ACIAD2687 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: ae333f1bc291e96fb33feea4baef18e2.TrEMBL.fasta
           11 sequences; 6,595 total letters



Query= ACIAD2687

Length=603
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F924 Uncharacterized protein [Acinetobacter baylyi (strain AT...  1202    0.0  
  A0A1P8EEQ7 Type VI secretion system protein ImpG [Acinetobacter...   988    0.0  
  N9BSF9 Type VI secretion protein [Acinetobacter soli NIPH 2899]      986    0.0  
  A0A2N0WFK2 Type VI secretion system baseplate subunit TssF [Aci...   924    0.0  
  A0A1E7R0Q1 Type VI secretion system protein ImpG [Acinetobacter...   924    0.0  
  N9LQX2 Type VI secretion protein [Acinetobacter sp. ANC 3929]        924    0.0  
  N9SUF0 Type VI secretion protein [Acinetobacter sp. NIPH 1867]       922    0.0  
  N8UZS1 Type VI secretion protein [Acinetobacter sp. NIPH 758]        922    0.0  
  N9Q5W0 Type VI secretion protein [Acinetobacter sp. NIPH 2168]       920    0.0  
  A0A143G7N4 Type VI secretion system protein ImpG [Acinetobacter...   919    0.0  
  R9TJM9 TssF [Campylobacter jejuni]                                   155    8e-44


> Q6F924 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=602

 Score = 1202 bits (3109),  Expect = 0.0
 Identities = 601/602 (99%), Positives = 602/602 (100%), Gaps = 0/602 (0%)

Query  1    VIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60
            +IEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI
Sbjct  1    MIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60

Query  61   DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS  120
            DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS
Sbjct  61   DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS  120

Query  121  FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK  180
            FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK
Sbjct  121  FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK  180

Query  181  LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH  240
            LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH
Sbjct  181  LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH  240

Query  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300
            HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV
Sbjct  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300

Query  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360
            ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE
Sbjct  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360

Query  361  QAIVPVLPFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDFVSTQ  420
            QAIVPVLPFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDFVSTQ
Sbjct  361  QAIVPVLPFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDFVSTQ  420

Query  421  LLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSLN  480
            LLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSLN
Sbjct  421  LLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSLN  480

Query  481  TLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGVK  540
            TLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGVK
Sbjct  481  TLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGVK  540

Query  541  AEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGKT  600
            AEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGKT
Sbjct  541  AEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGKT  600

Query  601  LL  602
            LL
Sbjct  601  LL  602


> A0A1P8EEQ7 Type VI secretion system protein ImpG [Acinetobacter 
soli]
Length=603

 Score =  988 bits (2554),  Expect = 0.0
 Identities = 486/603 (81%), Positives = 541/603 (90%), Gaps = 1/603 (0%)

Query  1    VIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60
            +IEELLPYYEKQLQEF QQSREFA KYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI
Sbjct  1    MIEELLPYYEKQLQEFGQQSREFAQKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60

Query  61   DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS  120
            DKKI DS+D FTRSLFEVMFPQYLRHFPACSVVSF+D QKLKQLTEPH+IP QT+LKSRS
Sbjct  61   DKKITDSHDIFTRSLFEVMFPQYLRHFPACSVVSFDDPQKLKQLTEPHLIPAQTRLKSRS  120

Query  121  FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK  180
            F+GVQCEFNT Y+VRLLPI L ++EFKTL    AHL+QNAS NFHF LLNP Q+WL  E+
Sbjct  121  FRGVQCEFNTTYDVRLLPIQLARVEFKTLDSARAHLSQNASFNFHFDLLNPAQTWLLDEQ  180

Query  181  LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH  240
            LPIYLD+ISNFPLQ+LDQ+FK ET+FS+ V  Q+  I NPF++MGF E +ALLP+DQHTH
Sbjct  181  LPIYLDSISNFPLQVLDQLFKTETQFSITVNRQTHSIPNPFQIMGFEEEQALLPIDQHTH  240

Query  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300
            HAYRLLMEYFCFPEKFNYL LNLS LK+F++ Q+ FEL +HLKLNLND ASVRNYSEL  
Sbjct  241  HAYRLLMEYFCFPEKFNYLKLNLSILKSFLSGQSNFELSVHLKLNLNDTASVRNYSELVT  300

Query  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360
            ENFKLFTTP+INLFEKQAEPQKINHQQLEY L+TDAHYPDAYQVY+I +MQMIREK++QE
Sbjct  301  ENFKLFTTPIINLFEKQAEPQKINHQQLEYSLLTDAHYPDAYQVYAIQNMQMIREKSNQE  360

