ACIAD2739 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 882dd9d3085b5864fa23416ff0d11624.TrEMBL.fasta
           19 sequences; 4,391 total letters



Query= ACIAD2739

Length=227
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F8X9 DJ-1_PfpI domain-containing protein [Acinetobacter bayly...   458    3e-168
  A0A0M1I093 Dimethylallyltransferase [Acinetobacter sp. C15]          383    1e-138
  N9ACR5 DJ-1_PfpI domain-containing protein [Acinetobacter soli ...   383    1e-138
  A0A1P8EEM9 Type 1 glutamine amidotransferase domain-containing ...   380    1e-137
  V2UWK4 DJ-1_PfpI domain-containing protein [Acinetobacter briso...   365    1e-131
  N8TVY3 DJ-1_PfpI domain-containing protein [Acinetobacter sp. A...   365    2e-131
  A0A2V1HIT6 Type 1 glutamine amidotransferase domain-containing ...   360    1e-129
  A0A1Z9YVN0 Type 1 glutamine amidotransferase domain-containing ...   349    3e-125
  A0A0E2GNG7 Uncharacterized protein [Acinetobacter radioresisten...   342    2e-122
  A0A2T1IW07 Type 1 glutamine amidotransferase domain-containing ...   342    2e-122
  A0A062BRQ3 N-terminal domain of DJ-1_PfpI family protein [Acine...   342    2e-122
  A0A2W7NY44 Putative intracellular protease/amidase [Cupriavidus...   342    4e-122
  Q9XDF2 NonF [Streptomyces griseus subsp. griseus]                    164    8e-53 
  Q93K62 Putative PFPI-like cystein-proteinase [Enterococcus faec...   138    7e-43 
  Q9RHS1 SA2F01-3 protein [Lactococcus garvieae]                       112    4e-33 
  Q6YK78 29 kDa IgE-binging protein [Candida albicans]                 102    2e-29 
  Q8ZLR6 Glyoxalase [Salmonella typhimurium (strain LT2 / SGSC141...  42.0    4e-08 
  Q2L7J8 Uncharacterized protein [Oryza rufipogon]                    40.8    1e-07 
  A0A0Q2XKL6 Peptidase [Thermococcus thioreducens]                    39.7    2e-07 


> Q6F8X9 DJ-1_PfpI domain-containing protein [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=226

 Score =  458 bits (1178),  Expect = 3e-168
 Identities = 226/226 (100%), Positives = 226/226 (100%), Gaps = 0/226 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP
Sbjct  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE
Sbjct  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
            QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE
Sbjct  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALLKA  226
            FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALLKA
Sbjct  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALLKA  226


> A0A0M1I093 Dimethylallyltransferase [Acinetobacter sp. C15]
Length=229

 Score =  383 bits (984),  Expect = 1e-138
 Identities = 185/224 (83%), Positives = 200/224 (89%), Gaps = 0/224 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            MKIL++LTSH QLG+TG KTGFWLEEFTSPYYVFKDAGA++ LASP+GGQPPLDPKS+DP
Sbjct  1    MKILIILTSHSQLGSTGKKTGFWLEEFTSPYYVFKDAGAELVLASPQGGQPPLDPKSDDP  60

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            DAQTDSTRRF++D  AQQ LANT+ L Q+  +DFDAVFY GGHGPLWDLTND  SI LIE
Sbjct  61   DAQTDSTRRFKEDPDAQQQLANTIPLAQINPDDFDAVFYSGGHGPLWDLTNDPHSIRLIE  120

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
            Q+T   KPLGLVCHAPAVLKNVKT  G SFVKGKHVTGFSNSEE  VQLTDVVPFLIEDE
Sbjct  121  QVTQDQKPLGLVCHAPAVLKNVKTPEGGSFVKGKHVTGFSNSEEEGVQLTDVVPFLIEDE  180

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALL  224
            FKAQGAHYEKGADWQSFTV+EG L+TGQNPASSEAVAEHLL LL
Sbjct  181  FKAQGAHYEKGADWQSFTVKEGLLVTGQNPASSEAVAEHLLKLL  224


