ACIAD2739 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: a37798bc38ff6c5902e24f4b3d56ad90.SwissProt.fasta
           10 sequences; 2,402 total letters



Query= ACIAD2739

Length=227
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q5AF03 Glyoxalase 3 [Candida albicans (strain SC5314 / ATCC MYA...   104    2e-30
  Q04432 Glutathione-independent glyoxalase HSP31 [Saccharomyces ...  92.4    5e-26
  O74914 Glutathione-independent glyoxalase hsp3101 [Schizosaccha...  84.3    4e-23
  Q09675 Glutathione-independent glyoxalase hsp3102 [Schizosaccha...  77.8    6e-21
  Q10092 Probable glutathione-independent glyoxalase hsp3104 [Sch...  75.1    4e-20
  O43084 Probable glutathione-independent glyoxalase hsp3103 [Sch...  73.6    2e-19
  Q08914 Probable glutathione-independent glyoxalase HSP33 [Sacch...  71.2    1e-18
  Q08992 Probable glutathione-independent glyoxalase HSP32 [Sacch...  70.9    1e-18
  Q04902 Probable glutathione-independent glyoxalase SNO4 [Saccha...  67.8    2e-17
  Q09918 Putative glutathione-independent glyoxalase hsp3105 [Sch...  61.2    5e-15


> Q5AF03 Glyoxalase 3 [Candida albicans (strain SC5314 / ATCC MYA-2876)]
Length=236

 Score =  104 bits (260),  Expect = 2e-30
 Identities = 70/231 (30%), Positives = 117/231 (51%), Gaps = 10/231 (4%)

Query  1    MKILMVLTSHDQ-LGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSND  59
            +K+L+ LTS+++   + G KTG ++ E   P+ VF+  G +I LAS + G    D  S  
Sbjct  2    VKVLLALTSYNETFYSDGKKTGVFVVEALHPFEVFRKKGYEIQLAS-ETGTFGWDDHSVV  60

Query  60   PDAQTDSTRRFEQDKQAQ--QALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIE  117
            PD      +    +  ++   AL N      +   D+D  F   GHG L+D  N K   +
Sbjct  61   PDFLNGEDKEIFDNVNSEFNVALKNLKKASDLDPNDYDIFFGSAGHGTLFDYPNAKDLQK  120

Query  118  LIEQITAMDKPLGLVCHAPAVLKNVK-TAAGDSFVKGKHVTGFSNSEEAAVQLTDVVP--  174
            +   +      +  VCH PA+ +N+     G+  +KGK +TGF++  E  + +TD++   
Sbjct  121  IATTVYDKGGVVSAVCHGPAIFENLNDPKTGEPLIKGKKITGFTDIGEDILGVTDIMKKG  180

Query  175  --FLIEDEFKAQGAHY-EKGADWQSFTVREGQLITGQNPASSEAVAEHLLA  222
                I+   + +GA Y E    W +FTV +G+++TG NP S+   AE ++A
Sbjct  181  NLLTIKQVAEKEGATYIEPEGPWDNFTVTDGRIVTGVNPQSAVKTAEDVIA  231


> Q04432 Glutathione-independent glyoxalase HSP31 [Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c)]
Length=237

 Score = 92.4 bits (228),  Expect = 5e-26
 Identities = 66/233 (28%), Positives = 109/233 (47%), Gaps = 10/233 (4%)

Query  2    KILMVLTSH-DQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            K+L+ LTS+ D   + G KTG ++ E   P+  F+  G ++   S + G+   D  S   
Sbjct  5    KVLLALTSYNDVFYSDGAKTGVFVVEALHPFNTFRKEGFEVDFVS-ETGKFGWDEHSLAK  63

Query  61   DAQT--DSTRRFEQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIEL  118
            D     D T    +D    + LA      +V A+D+   F   GHG L+D    K   ++
Sbjct  64   DFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADDYQIFFASAGHGTLFDYPKAKDLQDI  123

Query  119  IEQITAMDKPLGLVCHAPAVLKNV-KTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVP---  174
              +I A    +  VCH PA+   +     G   ++GK +TGF++  E  + +  ++    
Sbjct  124  ASEIYANGGVVAAVCHGPAIFDGLTDKKTGRPLIEGKSITGFTDVGETILGVDSILKAKN  183

Query  175  -FLIEDEFKAQGAHY-EKGADWQSFTVREGQLITGQNPASSEAVAEHLLALLK  225
               +ED  K  GA Y      W  +++ +G+L+TG NPAS+ + A   +  LK
Sbjct  184  LATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVNPASAHSTAVRSIDALK  236


