbjct  60  NELFEDLDEENMTFEKKCQRIIEYATNDA  88


> K9BM17 Uncharacterized protein [Acinetobacter sp. WC-323]
Length=90

 Score = 79.7 bits (195),  Expect = 2e-24
 Identities = 40/90 (44%), Positives = 58/90 (64%), Gaps = 1/90 (1%)

Query  3   MTLIEALVSRDQFSHEDIFFVEEPWTLHSKIQVVIMDVDGRTKIEVDGRTYLYFLEIFLI  62
           M L+EALV  +++S E+  +  +PW L+S+  ++I   +G  +  VDGR Y YFLEIFL+
Sbjct  1   MNLLEALVQIEKYSEEETIYSAKPWILNSETIIMIEPDEGGLEFTVDGRVYSYFLEIFLV  60

Query  63  NELFEDLEDQN-INFEEKCQRVISYAINDA  91
            EL  DL  +N ++ E K  R+I YA NDA
Sbjct  61  KELLSDLAAENGLSLEGKVLRIIQYAYNDA  90


> N9MIP9 Uncharacterized protein [Acinetobacter sp. ANC 4105]
Length=89

 Score = 75.5 bits (184),  Expect = 7e-23
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 0/89 (0%)

Query  3   MTLIEALVSRDQFSHEDIFFVEEPWTLHSKIQVVIMDVDGRTKIEVDGRTYLYFLEIFLI  62
           M L + L++   +  + I +V EPW L S+  V+    DG  ++  +   + YFLE+ L+
Sbjct  1   MDLFQILLNIHDYQDDQIIYVIEPWLLESQALVLTEPQDGLIQVRYNNSIFEYFLEVLLV  60

Query  63  NELFEDLEDQNINFEEKCQRVISYAINDA  91
            ELF DLE QN+   ++CQR+I YAI DA
Sbjct  61  KELFADLESQNLCIRDQCQRIIEYAIYDA  89


> N9QA96 Uncharacterized protein [Acinetobacter sp. NIPH 2100]
Length=89

 Score = 70.9 bits (172),  Expect = 4e-21
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 0/89 (0%)

Query  3   MTLIEALVSRDQFSHEDIFFVEEPWTLHSKIQVVIMDVDGRTKIEVDGRTYLYFLEIFLI  62
           M L + L++   +  +   +  EPW L S+  V+    DG  ++  +   + YFLE+ L+
Sbjct  1   MDLFQILLNIHDYQDDQTIYAIEPWLLESQALVLKEPHDGLIQVRYNNSIFEYFLEVLLV  60

Query  63  NELFEDLEDQNINFEEKCQRVISYAINDA  91
            ELF DLE QN+   ++CQR+I YAI DA
Sbjct  61  KELFADLESQNLCIRDQCQRIIEYAIYDA  89


> A0A178FXT9 Uncharacterized protein [Acinetobacter sp. SFC]
Length=100

 Score = 70.5 bits (171),  Expect = 7e-21
 Identities = 29/85 (34%), Positives = 52/85 (61%), Gaps = 0/85 (0%)

Query  5   LIEALVSRDQFSHEDIFFVEEPWTLHSKIQVVIMDVDGRTKIEVDGRTYLYFLEIFLINE  64
           L + L++ DQF  +D  +VE PWTL S+ QV+ +       + ++ + Y YFL+I+L++E
Sbjct  15  LFQVLLNIDQFPEDDTIYVERPWTLESEAQVIHIKDKATPTVHLENKVYTYFLDIYLVDE  74

Query  65  LFEDLEDQNINFEEKCQRVISYAIN  89
           L     +QN+   +  QR++ +A+N
Sbjct  75  LVAQFANQNLCIRDTYQRIVEFAMN  99


> A0A1Y3CH48 Uncharacterized protein [Acinetobacter sp. ANC 4470]
Length=88

 Score = 69.7 bits (169),  Expect = 1e-20
 Identities = 30/89 (34%), Positives = 55/89 (62%), Gaps = 1/89 (1%)

Query  3   MTLIEALVSRDQFSHEDIFFVEEPWTLHSKIQVVIMDVDGRTKIEVDGRTYLYFLEIFLI  62
           M L   L++ +  S +   +VE PWTL S++QV+    D +  I ++ + + YFL++ +I
Sbjct  1   MDLFYVLLNINNCSEDKTLYVERPWTLESEVQVIFHSNDAKN-INIENKVFEYFLDVSVI  59

Query  63  NELFEDLEDQNINFEEKCQRVISYAINDA  91
           +ELF    +QN+   + CQR++ +A+N+A
Sbjct  60  DELFAQFANQNLCLRDTCQRIVEFALNNA  88


> A0A1Y3D7I4 Uncharacterized protein [Acinetobacter sp. ANC 4973]
Length=90

 Score = 68.9 bits (167),  Expect = 2e-20
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 1/90 (1%)

Query  3   MTLIEALVSRDQFSHEDIFFVEEPWTLHSKIQVVIMDVDGRTKIEVDGRTYLYFLEIFLI  62
           M L++ L + +++S E+  +  +PWT+ S   V++   DG  +  VD R Y YFLE FLI
Sbjct  1   MNLLKVLSNIEEYSDEETIYAVKPWTVTSDAIVMVEPNDGALEFTVDRRVYSYFLETFLI  60

Query  63  NELFEDLEDQN-INFEEKCQRVISYAINDA  91
            E   DL ++N +  E +  R+I YA NDA
Sbjct  61  KEFLSDLSEKNGLPLEGRTLRIIQYASNDA  90



Lambda      K        H        a         alpha
   0.330    0.145    0.427    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 38430


  Database: f2adf90550cc6c2c66fd36eb1ce23db4.TrEMBL.fasta
    Posted date:  Sep 21, 2020  4:15 AM
  Number of letters in database: 725
  Number of sequences in database:  8



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40