> N9ACR5 DJ-1_PfpI domain-containing protein [Acinetobacter soli 
NIPH 2899]
Length=229

 Score =  383 bits (984),  Expect = 1e-138
 Identities = 185/224 (83%), Positives = 200/224 (89%), Gaps = 0/224 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            MKIL++LTSH QLG+TG KTGFWLEEFTSPYYVFKDAGA++ LASP+GGQPPLDPKS+DP
Sbjct  1    MKILIILTSHSQLGSTGKKTGFWLEEFTSPYYVFKDAGAELVLASPQGGQPPLDPKSDDP  60

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            DAQTDSTRRF++D  AQQ LANT+ L Q+  +DFDAVFY GGHGPLWDLTND  SI LIE
Sbjct  61   DAQTDSTRRFKEDPDAQQQLANTIPLAQINPDDFDAVFYSGGHGPLWDLTNDPHSIRLIE  120

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
            Q+T   KPLGLVCHAPAVLKNVKT  G SFVKGKHVTGFSNSEE  VQLTDVVPFLIEDE
Sbjct  121  QVTQDQKPLGLVCHAPAVLKNVKTPEGGSFVKGKHVTGFSNSEEEGVQLTDVVPFLIEDE  180

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALL  224
            FKAQGAHYEKGADWQSFTV+EG L+TGQNPASSEAVAEHLL LL
Sbjct  181  FKAQGAHYEKGADWQSFTVKEGLLVTGQNPASSEAVAEHLLKLL  224


> A0A1P8EEM9 Type 1 glutamine amidotransferase domain-containing 
protein [Acinetobacter soli]
Length=229

 Score =  380 bits (977),  Expect = 1e-137
 Identities = 184/224 (82%), Positives = 199/224 (89%), Gaps = 0/224 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            MKIL++LTSH QLG+T  KTGFWLEEFTSPYYVFKDAGA++ LASP+GGQPPLDPKS+DP
Sbjct  1    MKILIILTSHSQLGSTDKKTGFWLEEFTSPYYVFKDAGAELVLASPQGGQPPLDPKSDDP  60

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            DAQTDSTRRF++D  AQQ LANT+ L Q+  +DFDAVFY GGHGPLWDLTND  SI LIE
Sbjct  61   DAQTDSTRRFKEDPDAQQQLANTIPLAQINPDDFDAVFYSGGHGPLWDLTNDPHSIRLIE  120

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
            Q+T   KPLGLVCHAPAVLKNVKT  G SFVKGKHVTGFSNSEE  VQLTDVVPFLIEDE
Sbjct  121  QVTQDQKPLGLVCHAPAVLKNVKTPEGGSFVKGKHVTGFSNSEEEGVQLTDVVPFLIEDE  180

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALL  224
            FKAQGAHYEKGADWQSFTV+EG L+TGQNPASSEAVAEHLL LL
Sbjct  181  FKAQGAHYEKGADWQSFTVKEGLLVTGQNPASSEAVAEHLLKLL  224


> V2UWK4 DJ-1_PfpI domain-containing protein [Acinetobacter brisouii 
CIP 110357]
Length=228

 Score =  365 bits (937),  Expect = 1e-131
 Identities = 179/224 (80%), Positives = 194/224 (87%), Gaps = 0/224 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            MKILMVLTSHD+LGNTGHKTGFWLEEFT+PYYVFKDAGA+ITLASP+GGQPPLDPKSN+P
Sbjct  1    MKILMVLTSHDRLGNTGHKTGFWLEEFTAPYYVFKDAGAEITLASPQGGQPPLDPKSNEP  60

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            D QTDSTRRFEQD +AQ  LANT +L +V    FDAV YPGGHGPLWDLT +  SI L+E
Sbjct  61   DFQTDSTRRFEQDAEAQALLANTHVLAEVDVTGFDAVMYPGGHGPLWDLTENAASIALLE  120

