ACIAD2709 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: f13be44aa5fcf9aab15a380dc11fc2df.TrEMBL.fasta
           12 sequences; 14,028 total letters



Query= ACIAD2709

Length=66
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F905 Uncharacterized protein [Acinetobacter baylyi (strain AT...   140    2e-47
  A0A143IZ07 Putative deoxyribonuclease RhsC [Acinetobacter pittii]    119    1e-35
  V2VAG0 Uncharacterized protein [Acinetobacter gyllenbergii NIPH...   113    1e-34
  V2WCV3 Uncharacterized protein [Acinetobacter gyllenbergii NIPH...   115    5e-34
  A0A1B8UGP6 Uncharacterized protein [Acinetobacter gyllenbergii]      115    5e-34
  A0A240EA78 RHS repeat-associated core domain-containing protein...   108    9e-32
  N9GQC3 Uncharacterized protein [Acinetobacter haemolyticus CIP ...  87.4    4e-24
  A0A0Q7FR59 Uncharacterized protein [Acinetobacter sp. Root1280]     87.4    4e-24
  A0A140QYV3 RHS repeat-associated core domain protein [Acinetoba...  85.5    2e-23
  A0A0E2GCP0 Uncharacterized protein [Acinetobacter nosocomialis ...  85.5    2e-23
  A0A171EWS9 RHS repeat-associated core domain protein [Acinetoba...  84.7    4e-23
  N9LLH1 Uncharacterized protein [Acinetobacter sp. NIPH 298]         84.3    5e-23


> Q6F905 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=65

 Score =  140 bits (352),  Expect = 2e-47
 Identities = 64/65 (98%), Positives = 65/65 (100%), Gaps = 0/65 (0%)

Query  1   LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
           +IGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW
Sbjct  1   MIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60

Query  61  AWDEQ  65
           AWDEQ
Sbjct  61  AWDEQ  65


> A0A143IZ07 Putative deoxyribonuclease RhsC [Acinetobacter pittii]
Length=690

 Score =  119 bits (298),  Expect = 1e-35
 Identities = 53/63 (84%), Positives = 58/63 (92%), Gaps = 0/63 (0%)

Query  1    LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
            LIGEYNADG+PLV+YI +GDKPVAA YG+G T KTYWI TDAQNTPRRLI+AADGTTTVW
Sbjct  359  LIGEYNADGIPLVEYIWMGDKPVAAIYGSGVTTKTYWIVTDAQNTPRRLIDAADGTTTVW  418

Query  61   AWD  63
            AWD
Sbjct  419  AWD  421


 Score = 18.5 bits (36),  Expect = 1.1
 Identities = 10/37 (27%), Positives = 13/37 (35%), Gaps = 0/37 (0%)

Query  26   TYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVWAW  62
            TY A    +   I  D  +  R +     G  T W W
Sbjct  124  TYDATNKNQLKNINLDKTSLVRDITYDGSGQMTGWKW  160


 Score = 16.5 bits (31),  Expect = 5.0
 Identities = 11/40 (28%), Positives = 16/40 (40%), Gaps = 0/40 (0%)

Query  6    NADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNT  45
            N D   LV+ I          +  G    +Y  T DA+N+
Sbjct  137  NLDKTSLVRDITYDGSGQMTGWKWGAGEASYGQTYDAKNS  176


 Score = 16.2 bits (30),  Expect = 6.8
 Identities = 11/42 (26%), Positives = 20/42 (48%), Gaps = 2/42 (5%)

Query  19   GDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
            G++    T    TT+  Y++  + +N       AA+G  +VW
Sbjct  305  GNRREDKTTSGTTTSPQYYMAYNHKNERTLRGYAANG--SVW  344


 Score = 16.2 bits (30),  Expect = 6.8
 Identities = 4/7 (57%), Positives = 5/7 (71%), Gaps = 0/7 (0%)

Query  34   KTYWITT  40
            +TYW  T
Sbjct  679  RTYWFVT  685


 Score = 15.8 bits (29),  Expect = 9.3
 Identities = 13/44 (30%), Positives = 17/44 (39%), Gaps = 2/44 (5%)