Query  361  QAIVPVLPFFAMSHYHDHQVKFFYALHQQKL-TKHHVETRFSIVSKQLEPYNTTSDFVST  419
            Q   PVLPFFAMSHYH   VKFFYAL+QQK+ +   ++TRF+IVSKQLEP+NT+SD+VST
Sbjct  361  QITTPVLPFFAMSHYHPQTVKFFYALNQQKISSSSRMQTRFTIVSKQLEPFNTSSDYVST  420

Query  420  QLLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSL  479
            QLLCSN DLP+EVLGQTHT+LNLN+S LARRA VLKRPT+PYQFEQ+KNEQWRIISHLSL
Sbjct  421  QLLCSNWDLPHEVLGQTHTTLNLNNSTLARRATVLKRPTMPYQFEQNKNEQWRIISHLSL  480

Query  480  NTLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGV  539
            NTLALMKG+SLSHLKELLALYNLP SKEN LLI AIKQ+ F LTHKLVEAKPFPMFVRG+
Sbjct  481  NTLALMKGDSLSHLKELLALYNLPHSKENTLLIHAIKQIQFELTHKLVEAKPFPMFVRGI  540

Query  540  KAEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGK  599
            KA + +D +VFRGHSVYIFSQL+SHI NLKVQMNSFVDV+I DS RQQELYQCVQNVGGK
Sbjct  541  KANVYLDPAVFRGHSVYIFSQLLSHIFNLKVQMNSFVDVMIWDSQRQQELYQCVQNVGGK  600

Query  600  TLL  602
             LL
Sbjct  601  ALL  603


> N9BSF9 Type VI secretion protein [Acinetobacter soli NIPH 2899]
Length=603

 Score =  986 bits (2548),  Expect = 0.0
 Identities = 485/603 (80%), Positives = 541/603 (90%), Gaps = 1/603 (0%)

Query  1    VIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60
            +IEELLPYYEKQLQEF QQSREFA KYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI
Sbjct  1    MIEELLPYYEKQLQEFGQQSREFAQKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60

Query  61   DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS  120
            DKKI DS+D FTRSLFEVMF QYLRHFPACSVVSF+D QKLKQLTEPH+IP QT+LKSRS
Sbjct  61   DKKITDSHDIFTRSLFEVMFTQYLRHFPACSVVSFDDPQKLKQLTEPHLIPAQTRLKSRS  120

Query  121  FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK  180
            F+GVQCEFNT Y+VRLLPI L ++EFKTL    AHL+QNAS NFHF LLNP Q+WL  E+
Sbjct  121  FRGVQCEFNTTYDVRLLPIQLARVEFKTLDSARAHLSQNASFNFHFDLLNPAQTWLLDEQ  180

Query  181  LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH  240
            LPIYLD+ISNFPLQ+LDQ+FK ET+FS+ V  Q+  I NPF++MGF E +ALLP+DQHTH
Sbjct  181  LPIYLDSISNFPLQVLDQLFKTETQFSITVNRQTHSIPNPFQIMGFEEEQALLPIDQHTH  240

Query  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300
            HAYRLLMEYFCFPEKFNYL LNLS LK+F++ Q++FEL +HLKLNLND ASVRNYSEL  
Sbjct  241  HAYRLLMEYFCFPEKFNYLKLNLSILKSFLSGQSDFELSVHLKLNLNDTASVRNYSELVT  300

Query  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360
            ENFKLFTTP+INLFEKQAEPQKINHQQLEY L+TDAHYPDAYQVY+I +MQMIREK++QE
Sbjct  301  ENFKLFTTPIINLFEKQAEPQKINHQQLEYSLLTDAHYPDAYQVYAIQNMQMIREKSNQE  360

Query  361  QAIVPVLPFFAMSHYHDHQVKFFYALHQQKL-TKHHVETRFSIVSKQLEPYNTTSDFVST  419
            Q   PVLPFFAMSHYH   VKFFYAL+QQK+ +   ++TRF+IVSKQLEP+NT+SD+VST
Sbjct  361  QITTPVLPFFAMSHYHPQTVKFFYALNQQKISSSSRMQTRFTIVSKQLEPFNTSSDYVST  420

Query  420  QLLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSL  479
            QLLCSN DLP+EVLGQTHT+LNLN+S LARRA VLKRPT+PYQFEQ+KNEQWRIISHLSL
Sbjct  421  QLLCSNWDLPHEVLGQTHTTLNLNNSTLARRATVLKRPTMPYQFEQNKNEQWRIISHLSL  480