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
                  KP+GLVCHAPAVLK+VKTAAG SFV GK VTGFSNSEEAAV LT+VVPFLIEDE
Sbjct  121  YFDRASKPMGLVCHAPAVLKHVKTAAGQSFVAGKKVTGFSNSEEAAVGLTEVVPFLIEDE  180

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALL  224
            F AQGAHY+KGADWQSF V EG L+TGQNPASSEAVAE LLALL
Sbjct  181  FTAQGAHYQKGADWQSFIVSEGHLVTGQNPASSEAVAEQLLALL  224


> N8TVY3 DJ-1_PfpI domain-containing protein [Acinetobacter sp. 
ANC 3789]
Length=228

 Score =  365 bits (936),  Expect = 2e-131
 Identities = 179/224 (80%), Positives = 193/224 (86%), Gaps = 0/224 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            MKILMVLTSHD+LGNTGHKTGFWLEEFT+PYYVFKDAGA+ITLASP+GGQPPLDPKSN+P
Sbjct  1    MKILMVLTSHDRLGNTGHKTGFWLEEFTAPYYVFKDAGAEITLASPQGGQPPLDPKSNEP  60

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            D QTDSTRRFEQD +AQ  LANT  L +V    FDAV YPGGHGPLWDLT +  SI L+E
Sbjct  61   DFQTDSTRRFEQDAEAQALLANTHALAEVDVTGFDAVMYPGGHGPLWDLTENAASIALLE  120

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
                  KP+GLVCHAPAVLK VKTAAG+SFV GK VTGFSNSEEAAV LTDVVPFLIEDE
Sbjct  121  YFDRAGKPMGLVCHAPAVLKYVKTAAGESFVAGKKVTGFSNSEEAAVGLTDVVPFLIEDE  180

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALL  224
            F AQGAHY+KGADWQSF + EG L+TGQNPASSEAVAE LLALL
Sbjct  181  FTAQGAHYQKGADWQSFIITEGHLVTGQNPASSEAVAEQLLALL  224


> A0A2V1HIT6 Type 1 glutamine amidotransferase domain-containing 
protein [Serratia sp. S1B]
Length=228

 Score =  360 bits (924),  Expect = 1e-129
 Identities = 176/224 (79%), Positives = 194/224 (87%), Gaps = 0/224 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            MKILMVLTSHD+LGNTGHKTGFWLEEFT+PYYVFKDAGA+ITLASP+GGQPPLDPKSN+P
Sbjct  1    MKILMVLTSHDRLGNTGHKTGFWLEEFTAPYYVFKDAGAEITLASPQGGQPPLDPKSNEP  60

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            D QTDSTRRFEQD +A+  LA+T  L +V    FDAV YPGGHGPLWDLT +  SI L+E
Sbjct  61   DFQTDSTRRFEQDAEAKNLLAHTHALAEVDVTGFDAVMYPGGHGPLWDLTENAASIALLE  120

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
                  KP+GLVCHAPAVLK+VKTAAG+SFV GK VTGFSN+EEAAV LT+VVPFLIEDE
Sbjct  121  YFDRAAKPMGLVCHAPAVLKHVKTAAGESFVAGKKVTGFSNTEEAAVGLTEVVPFLIEDE  180

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALL  224
            F AQGAHY+KGADWQSF V EG L+TGQNPASSEAVAE LLALL
Sbjct  181  FTAQGAHYQKGADWQSFIVTEGHLVTGQNPASSEAVAEQLLALL  224


> A0A1Z9YVN0 Type 1 glutamine amidotransferase domain-containing 
protein [Acinetobacter populi]
Length=226

 Score =  349 bits (895),  Expect = 3e-125
 Identities = 171/226 (76%), Positives = 190/226 (84%), Gaps = 0/226 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            MKIL+VLTSH QLGNTG KTGFWLEEF +PYYVFKDAGA+ITLASPKGGQPPLDPKSN+P
Sbjct  1    MKILIVLTSHAQLGNTGLKTGFWLEEFAAPYYVFKDAGAEITLASPKGGQPPLDPKSNEP  60

