ACIAD2780 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: b4e270720f5c34f7d0418fab4f197476.TrEMBL.fasta
           22 sequences; 5,835 total letters



Query= ACIAD2780

Length=85
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A0A0A3W6D5 Integrase catalytic domain-containing protein [Acine...   158    9e-53
  A0A009F8D6 Integrase core domain protein [Acinetobacter baumann...   158    9e-53
  D4XKD6 Integrase core domain protein [Acinetobacter haemolyticu...   141    2e-47
  D0SQM1 Integrase catalytic domain-containing protein [Acinetoba...   140    3e-47
  N9PAF4 Integrase catalytic domain-containing protein [Acinetoba...   139    5e-47
  N8V3H0 Integrase catalytic domain-containing protein [Acinetoba...   139    5e-47
  A0A178GM30 Transposase [Acinetobacter sp. SFC]                       143    3e-46
  D0T0F8 IS1236 transposase [Acinetobacter lwoffii SH145]              142    8e-46
  N9P2C7 Integrase catalytic domain-containing protein [Acinetoba...   141    2e-45
  A0A2R4TGZ0 IS3 family transposase [Acinetobacter sp. WCHA45]         143    2e-45
  A0A1J4NDP9 Transposase [Acinetobacter sp. LCT-H3]                    140    2e-45
  Q43917 ORF2 gene product [Acinetobacter baylyi (strain ATCC 333...   138    3e-44
  Q43916 Putative transposase [Acinetobacter baylyi (strain ATCC ...   138    1e-43
  B0I370 Transposase [Vibrio splendidus]                              82.4    8e-24
  B0I349 Transposase [Vibrio parahaemolyticus]                        81.3    9e-23
  B0I367 Transposase [Vibrio penaeicida]                              80.1    2e-22
  B0I371 Transposase [Vibrio splendidus]                              79.0    7e-22
  G4WHZ5 Transposase OrfAB subunit B [Klebsiella pneumoniae]          73.9    1e-20
  A0A2P1JMX7 Integrase catalytic domain-containing protein [Snodg...  73.9    2e-20
  Q57113 ORF B [Erwinia amylovora]                                    73.9    2e-20
  Q3HW57 Transposase [Burkholderia cepacia]                           72.0    9e-20
  F2G2G8 Transposase IS401 [Alteromonas mediterranea (strain DSM ...  71.6    1e-19


> A0A0A3W6D5 Integrase catalytic domain-containing protein [Acinetobacter 
sp. HR7]
Length=217

 Score =  158 bits (399),  Expect = 9e-53
 Identities = 72/83 (87%), Positives = 80/83 (96%), Gaps = 0/83 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            VMLDLFSRRIVGWQTSHRIDR+LVCDAF+Y++ARQGYPTG+MVHSDQG +YCSRDFR LL
Sbjct  134  VMLDLFSRRIVGWQTSHRIDRQLVCDAFHYSMARQGYPTGVMVHSDQGSQYCSRDFRALL  193

Query  61   LTNNCLPSMSRRGLAQYTAHGIM  83
            LTN+C+ SMSRRGLAQYTAHGIM
Sbjct  194  LTNDCIQSMSRRGLAQYTAHGIM  216


 Score = 15.0 bits (27),  Expect = 9.7
 Identities = 8/19 (42%), Positives = 10/19 (53%), Gaps = 0/19 (0%)

Query  66   LPSMSRRGLAQYTAHGIMR  84
            L   SRR +   T+H I R
Sbjct  136  LDLFSRRIVGWQTSHRIDR  154


> A0A009F8D6 Integrase core domain protein [Acinetobacter baumannii 
348935]
Length=217

 Score =  158 bits (399),  Expect = 9e-53
 Identities = 72/83 (87%), Positives = 80/83 (96%), Gaps = 0/83 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            VMLDLFSRRIVGWQTSHRIDR+LVCDAF+Y++ARQGYPTG+MVHSDQG +YCSRDFR LL
Sbjct  134  VMLDLFSRRIVGWQTSHRIDRQLVCDAFHYSMARQGYPTGVMVHSDQGSQYCSRDFRALL  193

Query  61   LTNNCLPSMSRRGLAQYTAHGIM  83
            LTN+C+ SMSRRGLAQYTAHGIM
Sbjct  194  LTNDCIQSMSRRGLAQYTAHGIM  216


 Score = 15.0 bits (27),  Expect = 9.7
 Identities = 8/19 (42%), Positives = 10/19 (53%), Gaps = 0/19 (0%)