Query  3    GEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTP  46
            G Y A GV   +      KP    +   T  KT+ +     NTP
Sbjct  619  GNYLATGVVTFRPDTYSWKPDYGRFIEDTGIKTFGLILG--NTP  660


> V2VAG0 Uncharacterized protein [Acinetobacter gyllenbergii NIPH 
230]
Length=299

 Score =  113 bits (282),  Expect = 1e-34
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)

Query  1   LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
           +IGEY+ADGVPLV+Y+ +GDKPVAA YG+G T+KTYWI TDAQNTPRRLI+AAD +TTVW
Sbjct  1   MIGEYSADGVPLVEYVWMGDKPVAAIYGSGATSKTYWIVTDAQNTPRRLIDAADASTTVW  60

Query  61  AWD  63
           AWD
Sbjct  61  AWD  63


> V2WCV3 Uncharacterized protein [Acinetobacter gyllenbergii NIPH 
230]
Length=1486

 Score =  115 bits (289),  Expect = 5e-34
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)

Query  1     LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
             LIGEY+ADGVPLV+Y+ +GDKPVAA YG+GTT+KTYWI TDAQNTPRRLI+AAD +TTVW
Sbjct  1171  LIGEYSADGVPLVEYVWMGDKPVAAIYGSGTTSKTYWIVTDAQNTPRRLIDAADASTTVW  1230

Query  61    AWD  63
             AWD
Sbjct  1231  AWD  1233


 Score = 22.3 bits (46),  Expect = 0.042
 Identities = 20/61 (33%), Positives = 25/61 (41%), Gaps = 11/61 (18%)

Query  5    YNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAA--DGTTTVWAW  62
            YNADG    K    G      T    TT+ TY       +T +RL      DG  T +A+
Sbjct  600  YNADGTVASK--TTGTGTATTTITGKTTSYTY-------DTLKRLSTETNPDGEKTAYAY  650

Query  63   D  63
            D
Sbjct  651  D  651


 Score = 20.8 bits (42),  Expect = 0.15
 Identities = 10/36 (28%), Positives = 17/36 (47%), Gaps = 0/36 (0%)

Query  15   YICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLI  50
            Y   G+K   +    GTT  T ++  +A   P R++
Sbjct  554  YDAYGNKASESQVVNGTTRTTSYVGYNALGQPERIV  589


 Score = 19.2 bits (38),  Expect = 0.57
 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query  23   VAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTT  58
            V ++  AG+T+KT    TD       L++  DG  T
Sbjct  513  VLSSSQAGSTSKT----TDYTYLSNGLVSTVDGPRT  544


 Score = 18.9 bits (37),  Expect = 0.78
 Identities = 11/36 (31%), Positives = 15/36 (42%), Gaps = 1/36 (3%)

Query  29   AGTTAKTYWITTDAQ-NTPRRLINAADGTTTVWAWD  63
            +GT A   W+T     N       +A G T  W +D
Sbjct  709  SGTDAAKNWVTNSYDLNGNLTQTASALGITEKWTYD  744


> A0A1B8UGP6 Uncharacterized protein [Acinetobacter gyllenbergii]
Length=1492

 Score =  115 bits (289),  Expect = 5e-34
 Identities = 51/63 (81%), Positives = 58/63 (92%), Gaps = 0/63 (0%)

Query  1     LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
             LIGEY+ADGVPLV+Y+ +GDKPVAA YG+G T+KTYWI TDAQNTPRRLINAAD +TTVW
Sbjct  1171  LIGEYSADGVPLVEYVWMGDKPVAAIYGSGATSKTYWIVTDAQNTPRRLINAADASTTVW  1230

Query  61    AWD  63
             AWD
Sbjct  1231  AWD  1233


 Score = 22.3 bits (46),  Expect = 0.042
 Identities = 20/61 (33%), Positives = 25/61 (41%), Gaps = 11/61 (18%)

Query  5    YNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAA--DGTTTVWAW  62
            YNADG    K    G      T    TT+ TY       +T +RL      DG  T +A+
Sbjct  600  YNADGTVASK--TTGTGTATTTITGKTTSYTY-------DTLKRLSTETNPDGEKTAYAY  650