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            D QTDSTRRF QD +AQ  LANT LL QVQ +DFDAVFYPGGHGPLWDL N+++SIELI+
Sbjct  61   DFQTDSTRRFSQDSEAQYLLANTKLLTQVQTDDFDAVFYPGGHGPLWDLVNNEQSIELIQ  120

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
            Q     KP+ LVCHAPAVLKNVK+  G++FVKGK VTGF+NSEE AVQLT VV FLIED 
Sbjct  121  QFDHEHKPIALVCHAPAVLKNVKSVTGEAFVKGKKVTGFANSEEEAVQLTQVVHFLIEDT  180

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALLKA  226
            FKAQGA YEKG DW SF + +G LIT QNPASSE  A+ LL LL+A
Sbjct  181  FKAQGADYEKGTDWHSFVLVDGHLITNQNPASSEEAAKQLLKLLEA  226


> A0A0E2GNG7 Uncharacterized protein [Acinetobacter radioresistens 
DSM 6976 = NBRC 102413 = CIP 103788]
Length=228

 Score =  342 bits (876),  Expect = 2e-122
 Identities = 168/225 (75%), Positives = 190/225 (84%), Gaps = 1/225 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            MKILMVLTSH  LGNTG KTGFWLEEF +PYYVFKDAGADITLASP GGQPPLDPKS++P
Sbjct  1    MKILMVLTSHSALGNTGKKTGFWLEEFAAPYYVFKDAGADITLASPAGGQPPLDPKSDEP  60

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            DAQT++T+RF+ D++AQQALANT +L +VQ E FDAVFYPGGHGPLWDL+ND+ S+ +++
Sbjct  61   DAQTEATQRFKADQEAQQALANTHILAEVQPEQFDAVFYPGGHGPLWDLSNDQNSLNILQ  120

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
                  KP+ LVCHAPAVLKN+ T+ G SFVKGK VTGFSNSEE AV LT+VVPFLIEDE
Sbjct  121  YFDQAQKPMALVCHAPAVLKNL-TSNGQSFVKGKKVTGFSNSEEDAVGLTEVVPFLIEDE  179

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALLK  225
            FKAQGA YEKG DWQSF + EGQLITGQNP SSE  A  LL LLK
Sbjct  180  FKAQGALYEKGPDWQSFVLVEGQLITGQNPGSSEEAAVKLLELLK  224


> A0A2T1IW07 Type 1 glutamine amidotransferase domain-containing 
protein [Acinetobacter radioresistens]
Length=228

 Score =  342 bits (876),  Expect = 2e-122
 Identities = 168/225 (75%), Positives = 190/225 (84%), Gaps = 1/225 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            MKILMVLTSH  LGNTG KTGFWLEEF +PYYVFKDAGADITLASP GGQPPLDPKS++P
Sbjct  1    MKILMVLTSHSALGNTGKKTGFWLEEFAAPYYVFKDAGADITLASPAGGQPPLDPKSDEP  60

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            DAQT++T+RF+ D++AQQALANT +L +VQ E FDAVFYPGGHGPLWDL+ND+ S+ +++
Sbjct  61   DAQTEATQRFKADQEAQQALANTHILAEVQPEQFDAVFYPGGHGPLWDLSNDQNSLNILQ  120

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
                  KP+ LVCHAPAVLKN+ T+ G SFVKGK VTGFSNSEE AV LT+VVPFLIEDE
Sbjct  121  YFDQAQKPMALVCHAPAVLKNL-TSNGQSFVKGKKVTGFSNSEEDAVGLTEVVPFLIEDE  179

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALLK  225
            FKAQGA YEKG DWQSF + EGQLITGQNP SSE  A  LL LLK
Sbjct  180  FKAQGALYEKGPDWQSFVLVEGQLITGQNPGSSEEAAVKLLELLK  224


> A0A062BRQ3 N-terminal domain of DJ-1_PfpI family protein [Acinetobacter 
sp. 263903-1]
Length=228