> O74914 Glutathione-independent glyoxalase hsp3101 [Schizosaccharomyces 
pombe (strain 972 / ATCC 24843)]
Length=244

 Score = 84.3 bits (207),  Expect = 4e-23
 Identities = 65/228 (29%), Positives = 110/228 (48%), Gaps = 12/228 (5%)

Query  2    KILMVLTSH-DQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            K+L+V +S+       G  TG    E   PY VF++AG ++ L S + G+   D  S   
Sbjct  6    KVLLVASSYYGPFYPDGMNTGVHFAELLIPYQVFREAGYEVQLTS-ETGKCKFDDHSIKK  64

Query  61   DAQTDSTRRF--EQDKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIEL  118
             A  +  R     +D +   AL +    D++  ++F  +F  GGH  ++DL +      L
Sbjct  65   SALGEVERDAFDNKDNEFWYALKDIKPADKINYKEFCIMFIAGGHAAMFDLPHATNLQTL  124

Query  119  IEQITAMDKPLGLVCHAPAVL---KNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPF  175
             +QI A +  L  VCH P +L    + K+  G S V GK VT F+++ E  + ++  +  
Sbjct  125  AQQIYASNGVLAAVCHGPVMLPFVDDTKSPEGRSVVYGKKVTAFNSTGELVMGVSSALRE  184

Query  176  L----IEDEFKAQGAHY-EKGADWQSFTVREGQLITGQNPASSEAVAE  218
                 +   F+  GA + +       FT  +G+++TG NP S+++ AE
Sbjct  185  RNMQDLNSLFREAGAEFVDPPTPMSDFTQVDGRIVTGVNPMSAKSTAE  232


> Q09675 Glutathione-independent glyoxalase hsp3102 [Schizosaccharomyces 
pombe (strain 972 / ATCC 24843)]
Length=240

 Score = 77.8 bits (190),  Expect = 6e-21
 Identities = 60/218 (28%), Positives = 95/218 (44%), Gaps = 11/218 (5%)

Query  17   GHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDPDAQTDSTRRFEQDKQA  76
            G  TG    E   PY VFK AG ++   S  G     D  S +     D  R+   DK  
Sbjct  24   GKNTGVHFSELLIPYNVFKKAGFNVQFVSENGSYK-FDDHSIEESKLGDFERKVFNDKND  82

Query  77   Q--QALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELIEQITAMDKPLGLVCH  134
                 L N      +  +D+  +F  GGH  ++DL        +  ++      L  VCH
Sbjct  83   DFWTNLNNMKKASDIVGKDYQLLFVAGGHAAMFDLPKATNLQAVAREVFTNGGVLSAVCH  142

Query  135  APAVLKNVK---TAAGDSFVKGKHVTGFSNSEEAAVQLTDVVP----FLIEDEFKAQGAH  187
             P +L NVK   +  G + V  KHVT F+ + E  + + D +       + + F   GA 
Sbjct  143  GPVLLANVKNPQSVEGKTVVYHKHVTAFNKAGEEKMGVMDELKKRGMKSLNEIFAEAGAT  202

Query  188  Y-EKGADWQSFTVREGQLITGQNPASSEAVAEHLLALL  224
            + +      +FT  +G+++TG NP S+++ AE  ++ L
Sbjct  203  FIDPPNPNVNFTQIDGKIVTGVNPQSAKSTAEAAVSAL  240


> Q10092 Probable glutathione-independent glyoxalase hsp3104 [Schizosaccharomyces 
pombe (strain 972 / ATCC 24843)]
Length=222

 Score = 75.1 bits (183),  Expect = 4e-20
 Identities = 52/183 (28%), Positives = 84/183 (46%), Gaps = 13/183 (7%)

Query  54   DPKSNDPDAQTDSTRRFEQDKQAQ--QALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTN  111
            D  S    A +DS +   +DK     +A+ N      +   D+   F  GGHG L+D  +
Sbjct  43   DDHSISDSALSDSDKNAFKDKNNDFWKAIKNAKNASDINFSDYSIFFAAGGHGTLFDFPS  102

Query  112  DKKSIELIEQITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTD  171
                 +   +I +M   +  VCH P +L  +K + G S VKGK VT F+   E A Q  +
Sbjct  103  ATNLHKGAAKIYSMGGVIAAVCHGPVILPCIKDSTGFSIVKGKTVTAFN---EIAEQQMN  159