Query  63   D  63
            D
Sbjct  651  D  651


 Score = 20.8 bits (42),  Expect = 0.15
 Identities = 10/36 (28%), Positives = 17/36 (47%), Gaps = 0/36 (0%)

Query  15   YICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLI  50
            Y   G+K   +    GTT  T ++  +A   P R++
Sbjct  554  YDAYGNKASESQVVNGTTRTTSYVGYNALGQPERIV  589


 Score = 19.2 bits (38),  Expect = 0.57
 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query  23   VAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTT  58
            V ++  AG+T+KT    TD       L++  DG  T
Sbjct  513  VLSSSQAGSTSKT----TDYTYLSNGLVSTVDGPRT  544


 Score = 19.2 bits (38),  Expect = 0.57
 Identities = 11/36 (31%), Positives = 16/36 (44%), Gaps = 1/36 (3%)

Query  29   AGTTAKTYWITTDAQ-NTPRRLINAADGTTTVWAWD  63
            +GT A   W+T     N       +A G T  W++D
Sbjct  709  SGTDAAKNWVTNSYDLNGNLTQTASALGITEKWSYD  744


> A0A240EA78 RHS repeat-associated core domain-containing protein 
[Acinetobacter puyangensis]
Length=839

 Score =  108 bits (271),  Expect = 9e-32
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)

Query  1    LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
            LIGEYNA G P+V+YI LGD+P+AA YG+GTTAKTYWI TDAQNTPRRLI++ DG TTVW
Sbjct  509  LIGEYNASGTPIVEYIWLGDQPIAAIYGSGTTAKTYWIVTDAQNTPRRLIDSTDGNTTVW  568

Query  61   AWD  63
            A+D
Sbjct  569  AFD  571


 Score = 18.1 bits (35),  Expect = 1.5
 Identities = 5/17 (29%), Positives = 8/17 (47%), Gaps = 0/17 (0%)

Query  48  RLINAADGTTTVWAWDE  64
           R++    GT   W W +
Sbjct  42  RILRKQSGTDNDWYWTD  58


> N9GQC3 Uncharacterized protein [Acinetobacter haemolyticus CIP 
64.3]
Length=1477

 Score = 87.4 bits (215),  Expect = 4e-24
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 1/63 (2%)

Query  1     LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
             L+GEY A G+PLV+YI LGDKPVAA YG+G   K Y+I TD QNTPRRLI++++ +  VW
Sbjct  1118  LLGEYTAAGIPLVEYIWLGDKPVAAVYGSGAATKIYYIVTDVQNTPRRLIDSSN-SNVVW  1176

Query  61    AWD  63
             +WD
Sbjct  1177  SWD  1179


 Score = 16.9 bits (32),  Expect = 3.8
 Identities = 17/60 (28%), Positives = 23/60 (38%), Gaps = 7/60 (12%)

Query  4    EYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVWAWD  63
            +YN DG   +  + LG      T     T KT     DA       +N  DG  T + +D
Sbjct  550  DYNLDG--SLSRVVLGSGSTTGT----ITGKTVSYDYDALGQLTSTVN-EDGEKTSFYYD  602


 Score = 16.5 bits (31),  Expect = 5.1
 Identities = 6/14 (43%), Positives = 9/14 (64%), Gaps = 0/14 (0%)

Query  50   INAADGTTTVWAWD  63
            I   +G TT +A+D
Sbjct  383  ITDQNGNTTAYAFD  396


 Score = 16.5 bits (31),  Expect = 5.1
 Identities = 7/25 (28%), Positives = 12/25 (48%), Gaps = 0/25 (0%)

Query  31   TTAKTYWITTDAQNTPRRLINAADG  55
            T   TY   +D   +   L+++ DG
Sbjct  468  TKVTTYTYFSDITQSNNGLLSSEDG  492


> A0A0Q7FR59 Uncharacterized protein [Acinetobacter sp. Root1280]
Length=1524

 Score = 87.4 bits (215),  Expect = 4e-24
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)