Query  66   LPSMSRRGLAQYTAHGIMR  84
            L   SRR +   T+H I R
Sbjct  136  LDLFSRRIVGWQTSHRIDR  154


> D4XKD6 Integrase core domain protein [Acinetobacter haemolyticus 
ATCC 19194]
Length=115

 Score =  141 bits (355),  Expect = 2e-47
 Identities = 70/85 (82%), Positives = 76/85 (89%), Gaps = 2/85 (2%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            VMLDLFSRRIVGWQTSHRIDR+LVCD FNYA+ARQGYPTG+MVHSDQG +Y SRDFR LL
Sbjct  32   VMLDLFSRRIVGWQTSHRIDRQLVCDTFNYAMARQGYPTGVMVHSDQGSQYFSRDFRALL  91

Query  61   LTNNCLPSMSRRGLAQYTAH-GIMR  84
            LTN+C  SMS R LAQYTAH GIM+
Sbjct  92   LTNDCTQSMS-RSLAQYTAHVGIMQ  115


> D0SQM1 Integrase catalytic domain-containing protein [Acinetobacter 
junii SH205]
Length=94

 Score =  140 bits (352),  Expect = 3e-47
 Identities = 63/73 (86%), Positives = 70/73 (96%), Gaps = 0/73 (0%)

Query  1   VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
           +MLDLFSRRIVGWQTSHRIDR+LVCDAF+YA+ARQGYPTG+MVHSDQG +YCSRDFR LL
Sbjct  1   MMLDLFSRRIVGWQTSHRIDRQLVCDAFHYAMARQGYPTGVMVHSDQGSQYCSRDFRTLL  60

Query  61  LTNNCLPSMSRRG  73
           LTNNC+ SMSRRG
Sbjct  61  LTNNCIQSMSRRG  73


 Score = 15.0 bits (27),  Expect = 8.5
 Identities = 8/19 (42%), Positives = 10/19 (53%), Gaps = 0/19 (0%)

Query  66  LPSMSRRGLAQYTAHGIMR  84
           L   SRR +   T+H I R
Sbjct  3   LDLFSRRIVGWQTSHRIDR  21


> N9PAF4 Integrase catalytic domain-containing protein [Acinetobacter 
sp. CIP 64.2]
Length=94

 Score =  139 bits (351),  Expect = 5e-47
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)

Query  2   MLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLLL  61
           MLDLFSRRIVGWQTSHRIDR+LVCDAF+YA+ARQGYPTG+MVHSDQG +YCSRDFR LLL
Sbjct  1   MLDLFSRRIVGWQTSHRIDRQLVCDAFHYAMARQGYPTGVMVHSDQGSQYCSRDFRTLLL  60

Query  62  TNNCLPSMSRRG  73
           TNNC+ SMSRRG
Sbjct  61  TNNCIQSMSRRG  72


 Score = 15.0 bits (27),  Expect = 8.5
 Identities = 8/19 (42%), Positives = 10/19 (53%), Gaps = 0/19 (0%)

Query  66  LPSMSRRGLAQYTAHGIMR  84
           L   SRR +   T+H I R
Sbjct  2   LDLFSRRIVGWQTSHRIDR  20


> N8V3H0 Integrase catalytic domain-containing protein [Acinetobacter 
sp. CIP 102082]
Length=94

 Score =  139 bits (351),  Expect = 5e-47
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)

Query  2   MLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLLL  61
           MLDLFSRRIVGWQTSHRIDR+LVCDAF+YA+ARQGYPTG+MVHSDQG +YCSRDFR LLL
Sbjct  1   MLDLFSRRIVGWQTSHRIDRQLVCDAFHYAMARQGYPTGVMVHSDQGSQYCSRDFRTLLL  60

Query  62  TNNCLPSMSRRG  73
           TNNC+ SMSRRG
Sbjct  61  TNNCIQSMSRRG  72


 Score = 15.0 bits (27),  Expect = 8.5
 Identities = 8/19 (42%), Positives = 10/19 (53%), Gaps = 0/19 (0%)

