ACIAD2780 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 4eaf0319de03674e81f26b6930a104e9.SwissProt.fasta
           15 sequences; 3,871 total letters



Query= ACIAD2780

Length=85
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P0CF82 Transposase InsF for insertion sequence IS3D [Escherichi...  69.7    4e-19
  P0CF83 Transposase InsF for insertion sequence IS3E [Escherichi...  69.7    4e-19
  P0CF84 Transposase InsF for insertion sequence IS3fA [Escherich...  69.7    4e-19
  P0CF79 Transposase InsF for insertion sequence IS3A [Escherichi...  69.7    4e-19
  P0CF85 Transposase InsF for insertion sequence IS3 [Escherichia...  69.7    4e-19
  Q9JMT3 Transposase InsF for insertion sequence IS3fB [Escherich...  69.3    5e-19
  P35878 Transposase for insertion sequence element IS904 [Lactoc...  59.3    2e-15
  P16940 Insertion element IS600 uncharacterized 31 kDa protein [...  51.2    2e-12
  P16942 Transposase for insertion sequence element IS629 [Shigel...  40.8    9e-09
  Q9JMS8 Uncharacterized protein YuaL [Escherichia coli (strain K...  36.6    4e-08
  P19769 Putative transposase InsK for insertion sequence element...  37.7    9e-08
  Q47718 Putative transposase InsO for insertion sequence element...  36.6    2e-07
  O05086 Uncharacterized transposase-like protein HI_1721 [Haemop...  36.2    3e-07
  A5TY79 Putative transposase for insertion sequence element IS98...  34.7    1e-06
  P9WKH9 Putative transposase for insertion sequence element IS98...  34.7    1e-06


> P0CF82 Transposase InsF for insertion sequence IS3D [Escherichia 
coli (strain K12)]
Length=288

 Score = 69.7 bits (169),  Expect = 4e-19
 Identities = 30/73 (41%), Positives = 48/73 (66%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DL+SR ++GW  S R+  +L CDA   A+ R+  P  ++VH+D+G +YCS D++  L
Sbjct  150  VVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQL  209

Query  61   LTNNCLPSMSRRG  73
              +N   SMS +G
Sbjct  210  KRHNLRGSMSAKG  222


> P0CF83 Transposase InsF for insertion sequence IS3E [Escherichia 
coli (strain K12)]
Length=288

 Score = 69.7 bits (169),  Expect = 4e-19
 Identities = 30/73 (41%), Positives = 48/73 (66%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DL+SR ++GW  S R+  +L CDA   A+ R+  P  ++VH+D+G +YCS D++  L
Sbjct  150  VVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQL  209

Query  61   LTNNCLPSMSRRG  73
              +N   SMS +G
Sbjct  210  KRHNLRGSMSAKG  222


> P0CF84 Transposase InsF for insertion sequence IS3fA [Escherichia 
coli (strain K12)]
Length=288

 Score = 69.7 bits (169),  Expect = 4e-19
 Identities = 30/73 (41%), Positives = 48/73 (66%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DL+SR ++GW  S R+  +L CDA   A+ R+  P  ++VH+D+G +YCS D++  L
Sbjct  150  VVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQL  209

Query  61   LTNNCLPSMSRRG  73
              +N   SMS +G
Sbjct  210  KRHNLRGSMSAKG  222


> P0CF79 Transposase InsF for insertion sequence IS3A [Escherichia 
coli (strain K12)]
Length=288

 Score = 69.7 bits (169),  Expect = 4e-19
 Identities = 30/73 (41%), Positives = 48/73 (66%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DL+SR ++GW  S R+  +L CDA   A+ R+  P  ++VH+D+G +YCS D++  L
Sbjct  150  VVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQL  209

Query  61   LTNNCLPSMSRRG  73
              +N   SMS +G
Sbjct  210  KRHNLRGSMSAKG  222


> P0CF85 Transposase InsF for insertion sequence IS3 [Escherichia 
coli O111:H-]
Length=288