Query  1     LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
             L+GEY+ADG P+V+YI L DKPVAA YG  +  K YWI TD QN PRRLI++++ ++ VW
Sbjct  1177  LLGEYDADGNPIVEYIWLFDKPVAAIYGTTSNTKIYWIATDVQNKPRRLIDSSNDSSIVW  1236

Query  61    AWD  63
             AWD
Sbjct  1237  AWD  1239


> A0A140QYV3 RHS repeat-associated core domain protein [Acinetobacter 
sp. 216872]
Length=1468

 Score = 85.5 bits (210),  Expect = 2e-23
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 2/63 (3%)

Query  1     LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
             LIGEY A G+PLV+YI LGDKPVAA Y +G T K Y+I TD QNTPRRLI++    + VW
Sbjct  1113  LIGEYTATGIPLVEYIWLGDKPVAAVYESGATTKIYYIVTDVQNTPRRLIDS--NGSVVW  1170

Query  61    AWD  63
             +WD
Sbjct  1171  SWD  1173


 Score = 19.6 bits (39),  Expect = 0.41
 Identities = 12/44 (27%), Positives = 23/44 (52%), Gaps = 5/44 (11%)

Query  20   DKPVAATYGAGTT-AKTYWITTDAQNTPRRLINAADGTTTVWAW  62
            ++P++   G+G T  KTY    DA + P  +++A    T  + +
Sbjct  693  NRPISHIDGSGNTDTKTY----DALDNPITVLDALSSGTNPYLY  732


 Score = 15.8 bits (29),  Expect = 9.4
 Identities = 5/9 (56%), Positives = 6/9 (67%), Gaps = 0/9 (0%)

Query  1    LIGEYNADG  9
            L+G  N DG
Sbjct  581  LVGSLNEDG  589


> A0A0E2GCP0 Uncharacterized protein [Acinetobacter nosocomialis 
NIPH 386]
Length=1561

 Score = 85.5 bits (210),  Expect = 2e-23
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 2/63 (3%)

Query  1     LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
             LIGEY A G+PLV+YI LGDKPVAA Y +G T K Y+I TD QNTPRRLI++    + VW
Sbjct  1206  LIGEYTATGIPLVEYIWLGDKPVAAVYESGATTKIYYIVTDVQNTPRRLIDS--NGSVVW  1263

Query  61    AWD  63
             +WD
Sbjct  1264  SWD  1266


 Score = 19.6 bits (39),  Expect = 0.41
 Identities = 12/44 (27%), Positives = 23/44 (52%), Gaps = 5/44 (11%)

Query  20   DKPVAATYGAGTT-AKTYWITTDAQNTPRRLINAADGTTTVWAW  62
            ++P++   G+G T  KTY    DA + P  +++A    T  + +
Sbjct  786  NRPISHIDGSGNTDTKTY----DALDNPITVLDALSSGTNPYLY  825


 Score = 16.2 bits (30),  Expect = 7.0
 Identities = 10/38 (26%), Positives = 16/38 (42%), Gaps = 1/38 (3%)

Query  1    LIGEYNADGVPLVKYICLGDKPVAATYGAGT-TAKTYW  37
            L+G  N DG     Y     + +   Y  G+ + K Y+
Sbjct  674  LVGSLNEDGEKTSYYYDNLGRIIKTIYSDGSISTKNYF  711


> A0A171EWS9 RHS repeat-associated core domain protein [Acinetobacter 
baumannii Naval-82]
Length=1577

 Score = 84.7 bits (208),  Expect = 4e-23
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 2/63 (3%)

Query  1     LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
             L+GEY A GVP+V+Y+ LGDKP+AA YG+G+    Y+I TD QNTPRRL+N +     VW
Sbjct  1204  LVGEYTASGVPIVEYVWLGDKPIAAIYGSGSATTIYYIVTDVQNTPRRLVNTSG--NVVW  1261

Query  61    AWD  63
             +WD
Sbjct  1262  SWD  1264


 Score = 20.8 bits (42),  Expect = 0.15
 Identities = 10/31 (32%), Positives = 14/31 (45%), Gaps = 0/31 (0%)