 Score =  342 bits (876),  Expect = 2e-122
 Identities = 168/225 (75%), Positives = 190/225 (84%), Gaps = 1/225 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            MKILMVLTSH  LGNTG KTGFWLEEF +PYYVFKDAGADITLASP GGQPPLDPKS++P
Sbjct  1    MKILMVLTSHSALGNTGKKTGFWLEEFAAPYYVFKDAGADITLASPAGGQPPLDPKSDEP  60

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            DAQT++T+RF+ D++AQQALANT +L +VQ E FDAVFYPGGHGPLWDL+ND+ S+ +++
Sbjct  61   DAQTEATQRFKADQEAQQALANTHILAEVQPEQFDAVFYPGGHGPLWDLSNDQNSLNILQ  120

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
                  KP+ LVCHAPAVLKN+ T+ G SFVKGK VTGFSNSEE AV LT+VVPFLIEDE
Sbjct  121  YFDQAQKPMALVCHAPAVLKNL-TSNGQSFVKGKKVTGFSNSEEDAVGLTEVVPFLIEDE  179

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALLK  225
            FKAQGA YEKG DWQSF + EGQLITGQNP SSE  A  LL LLK
Sbjct  180  FKAQGALYEKGPDWQSFVLVEGQLITGQNPGSSEEAAVKLLELLK  224


> A0A2W7NY44 Putative intracellular protease/amidase [Cupriavidus 
alkaliphilus]
Length=241

 Score =  342 bits (876),  Expect = 4e-122
 Identities = 165/225 (73%), Positives = 186/225 (83%), Gaps = 0/225 (0%)

Query  1    MKILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            M ILMVLTSHDQLGNTG KTGFWLEEF +PYYVF+DAGADITLASPKGGQPP+DPKS+DP
Sbjct  17   MNILMVLTSHDQLGNTGKKTGFWLEEFAAPYYVFRDAGADITLASPKGGQPPIDPKSDDP  76

Query  61   DAQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIE  120
            DAQTD+TRRF  D  AQQALA+T+ LDQV+AEDFDAVFYPGGHGPLWDL  DK+SI LIE
Sbjct  77   DAQTDATRRFRSDSAAQQALASTLTLDQVKAEDFDAVFYPGGHGPLWDLAEDKRSIALIE  136

Query  121  QITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDE  180
            Q   + KP+G VCHAP VL++VK A G   VKGK VTGF+NSEEAAVQLT+VVPFL+ED 
Sbjct  137  QFDRLGKPVGAVCHAPGVLRHVKGADGQPLVKGKEVTGFTNSEEAAVQLTEVVPFLVEDV  196

Query  181  FKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALLK  225
             KA G  + +G DW S     G+L+TGQNPASSEA AE +L LLK
Sbjct  197  LKASGGRFTRGDDWASHVAVAGRLVTGQNPASSEAGAEAVLGLLK  241


> Q9XDF2 NonF [Streptomyces griseus subsp. griseus]
Length=234

 Score =  164 bits (415),  Expect = 8e-53
 Identities = 91/225 (40%), Positives = 122/225 (54%), Gaps = 5/225 (2%)

Query  2    KILMVLTSHDQ---LGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSN  58
            KIL V++  D       T H TGFW EE  +PY  F DAG ++ +A+P G  P +D  S 
Sbjct  6    KILFVVSGADHWTLADGTAHPTGFWAEEAVAPYRAFTDAGHEVVVATPGGVVPTVDRGSL  65

Query  59   DPDAQ--TDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSI  116
             PD     +         +A + L   V L+ V  + +DAVFYPGGHGP+ DL  D  S 
Sbjct  66   APDVNGGQEGADAVAAGLEAFEELRRPVALEDVDPDVYDAVFYPGGHGPMEDLAVDPVSG  125

Query  117  ELIEQITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFL  176
             L+ ++ A  KPLG+VCH PA L       G S   G  +TGF+N+EEA     D   +L
Sbjct  126  RLLARVLASGKPLGVVCHGPAALLAATGPDGRSAFAGYRLTGFTNAEEAQAGFADKAKWL  185