Query  480  NTLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGV  539
            NTLALMKG+SLSHLKELLALYNLP SKEN LLI AIKQ+ F LTHKLVEAKPFPMFVRG+
Sbjct  481  NTLALMKGDSLSHLKELLALYNLPHSKENTLLIHAIKQIQFELTHKLVEAKPFPMFVRGI  540

Query  540  KAEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGK  599
            KA + +D +VFRGHSVYIFSQL+SHI NLKVQMNSFVDV+I DS RQQELYQCVQNVGGK
Sbjct  541  KANVYLDPAVFRGHSVYIFSQLLSHIFNLKVQMNSFVDVMIWDSQRQQELYQCVQNVGGK  600

Query  600  TLL  602
             LL
Sbjct  601  ALL  603


> A0A2N0WFK2 Type VI secretion system baseplate subunit TssF [Acinetobacter 
proteolyticus]
Length=602

 Score =  924 bits (2388),  Expect = 0.0
 Identities = 447/602 (74%), Positives = 525/602 (87%), Gaps = 0/602 (0%)

Query  1    VIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60
            +IE+LLPYYEKQLQEF QQSREFA KYPKIAQRL+LNQEQIDDPHIERLIQAFSLIAARI
Sbjct  1    MIEQLLPYYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARI  60

Query  61   DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS  120
            DKK+ADSY+ FT SLFEVMFPQYLRHFPAC+VVSFED  KLKQLTE H+IP++T LKSRS
Sbjct  61   DKKLADSYELFTHSLFEVMFPQYLRHFPACTVVSFEDTNKLKQLTEAHLIPQKTALKSRS  120

Query  121  FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK  180
            FKGVQCEFNT+ EVRLLPI+L  LEF+T   TH HL QNA+LN  F + N  Q W+  EK
Sbjct  121  FKGVQCEFNTSNEVRLLPIALTHLEFQTSPSTHMHLNQNATLNLKFEIFNDAQQWILDEK  180

Query  181  LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH  240
            LPIYLDAISNFPLQ+LD IF+K+T F++RVG +  +++NPFE+MGFSE E+LLP+DQHTH
Sbjct  181  LPIYLDAISNFPLQVLDSIFRKDTGFAIRVGPRVIEVSNPFEVMGFSEQESLLPIDQHTH  240

Query  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300
            HAYRLLMEYFCFPEKFNYLNL+LS LK  +  Q  FE+LIHLKLNLND A VRNYSEL++
Sbjct  241  HAYRLLMEYFCFPEKFNYLNLDLSVLKGLLQQQNSFEILIHLKLNLNDQAVVRNYSELNI  300

Query  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360
             NFKLFTTP INLFEKQAEPQKI+H QL+YPLITDAH+P+ YQVYSI++M M+REKT+QE
Sbjct  301  ANFKLFTTPAINLFEKQAEPQKISHTQLQYPLITDAHHPELYQVYSILEMNMVREKTNQE  360

Query  361  QAIVPVLPFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDFVSTQ  420
            Q  +PVLPFFAMSHYH+ +V+FFY+L+        ++  +SIVSK L+PY   SDF+ST+
Sbjct  361  QTHLPVLPFFAMSHYHNDKVQFFYSLNYLPSQTKIMQMGYSIVSKHLKPYEIKSDFISTR  420

Query  421  LLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSLN  480
            LLCSN DLP+E L Q++  LNLNDS+LARRA++LKRPT PY F+++ NEQWRIISHLSLN
Sbjct  421  LLCSNGDLPHEALSQSNNILNLNDSSLARRALILKRPTSPYHFDKNSNEQWRIISHLSLN  480

Query  481  TLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGVK  540
            TLALMKG++LSH+KELLALYNLP SKEN LLIDA+KQLNFS T+KL+ AKPFPMF+RGVK
Sbjct  481  TLALMKGDALSHVKELLALYNLPHSKENILLIDALKQLNFSTTNKLMNAKPFPMFIRGVK  540

Query  541  AEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGKT  600
            AE+S++ SVFRGHS+YIFSQL+SHI NLKVQ+NSFVDVV++DS+ QQE+YQCVQNVGGKT
Sbjct  541  AELSVNKSVFRGHSLYIFSQLLSHIFNLKVQINSFVDVVVKDSLNQQEIYQCVQNVGGKT  600

Query  601  LL  602
            LL
Sbjct  601  LL  602


> A0A1E7R0Q1 Type VI secretion system protein ImpG [Acinetobacter 
proteolyticus]
Length=602

 Score =  924 bits (2387),  Expect = 0.0
 Identities = 446/602 (74%), Positives = 525/602 (87%), Gaps = 0/602 (0%)