Query  28   GAGTTAKTYWITTDAQNTPRRLINAADGTTT  58
            G+ T   TY   TD       L+++ DG  T
Sbjct  551  GSTTKTTTYTYYTDTTKPNNGLLSSEDGPRT  581


 Score = 20.4 bits (41),  Expect = 0.21
 Identities = 7/36 (19%), Positives = 18/36 (50%), Gaps = 0/36 (0%)

Query  26    TYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVWA  61
             T+G+   + T+  +T      ++++N   G  T ++
Sbjct  1007  TWGSNAGSYTWTYSTSKNGLIKQIVNKTSGGATTYS  1042


 Score = 19.6 bits (39),  Expect = 0.41
 Identities = 13/41 (32%), Positives = 19/41 (46%), Gaps = 3/41 (7%)

Query  28    GAGTTAKTYWITTDAQNTPRRLINAADG---TTTVWAWDEQ  65
             G GT+       +   N  R L + A G   +TT + +DEQ
Sbjct  1161  GEGTSTTINRYMSYNANNERTLTSLASGWVNSTTQFVYDEQ  1201


 Score = 16.9 bits (32),  Expect = 3.8
 Identities = 15/52 (29%), Positives = 23/52 (44%), Gaps = 3/52 (6%)

Query  5    YNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGT  56
            Y+A+G  L+    L D   + TY A     ++  T    NT  +  +A D T
Sbjct  759  YDANGNVLLTKTAL-DTTESWTYDAFNRVISH--TDSTNNTNTKTYDALDNT  807


 Score = 16.2 bits (30),  Expect = 7.0
 Identities = 5/22 (23%), Positives = 12/22 (55%), Gaps = 0/22 (0%)

Query  30   GTTAKTYWITTDAQNTPRRLIN  51
            G T  T ++  ++   P R+++
Sbjct  606  GATRTTQYVGYNSFGKPERIVH  627


> N9LLH1 Uncharacterized protein [Acinetobacter sp. NIPH 298]
Length=1550

 Score = 84.3 bits (207),  Expect = 5e-23
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 1/63 (2%)

Query  1     LIGEYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVW  60
             L+GEY A G P+V+YI LGDKP+AA YG+G   K Y+I TDAQNTPRRL++++     VW
Sbjct  1212  LLGEYTASGAPVVEYIWLGDKPIAAVYGSGVNTKIYYIVTDAQNTPRRLVDSST-QAIVW  1270

Query  61    AWD  63
              WD
Sbjct  1271  GWD  1273


 Score = 18.5 bits (36),  Expect = 1.1
 Identities = 8/28 (29%), Positives = 13/28 (46%), Gaps = 0/28 (0%)

Query  28   GAGTTAKTYWITTDAQNTPRRLINAADG  55
            G+ T   TY   +D       L+++ DG
Sbjct  559  GSTTKVTTYTYYSDTSKPNNGLLSSEDG  586


 Score = 16.9 bits (32),  Expect = 3.8
 Identities = 17/60 (28%), Positives = 23/60 (38%), Gaps = 7/60 (12%)

Query  4    EYNADGVPLVKYICLGDKPVAATYGAGTTAKTYWITTDAQNTPRRLINAADGTTTVWAWD  63
            +YN DG   +  + LG      T     T KT     DA       +N  DG  T + +D
Sbjct  644  DYNLDG--SLSRVVLGSGSTTGT----ITGKTVSYDYDALGQLTSTVN-EDGEKTSFYYD  696


 Score = 16.5 bits (31),  Expect = 5.1
 Identities = 6/14 (43%), Positives = 9/14 (64%), Gaps = 0/14 (0%)

Query  50   INAADGTTTVWAWD  63
            I   +G TT +A+D
Sbjct  477  ITDQNGNTTTYAFD  490



Lambda      K        H        a         alpha
   0.323    0.137    0.459    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 380016


  Database: f13be44aa5fcf9aab15a380dc11fc2df.TrEMBL.fasta
    Posted date:  Sep 18, 2020  4:15 PM
  Number of letters in database: 14,028
  Number of sequences in database:  12



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40