 Score = 69.7 bits (169),  Expect = 4e-19
 Identities = 30/73 (41%), Positives = 48/73 (66%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DL+SR ++GW  S R+  +L CDA   A+ R+  P  ++VH+D+G +YCS D++  L
Sbjct  150  VVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQL  209

Query  61   LTNNCLPSMSRRG  73
              +N   SMS +G
Sbjct  210  KRHNLRGSMSAKG  222


> Q9JMT3 Transposase InsF for insertion sequence IS3fB [Escherichia 
coli (strain K12)]
Length=288

 Score = 69.3 bits (168),  Expect = 5e-19
 Identities = 30/73 (41%), Positives = 48/73 (66%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V++DL+SR ++GW  S R+  +L CDA   A+ R+  P  ++VH+D+G +YCS D++  L
Sbjct  150  VVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPWNVIVHTDRGGQYCSADYQAQL  209

Query  61   LTNNCLPSMSRRG  73
              +N   SMS +G
Sbjct  210  KRHNLRGSMSAKG  222


> P35878 Transposase for insertion sequence element IS904 [Lactococcus 
lactis subsp. lactis (strain IL1403)]
Length=253

 Score = 59.3 bits (142),  Expect = 2e-15
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 0/73 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            V +D+FSR+IVGW  S R+  +LV D F  A  ++    G++VH+DQG +Y S  ++  L
Sbjct  116  VNIDVFSRKIVGWSMSSRMQDKLVRDCFLQACGKEHPQPGLIVHTDQGSQYTSSRYQSTL  175

Query  61   LTNNCLPSMSRRG  73
                   SMSR+G
Sbjct  176  RQVGAQSSMSRKG  188


> P16940 Insertion element IS600 uncharacterized 31 kDa protein 
[Shigella sonnei]
Length=272

 Score = 51.2 bits (121),  Expect = 2e-12
 Identities = 25/70 (36%), Positives = 41/70 (59%), Gaps = 0/70 (0%)

Query  4    DLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLLLTN  63
            D+++  IV +    R+ +EL   A   A+  Q  P G++ HSD+G +YC+ D+RV+   +
Sbjct  134  DVYTCEIVRYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQEQS  193

Query  64   NCLPSMSRRG  73
                SMSR+G
Sbjct  194  GLKTSMSRKG  203


> P16942 Transposase for insertion sequence element IS629 [Shigella 
sonnei]
Length=296

 Score = 40.8 bits (94),  Expect = 9e-09
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query  2    MLDLFSRRIVGWQTSHRIDRELVCDAFNYAI-ARQGYPTGIMVHSDQGREYCSRDFRVLL  60
            ++D+F+  IVGW+ S  ++   V DA   A+ AR+  P+G + HSD+G +Y S  +   L
Sbjct  152  IIDVFAGYIVGWRVSSSMETTFVLDALEQALWARR--PSGTVHHSDKGSQYVSLAYTQRL  209

Query  61   LTNNCLPSMSRRG  73
                 L S    G
Sbjct  210  KEAGLLASTGSTG  222


> Q9JMS8 Uncharacterized protein YuaL [Escherichia coli (strain 
K12)]
Length=69

 Score = 36.6 bits (83),  Expect = 4e-08
 Identities = 16/32 (50%), Positives = 22/32 (69%), Gaps = 0/32 (0%)

Query  42  MVHSDQGREYCSRDFRVLLLTNNCLPSMSRRG  73
           M+HSDQG +Y S  +++LL     + SMSRRG
Sbjct  1   MLHSDQGVQYKSNKYKILLCRYEAMQSMSRRG  32


> P19769 Putative transposase InsK for insertion sequence element 
IS150 [Escherichia coli (strain K12)]
Length=283