Query  66  LPSMSRRGLAQYTAHGIMR  84
           L   SRR +   T+H I R
Sbjct  2   LDLFSRRIVGWQTSHRIDR  20


> A0A178GM30 Transposase [Acinetobacter sp. SFC]
Length=283

 Score =  143 bits (360),  Expect = 3e-46
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            VMLDLFSRRIVGWQTSHRIDR+LVCDAFNYA+ARQGYPTG+MVHSDQG +YCSRDFR LL
Sbjct  134  VMLDLFSRRIVGWQTSHRIDRQLVCDAFNYAMARQGYPTGVMVHSDQGSQYCSRDFRALL  193

Query  61   LTNNCLPSMSRRG  73
            LTNNC+ SMSRRG
Sbjct  194  LTNNCIQSMSRRG  206


 Score = 15.0 bits (27),  Expect = 10.0
 Identities = 8/19 (42%), Positives = 10/19 (53%), Gaps = 0/19 (0%)

Query  66   LPSMSRRGLAQYTAHGIMR  84
            L   SRR +   T+H I R
Sbjct  136  LDLFSRRIVGWQTSHRIDR  154


> D0T0F8 IS1236 transposase [Acinetobacter lwoffii SH145]
Length=308

 Score =  142 bits (359),  Expect = 8e-46
 Identities = 65/73 (89%), Positives = 70/73 (96%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            VMLDLFSRRIVGWQTSHRID +LVCDAFNYA+ARQGYPTG+MVHSDQG +YCSRDFRVLL
Sbjct  159  VMLDLFSRRIVGWQTSHRIDHQLVCDAFNYAMARQGYPTGVMVHSDQGSQYCSRDFRVLL  218

Query  61   LTNNCLPSMSRRG  73
            LTNNC+ SMSRRG
Sbjct  219  LTNNCIQSMSRRG  231


> N9P2C7 Integrase catalytic domain-containing protein [Acinetobacter 
sp. CIP 64.7]
Length=283

 Score =  141 bits (355),  Expect = 2e-45
 Identities = 64/73 (88%), Positives = 70/73 (96%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            VMLDLFSRRIVGWQTSHRIDR+LVCDAF+YA+ARQGYPTG+MVHSDQG +YCSRDFR LL
Sbjct  134  VMLDLFSRRIVGWQTSHRIDRQLVCDAFHYAMARQGYPTGVMVHSDQGSQYCSRDFRTLL  193

Query  61   LTNNCLPSMSRRG  73
            LTNNC+ SMSRRG
Sbjct  194  LTNNCIQSMSRRG  206


 Score = 15.0 bits (27),  Expect = 10.0
 Identities = 8/19 (42%), Positives = 10/19 (53%), Gaps = 0/19 (0%)

Query  66   LPSMSRRGLAQYTAHGIMR  84
            L   SRR +   T+H I R
Sbjct  136  LDLFSRRIVGWQTSHRIDR  154


> A0A2R4TGZ0 IS3 family transposase [Acinetobacter sp. WCHA45]
Length=386

 Score =  143 bits (360),  Expect = 2e-45
 Identities = 64/73 (88%), Positives = 71/73 (97%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            VMLDLFSRRI+GWQTSHRIDR+LVCDAFNYA+ARQGYPTG+MVHSDQG +YCSRDFR+LL
Sbjct  237  VMLDLFSRRIIGWQTSHRIDRQLVCDAFNYAMARQGYPTGVMVHSDQGSQYCSRDFRMLL  296

Query  61   LTNNCLPSMSRRG  73
            LTNNC+ SMSRRG
Sbjct  297  LTNNCIQSMSRRG  309


 Score = 15.4 bits (28),  Expect = 7.5
 Identities = 8/19 (42%), Positives = 10/19 (53%), Gaps = 0/19 (0%)

Query  66   LPSMSRRGLAQYTAHGIMR  84
            L   SRR +   T+H I R
Sbjct  239  LDLFSRRIIGWQTSHRIDR  257


> A0A1J4NDP9 Transposase [Acinetobacter sp. LCT-H3]
Length=283

 Score =  140 bits (354),  Expect = 2e-45
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            VMLDLFSRRIVGWQTSHRIDR+LVCDAFNYA+ARQGYPT +MVHSDQG +YCSRDFR LL
Sbjct  134  VMLDLFSRRIVGWQTSHRIDRQLVCDAFNYAMARQGYPTSVMVHSDQGSQYCSRDFRALL  193