Query  177  IEDEFKAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLL  221
            ++D   A GA +++G  W  F + +  LITGQNPASS  +A  LL
Sbjct  186  LQDRLVALGADFQEGEPWAPFVITDRNLITGQNPASSVPLAAELL  230


> Q93K62 Putative PFPI-like cystein-proteinase [Enterococcus faecalis]
Length=226

 Score =  138 bits (347),  Expect = 7e-43
 Identities = 79/223 (35%), Positives = 121/223 (54%), Gaps = 1/223 (0%)

Query  2    KILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDPD  61
            KIL+VLT+  +   T   TG WL E T        AG  +   SP+GG  PLDP+S    
Sbjct  3    KILVVLTNVSRYHGTEEPTGLWLGEATEFVEEVTKAGFSVDYVSPQGGYVPLDPRSMKY-  61

Query  62   AQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIEQ  121
              +     +E     ++ALA+++ L+++  +++ A+++ GGHG +WD  ++ +   +   
Sbjct  62   VDSSIMAVYESADFQERALAHSLSLEEIDPDEYAAIYFTGGHGVMWDFPDNPQLQAITRS  121

Query  122  ITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDEF  181
            +    K L  VCH  A L NVK A+G+  V  K +TGF+ +EE       VVPFL E   
Sbjct  122  LYEQGKYLTSVCHGIAGLLNVKDASGNYLVADKTITGFTTAEEILAMKKAVVPFLNETIA  181

Query  182  KAQGAHYEKGADWQSFTVREGQLITGQNPASSEAVAEHLLALL  224
            K  GA++ K   ++ F  ++G++ITGQNP S  AVA  L+  L
Sbjct  182  KEHGANFAKKRPYKEFAYQDGRIITGQNPFSVRAVARLLIQQL  224


> Q9RHS1 SA2F01-3 protein [Lactococcus garvieae]
Length=212

 Score =  112 bits (279),  Expect = 4e-33
 Identities = 67/205 (33%), Positives = 104/205 (51%), Gaps = 1/205 (0%)

Query  2    KILMVLTSHDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDPD  61
            K+L+V T+  +  NT   TG WL E        +  G      SPKGG  PLDP+S    
Sbjct  3    KVLIVETNIKRYENTDEATGLWLGESAEFVDELQKHGIAYDFVSPKGGYVPLDPRSMKYM  62

Query  62   AQTDSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIEQ  121
             +      +E      +AL  T+  ++V  +D+ A+++ GGHG +WD  ++ +   + + 
Sbjct  63   DEA-IWNIYEGQDFVDRALKKTLKPEEVIPQDYRAIYFTGGHGVMWDFPDNPEIQRIAQD  121

Query  122  ITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDEF  181
            I      L  VCH  A L ++K   G   + GK +TGF+ +EE       VVPFL E+  
Sbjct  122  IHTNGGYLTSVCHGIAGLLHLKNQEGHYIISGKKITGFTTAEEVLAGKKKVVPFLNEEVA  181

Query  182  KAQGAHYEKGADWQSFTVREGQLIT  206
            K+ GA + K   ++ F +++GQLIT
Sbjct  182  KSHGAIWCKKRFYKDFAIQDGQLIT  206


> Q6YK78 29 kDa IgE-binging protein [Candida albicans]
Length=236

 Score =  102 bits (255),  Expect = 2e-29
 Identities = 69/231 (30%), Positives = 117/231 (51%), Gaps = 10/231 (4%)

Query  1    MKILMVLTSHDQ-LGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSND  59
            +K+L+ LTS+++   + G KTG ++ E   P+ VF+  G +I LAS + G    D  S  
Sbjct  2    VKVLLALTSYNETFYSDGKKTGVFVVEALHPFEVFRKKGYEIQLAS-ETGTFGWDDHSVV  60

Query  60   PDAQTDSTRRFEQDKQAQ--QALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIE  117
            PD      +    +  ++   AL N      +   D+D  F   GHG L+D  + K   +
Sbjct  61   PDFLNGEDKEIFDNVNSEFNVALKNLKKASDLDPNDYDIFFGSAGHGTLFDYPHAKDLQK  120