Query  172  VVPFLIEDEFKAQGAHYEKGAD--------WQSFTVREGQLITGQNPASSEAVAEHLLAL  223
            ++P   +  FK     +++           +  F   +G+L+TG NPAS+ + A+  L  
Sbjct  160  LMPTFEKYHFKTLNKLFQEAGSNFVDPQEPFDDFVKTDGKLVTGANPASAASTAKAALNS  219

Query  224  LKA  226
            L +
Sbjct  220  LNS  222


> O43084 Probable glutathione-independent glyoxalase hsp3103 [Schizosaccharomyces 
pombe (strain 972 / ATCC 24843)]
Length=261

 Score = 73.6 bits (179),  Expect = 2e-19
 Identities = 62/239 (26%), Positives = 101/239 (42%), Gaps = 31/239 (13%)

Query  17   GHKTGFWLEEFTSPYYVFKDAGADITLASPKG---------GQPPLDPKS--------ND  59
            G  TG +  E   PY VF+DA  ++ + +  G           P +D  S        +D
Sbjct  23   GENTGAFFLELLHPYLVFRDACFNVDIVTESGKIQFDDHSVAGPAIDKGSKGEEFLSYDD  82

Query  60   PDAQTDSTRRFEQ------DKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDK  113
              A      + E+      D    + + N+   D+V  + +D  F  GGH  L+D     
Sbjct  83   HIASGPELSKAEKYVLENKDDMFWRIVQNSKTADEVNPDKYDIFFVAGGHATLFDFPKAT  142

Query  114  KSIELIEQITAMDKPLGLVCHAPAVLKNVKTAAGD---SFVKGKHVTGFSNSEEAAVQLT  170
               +L   I      +  VCH P +L  +K    D   S V GK VT F    E   +L 
Sbjct  143  NLQKLGTSIYENGGVVAAVCHGPTLLPFMKRQTSDGSVSIVCGKDVTAFDRVAEDKSKLM  202

Query  171  DVVP----FLIEDEFKAQGAHYEKGAD-WQSFTVREGQLITGQNPASSEAVAEHLLALL  224
            + +      +++D     GA++ K  + +  F + +G+L+TG NPAS+ + A+  L +L
Sbjct  203  EALKKYNLEVLDDMLNDAGANFIKSPNPFGDFVIADGRLVTGSNPASATSTAKTALRVL  261


> Q08914 Probable glutathione-independent glyoxalase HSP33 [Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c)]
Length=237

 Score = 71.2 bits (173),  Expect = 1e-18
 Identities = 62/225 (28%), Positives = 98/225 (44%), Gaps = 18/225 (8%)

Query  2    KILMVLTS-HDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGG---QPPLDPKS  57
            + L+ LTS H      G KTG ++ E    +  F+  G ++   S  GG        PKS
Sbjct  5    RALISLTSYHGPFYKDGAKTGVFVVEILRSFDTFEKHGFEVDFVSETGGFGWDEHYLPKS  64

Query  58   NDPDAQTDSTRRFEQDKQA-QQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSI  116
                   +    FE    A  +ALA     ++V A D+   F   GHG L+D    K   
Sbjct  65   F---IGGEDKMNFETKNSAFNKALARIKTANEVNASDYKVFFASAGHGALFDYPKAKNLQ  121

Query  117  ELIEQITAMDKPLGLVCHAPAV---LKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVV  173
            ++  +I A    +  +CH P +   L ++KT      ++GK +TGF    E A+ + D++
Sbjct  122  DIASKIYANGGVIAAICHGPLLFDGLIDIKTTR--PLIEGKAITGFPLEGEIALGVDDIL  179

Query  174  P----FLIEDEFKAQGAHYEKGA-DWQSFTVREGQLITGQNPASS  213
                   +E      GA Y      W  +++ +G+L+TG N  SS
Sbjct  180  RSRKLTTVERVANKNGAKYLAPIHPWDDYSITDGKLVTGVNANSS  224


> Q08992 Probable glutathione-independent glyoxalase HSP32 [Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c)]
Length=237

 Score = 70.9 bits (172),  Expect = 1e-18
 Identities = 62/225 (28%), Positives = 98/225 (44%), Gaps = 18/225 (8%)

Query  2    KILMVLTS-HDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGG---QPPLDPKS  57
            + L+ LTS H      G KTG ++ E    +  F+  G ++   S  GG        PKS
Sbjct  5    RALISLTSYHGPFYKDGAKTGVFVVEILRSFDTFEKHGFEVDFVSETGGFGWDEHYLPKS  64

Query  58   NDPDAQTDSTRRFEQDKQA-QQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSI  116
                   +    FE    A  +ALA     ++V A D+   F   GHG L+D    K   
Sbjct  65   F---IGGEDKMNFETKNSAFNKALARIKTANEVNASDYKIFFASAGHGALFDYPKAKNLQ  121