Query  61   LTNNCLPSMSRRG  73
            LTNNC+ SMSRRG
Sbjct  194  LTNNCIQSMSRRG  206


 Score = 15.0 bits (27),  Expect = 10.0
 Identities = 8/19 (42%), Positives = 10/19 (53%), Gaps = 0/19 (0%)

Query  66   LPSMSRRGLAQYTAHGIMR  84
            L   SRR +   T+H I R
Sbjct  136  LDLFSRRIVGWQTSHRIDR  154


> Q43917 ORF2 gene product [Acinetobacter baylyi (strain ATCC 33305 
/ BD413 / ADP1)]
Length=305

 Score =  138 bits (348),  Expect = 3e-44
 Identities = 63/73 (86%), Positives = 69/73 (95%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            VMLDLFSRRIVGWQTSHRIDR+LVCDAF+YA+ARQGYP G+MVHSDQG +YCSRDFR LL
Sbjct  156  VMLDLFSRRIVGWQTSHRIDRQLVCDAFHYAMARQGYPMGVMVHSDQGSQYCSRDFRALL  215

Query  61   LTNNCLPSMSRRG  73
            LTNNC+ SMSRRG
Sbjct  216  LTNNCVQSMSRRG  228


> Q43916 Putative transposase [Acinetobacter baylyi (strain ATCC 
33305 / BD413 / ADP1)]
Length=386

 Score =  138 bits (348),  Expect = 1e-43
 Identities = 63/73 (86%), Positives = 69/73 (95%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            VMLDLFSRRIVGWQTSHRIDR+LVCDAF+YA+ARQGYP G+MVHSDQG +YCSRDFR LL
Sbjct  237  VMLDLFSRRIVGWQTSHRIDRQLVCDAFHYAMARQGYPMGVMVHSDQGSQYCSRDFRALL  296

Query  61   LTNNCLPSMSRRG  73
            LTNNC+ SMSRRG
Sbjct  297  LTNNCVQSMSRRG  309


> B0I370 Transposase [Vibrio splendidus]
Length=200

 Score = 82.4 bits (202),  Expect = 8e-24
 Identities = 34/73 (47%), Positives = 53/73 (73%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DL+SR+++GW    R+   LVCDA + A+ R+G+P  ++ HSD+G +YCS+D+R L+
Sbjct  62   VIIDLYSRQVIGWSMDTRMTASLVCDALSMALFRRGFPEHVITHSDRGSQYCSKDYRDLI  121

Query  61   LTNNCLPSMSRRG  73
             T N   SMSR+G
Sbjct  122  STYNLKQSMSRKG  134


> B0I349 Transposase [Vibrio parahaemolyticus]
Length=383

 Score = 81.3 bits (199),  Expect = 9e-23
 Identities = 34/73 (47%), Positives = 53/73 (73%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DL+SR++VGW    ++   LVCDA + A+ R+G+P  ++VHSD+G +YCS+D+R L+
Sbjct  245  VIIDLYSRQVVGWSMDTKMTATLVCDALSMALFRRGFPEQVIVHSDRGSQYCSKDYRDLM  304

Query  61   LTNNCLPSMSRRG  73
               N   SMSR+G
Sbjct  305  TAYNLKQSMSRKG  317


> B0I367 Transposase [Vibrio penaeicida]
Length=384

 Score = 80.1 bits (196),  Expect = 2e-22
 Identities = 33/73 (45%), Positives = 52/73 (71%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DL+SR+++GW    R+   LVCDA + A+ R+G+P  + VHSD+G +YCS+D+R ++
Sbjct  246  VIIDLYSRQVIGWSMDTRMTATLVCDALSMALFRRGFPEHVTVHSDRGSQYCSKDYRDII  305

Query  61   LTNNCLPSMSRRG  73
               N   SMSR+G
Sbjct  306  SAYNLKQSMSRKG  318


> B0I371 Transposase [Vibrio splendidus]
Length=383

 Score = 79.0 bits (193),  Expect = 7e-22
 Identities = 32/73 (44%), Positives = 51/73 (70%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DL+SR+++GW    R+   L CDA + A+ R+G+P  ++ HSD+G +YCS+D+R L+
Sbjct  245  VIIDLYSRQVIGWSMDTRMTASLACDALSMALFRRGFPEQVITHSDRGSQYCSKDYRDLI  304