Query  118  LIEQITAMDKPLGLVCHAPAVLKNVK-TAAGDSFVKGKHVTGFSNSEEAAVQLTDVVP--  174
            +   +      +  VCH PA+ +N+     G+  +KGK +TGF++  E  + +TD++   
Sbjct  121  IATTVYNKGGVVSAVCHGPAIFENLNDPKTGEPLIKGKKITGFTDIGEDILGVTDIMKKG  180

Query  175  --FLIEDEFKAQGAHY-EKGADWQSFTVREGQLITGQNPASSEAVAEHLLA  222
                I+   + +GA Y E    W +FTV +G+++TG NP S+   AE ++A
Sbjct  181  NLLTIKQVAEKEGATYIEPEGPWDNFTVTDGRIVTGVNPQSAVKTAEDVIA  231


> Q8ZLR6 Glyoxalase [Salmonella typhimurium (strain LT2 / SGSC1412 
/ ATCC 700720)]
Length=217

 Score = 42.0 bits (97),  Expect = 4e-08
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 10/67 (15%)

Query  86   LDQVQAEDFDAVFYPGGHGPLWDLTN----------DKKSIELIEQITAMDKPLGLVCHA  135
            L Q Q E+ DA+  PGG G   +L+N          D   + L + +    KPLG +C A
Sbjct  78   LSQAQPEELDALIVPGGFGAAKNLSNFASQGSECRVDSDVVALAKAMHQSGKPLGFICIA  137

Query  136  PAVLKNV  142
            PA+L  +
Sbjct  138  PAMLPKI  144


> Q2L7J8 Uncharacterized protein [Oryza rufipogon]
Length=352

 Score = 40.8 bits (94),  Expect = 1e-07
 Identities = 43/151 (28%), Positives = 62/151 (41%), Gaps = 37/151 (25%)

Query  81   ANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIEQITAMDKPLGLVCHAPAVLK  140
            A T   D V A  +DA+  PGG  P +   NDK  I L++      KP+  +CH   +L 
Sbjct  226  ALTASFDNVDASSYDALVIPGGRAPEYLALNDKV-ISLVKGFMDKAKPVASICHGQQIL-  283

Query  141  NVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIEDEFKAQGAHYEKGADW------  194
               +AAG   ++G+  T +      AV+L  V+                 GA W      
Sbjct  284  ---SAAG--VLQGRKCTAYP-----AVKLNVVLG----------------GATWLEPNPI  317

Query  195  -QSFTVREGQLITGQNPASSEAVAEHLLALL  224
             + FT  +G L+TG            L+ALL
Sbjct  318  DRCFT--DGNLVTGAAWPGHPEFISQLMALL  346


 Score = 27.3 bits (59),  Expect = 0.003
 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 0/31 (0%)

Query  109  LTNDKKSIELIEQITAMDKPLGLVCHAPAVL  139
            L  D+K ++L+ + +   KP+  VCH   +L
Sbjct  82   LAMDEKVLDLVRKFSDAKKPIASVCHGQLIL  112


> A0A0Q2XKL6 Peptidase [Thermococcus thioreducens]
Length=166

 Score = 39.7 bits (91),  Expect = 2e-07
 Identities = 18/53 (34%), Positives = 31/53 (58%), Gaps = 1/53 (2%)

Query  87   DQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIEQITAMDKPLGLVCHAPAVL  139
            ++V  ++FDA+  PGG  P     N+K +IE+  ++    KP+  +CH P +L
Sbjct  55   EEVGPDEFDALVLPGGRAPEIVRLNEK-AIEITRKMFEAGKPVASICHGPQIL  106



Lambda      K        H        a         alpha
   0.317    0.133    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 664705


  Database: 882dd9d3085b5864fa23416ff0d11624.TrEMBL.fasta
    Posted date:  Sep 19, 2020  1:14 PM
  Number of letters in database: 4,391
  Number of sequences in database:  19



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40