 Score = 37.7 bits (86),  Expect = 9e-08
 Identities = 20/72 (28%), Positives = 38/72 (53%), Gaps = 0/72 (0%)

Query  2    MLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLLL  61
            ++DLF+  ++ +  S R    +V +  + A  +       ++HSDQG +Y  R ++ +L 
Sbjct  144  VIDLFNNEVISYSLSERPVMNMVENMLDQAFKKLNPHEHPVLHSDQGWQYRMRRYQNILK  203

Query  62   TNNCLPSMSRRG  73
             +    SMSR+G
Sbjct  204  EHGIKQSMSRKG  215


> Q47718 Putative transposase InsO for insertion sequence element 
IS911B [Escherichia coli (strain K12)]
Length=198

 Score = 36.6 bits (83),  Expect = 2e-07
 Identities = 18/42 (43%), Positives = 23/42 (55%), Gaps = 0/42 (0%)

Query  1    VMLDLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIM  42
            V+LDLF+R+ VGW  S   D  L   A   A   +G P G+M
Sbjct  131  VVLDLFARKPVGWAMSFSPDSRLTMKALEMAWETRGKPVGVM  172


> O05086 Uncharacterized transposase-like protein HI_1721 [Haemophilus 
influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)]
Length=216

 Score = 36.2 bits (82),  Expect = 3e-07
 Identities = 23/76 (30%), Positives = 37/76 (49%), Gaps = 1/76 (1%)

Query  4    DLFSRRIVGWQTSHRIDRELVCDAFNYAIARQGYPTGIMVHSDQGREYCSRDFRVLLLTN  63
            DLF+  I+ +  +   + E +      A+AR      I+ HSDQG +Y    ++ +L  N
Sbjct  83   DLFNNEIIAYDLARSPNFEQITRMMKQAVARLEGAKPIL-HSDQGWQYQMIGYQNILREN  141

Query  64   NCLPSMSRRGLAQYTA  79
                SMSR+G   Y +
Sbjct  142  GIQQSMSRKGNCLYNS  157


> A5TY79 Putative transposase for insertion sequence element IS986/IS6110 
[Mycobacterium tuberculosis (strain ATCC 25177 / 
H37Ra)]
Length=278

 Score = 34.7 bits (78),  Expect = 1e-06
 Identities = 23/75 (31%), Positives = 36/75 (48%), Gaps = 5/75 (7%)

Query  4    DLFSRRIVGWQTSHRIDRELVCDAFNYAI-ARQGYPT----GIMVHSDQGREYCSRDFRV  58
            D ++RRI+GW+ +  +   +V DA   AI  RQ         ++ H+D+G +Y S  F  
Sbjct  130  DAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSE  189

Query  59   LLLTNNCLPSMSRRG  73
             L      PS+   G
Sbjct  190  RLAEAGIQPSVGAVG  204


> P9WKH9 Putative transposase for insertion sequence element IS986/IS6110 
[Mycobacterium tuberculosis (strain ATCC 25618 / 
H37Rv)]
Length=278

 Score = 34.7 bits (78),  Expect = 1e-06
 Identities = 23/75 (31%), Positives = 36/75 (48%), Gaps = 5/75 (7%)

Query  4    DLFSRRIVGWQTSHRIDRELVCDAFNYAI-ARQGYPT----GIMVHSDQGREYCSRDFRV  58
            D ++RRI+GW+ +  +   +V DA   AI  RQ         ++ H+D+G +Y S  F  
Sbjct  130  DAYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSE  189

Query  59   LLLTNNCLPSMSRRG  73
             L      PS+   G
Sbjct  190  RLAEAGIQPSVGAVG  204



Lambda      K        H        a         alpha
   0.336    0.144    0.469    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 175552


  Database: 4eaf0319de03674e81f26b6930a104e9.SwissProt.fasta
    Posted date:  Sep 18, 2020  4:29 PM
  Number of letters in database: 3,871
  Number of sequences in database:  15



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40