Query  117  ELIEQITAMDKPLGLVCHAPAV---LKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVV  173
            ++  +I A    +  +CH P +   L ++KT      ++GK +TGF    E A+ + D++
Sbjct  122  DIASKIYANGGVIAAICHGPLLFDGLIDIKTTR--PLIEGKAITGFPLEGEIALGVDDIL  179

Query  174  P----FLIEDEFKAQGAHYEKGA-DWQSFTVREGQLITGQNPASS  213
                   +E      GA Y      W  +++ +G+L+TG N  SS
Sbjct  180  RSRKLTTVERVANKNGAKYLAPIHPWDDYSITDGKLVTGVNANSS  224


> Q04902 Probable glutathione-independent glyoxalase SNO4 [Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c)]
Length=237

 Score = 67.8 bits (164),  Expect = 2e-17
 Identities = 61/225 (27%), Positives = 97/225 (43%), Gaps = 18/225 (8%)

Query  2    KILMVLTS-HDQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGG---QPPLDPKS  57
            + L+ LTS H      G KTG ++ E    +  F+  G ++   S  GG        PKS
Sbjct  5    RALISLTSYHGPFYKDGAKTGVFVVEILRSFDTFEKHGFEVDFVSETGGFGWDEHYLPKS  64

Query  58   NDPDAQTDSTRRFEQDKQA-QQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSI  116
                   +    FE    A  +ALA     ++V A D+   F   GHG L+D    K   
Sbjct  65   F---IGGEDKMNFETKNSAFNKALARIKTANEVNASDYKIFFASAGHGALFDYPKAKNLQ  121

Query  117  ELIEQITAMDKPLGLVCHAPAV---LKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVV  173
            ++  +I A    +  +CH P +   L ++KT      ++GK +TGF    E A+ + D++
Sbjct  122  DIASKIYANGGVIAAICHGPLLFDGLIDIKTTR--PLIEGKAITGFPLEGEIALGVDDIL  179

Query  174  P----FLIEDEFKAQGAHYEKGA-DWQSFTVREGQLITGQNPASS  213
                   +E       A Y      W  +++ +G+L+TG N  SS
Sbjct  180  RSRKLTTVERVANKNRAKYLAPIHPWDDYSITDGKLVTGVNANSS  224


> Q09918 Putative glutathione-independent glyoxalase hsp3105 [Schizosaccharomyces 
pombe (strain 972 / ATCC 24843)]
Length=251

 Score = 61.2 bits (147),  Expect = 5e-15
 Identities = 57/224 (25%), Positives = 95/224 (42%), Gaps = 8/224 (4%)

Query  2    KILMVLTSH-DQLGNTGHKTGFWLEEFTSPYYVFKDAGADITLASPKGGQPPLDPKSNDP  60
            K+L +L S+     + G  TG  + +    + VF++ G DI +AS  G     D    DP
Sbjct  16   KVLFLLNSYYGPFYDDGDNTGVNVVDLYEAFKVFEENGFDIVIASDTGDYGFDDKSFRDP  75

Query  61   DAQTDSTRRFEQ-DKQAQQALANTVLLDQVQAEDFDAVFYPGGHGPLWDLTNDKKSIELI  119
                ++   F   D    + L N   LD++   D+  V+ PGG+G  +D  + K   + +
Sbjct  76   AIVDETQSIFSNPDCSLMKKLKNIARLDRLNPSDYVIVYIPGGYGCSFDFPHAKVVQDFL  135

Query  120  EQITAMDKPLGLVCHAPAVLKNVKTAAGDSFVKGKHVTGFSNSEEAAVQLTDVVPFLIED  179
             +       +  V  A   L     + G +    + VTG +  +E    + +V+  L   
Sbjct  136  YRFYETKGIICAVAQANIALAYTTNSDGQALCTNRRVTGCTWKDEVQNGVLNVMNRLNFY  195

Query  180  EF----KAQGAHYEKGADW--QSFTVREGQLITGQNPASSEAVA  217
             F    +  GA +E    +    F V +GQL TG N  S++ VA
Sbjct  196  SFGHIAENIGAIFESPPVYVEDPFIVEDGQLFTGSNTNSAKGVA  239



Lambda      K        H        a         alpha
   0.317    0.133    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 382158


  Database: a37798bc38ff6c5902e24f4b3d56ad90.SwissProt.fasta
    Posted date:  Sep 18, 2020  3:33 PM
  Number of letters in database: 2,402
  Number of sequences in database:  10



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40