Query  61   LTNNCLPSMSRRG  73
               N   SMSR+G
Sbjct  305  SNYNLRQSMSRKG  317


> G4WHZ5 Transposase OrfAB subunit B [Klebsiella pneumoniae]
Length=279

 Score = 73.9 bits (180),  Expect = 1e-20
 Identities = 37/73 (51%), Positives = 45/73 (62%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DLF+R+ VGW  S   D EL C A ++A   +G P G+M HSDQG  Y SR FR LL
Sbjct  132  VVMDLFARKPVGWAMSFSPDSELTCKALSHAFESRGRPEGVMFHSDQGSHYTSRKFRQLL  191

Query  61   LTNNCLPSMSRRG  73
                   SMSRRG
Sbjct  192  WRCQITQSMSRRG  204


> A0A2P1JMX7 Integrase catalytic domain-containing protein [Snodgrassella 
alvi]
Length=285

 Score = 73.9 bits (180),  Expect = 2e-20
 Identities = 32/73 (44%), Positives = 51/73 (70%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V+LDL+SRR++GW T  R+ ++L   A N A+A +  P G + H+D+G +YC+ +++ LL
Sbjct  148  VILDLYSRRVIGWATGDRLKQDLALRALNMALALRKPPPGCIQHTDRGSQYCAHEYQKLL  207

Query  61   LTNNCLPSMSRRG  73
            L +  LPSMS +G
Sbjct  208  LKHQLLPSMSGKG  220


 Score = 15.4 bits (28),  Expect = 7.3
 Identities = 10/44 (23%), Positives = 16/44 (36%), Gaps = 3/44 (7%)

Query  13   WQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDF  56
            W+   +  R++    F Y     G+      HS  G +    DF
Sbjct  241  WRRHWQTRRDIEIAIFEYI---NGFYNPRRRHSTLGSDESPNDF  281


> Q57113 ORF B [Erwinia amylovora]
Length=285

 Score = 73.9 bits (180),  Expect = 2e-20
 Identities = 32/73 (44%), Positives = 51/73 (70%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V+LDL+SRR++GW T  R+ ++L   A N A+A +  P G + H+D+G +YC+ +++ LL
Sbjct  148  VILDLYSRRVIGWATGDRLKQDLALRALNMALALRKPPPGCIQHTDRGSQYCAHEYQKLL  207

Query  61   LTNNCLPSMSRRG  73
            L +  LPSMS +G
Sbjct  208  LKHQLLPSMSGKG  220


> Q3HW57 Transposase [Burkholderia cepacia]
Length=296

 Score = 72.0 bits (175),  Expect = 9e-20
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V+LDLFSR++VGW     +  ELV DA   A  R+    G++VHSD+G +YCSRDF+ LL
Sbjct  152  VILDLFSRQVVGWSMQPHMRTELVSDALRMAWFRRRPEAGLIVHSDRGSQYCSRDFQDLL  211

Query  61   LTNNCLPSMSRRG  73
                   SMSRRG
Sbjct  212  KGYGMRSSMSRRG  224


> F2G2G8 Transposase IS401 [Alteromonas mediterranea (strain DSM 
17117 / CIP 110805 / LMG 28347 / Deep ecotype)]
Length=275

 Score = 71.6 bits (174),  Expect = 1e-19
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DLFSR+IVGW  + R++ +LVCDA   A+ ++    G++ HSD+G +Y SR FR LL
Sbjct  132  VVIDLFSRKIVGWSMASRMNAQLVCDALTMALWQRKPKVGLIHHSDRGSQYASRQFRQLL  191

Query  61   LTNNCLPSMSRRG  73
                   SMSR+G
Sbjct  192  TQYKVTGSMSRKG  204


 Score = 15.8 bits (29),  Expect = 5.4
 Identities = 10/26 (38%), Positives = 11/26 (42%), Gaps = 9/26 (35%)

Query  24  VCDA--FNYAIARQ-------GYPTG  40
           V DA  F Y + R        GYP G
Sbjct  38  VADASDFTYGVRRMKRALNSLGYPVG  63



Lambda      K        H        a         alpha
   0.336    0.144    0.469    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 253250


  Database: b4e270720f5c34f7d0418fab4f197476.TrEMBL.fasta
    Posted date:  Sep 21, 2020  5:28 AM
  Number of letters in database: 5,835
  Number of sequences in database:  22



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40