Query  1    VIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60
            +IE+LLPYYEKQLQEF QQSREFA KYPKIAQRL+LNQEQIDDPHIERLIQAFSLIAARI
Sbjct  1    MIEQLLPYYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARI  60

Query  61   DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS  120
            DKK+ADSY+ FT SLFEVMFPQYLRHFPAC+VVSFED  KLKQLTE H+IP++T LKSRS
Sbjct  61   DKKLADSYELFTHSLFEVMFPQYLRHFPACTVVSFEDTNKLKQLTEAHLIPQKTALKSRS  120

Query  121  FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK  180
            FKGVQCEFNT+ EVRLLPI+L  LEF+T   TH HL QNA+LN  F + N  Q W+  EK
Sbjct  121  FKGVQCEFNTSNEVRLLPIALTHLEFQTSPSTHMHLNQNATLNLKFEIFNDAQQWILDEK  180

Query  181  LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH  240
            LPIYLDAISNFPLQ+LD IF+K+T F++RVG +  +++NPFE+MGFSE E+LLP+DQHTH
Sbjct  181  LPIYLDAISNFPLQVLDSIFRKDTGFAIRVGPRVIEVSNPFEVMGFSEQESLLPIDQHTH  240

Query  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300
            HAYRLLMEYFCFPEKFNYLNL+LS LK  +  Q  FE+LIHLKLNLND A VRNYSEL++
Sbjct  241  HAYRLLMEYFCFPEKFNYLNLDLSVLKGLLQQQNSFEILIHLKLNLNDQAVVRNYSELNI  300

Query  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360
             NFKLFTTP INLFEKQAEPQKI+H QL+YPL+TDAH+P+ YQVYSI++M M+REKT+QE
Sbjct  301  ANFKLFTTPAINLFEKQAEPQKISHTQLQYPLVTDAHHPELYQVYSILEMNMVREKTNQE  360

Query  361  QAIVPVLPFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDFVSTQ  420
            Q  +PVLPFFAMSHYH+ +V+FFY+L+        ++  +SIVSK L+PY   SDF+ST+
Sbjct  361  QTHLPVLPFFAMSHYHNDKVQFFYSLNYLPSQTKIMQMGYSIVSKHLKPYEIKSDFISTR  420

Query  421  LLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSLN  480
            LLCSN DLP+E L Q++  LNLNDS+LARRA++LKRPT PY F+++ NEQWRIISHLSLN
Sbjct  421  LLCSNGDLPHEALSQSNNILNLNDSSLARRALILKRPTSPYHFDKNSNEQWRIISHLSLN  480

Query  481  TLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGVK  540
            TLALMKG++LSH+KELLALYNLP SKEN LLIDA+KQLNFS T+KL+ AKPFPMF+RGVK
Sbjct  481  TLALMKGDALSHVKELLALYNLPHSKENILLIDALKQLNFSTTNKLMNAKPFPMFIRGVK  540

Query  541  AEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGKT  600
            AE+S++ SVFRGHS+YIFSQL+SHI NLKVQ+NSFVDVV++DS+ QQE+YQCVQNVGGKT
Sbjct  541  AELSVNKSVFRGHSLYIFSQLLSHIFNLKVQINSFVDVVVKDSLNQQEIYQCVQNVGGKT  600

Query  601  LL  602
            LL
Sbjct  601  LL  602


> N9LQX2 Type VI secretion protein [Acinetobacter sp. ANC 3929]
Length=602

 Score =  924 bits (2387),  Expect = 0.0
 Identities = 449/602 (75%), Positives = 523/602 (87%), Gaps = 0/602 (0%)

Query  1    VIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60
            +IE+LLPYYEKQLQEF QQSREFA KYPKIAQRL+LNQEQIDDPHIERLIQAFSLIAARI
Sbjct  1    MIEQLLPYYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARI  60

Query  61   DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS  120
            DKK+ADSYD FT SLFEVMFPQYLRHFPAC+VVSFED+ KLKQLT  HIIP++T LKSRS
Sbjct  61   DKKLADSYDLFTHSLFEVMFPQYLRHFPACTVVSFEDINKLKQLTAAHIIPQKTALKSRS  120

Query  121  FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK  180
            FKGVQCEFNT+ EVRLLPI+L  LEF+T   TH HL QNA+L+  F + N +Q WL  EK
Sbjct  121  FKGVQCEFNTSNEVRLLPITLTNLEFQTSPSTHMHLNQNATLSLKFEIFNDVQQWLLDEK  180

Query  181  LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH  240
            LPIYLDAISNFPLQ+LD IF+KET FS+RVG +  +I NPF +MGFSE E+LLP+DQHTH
Sbjct  181  LPIYLDAISNFPLQVLDSIFRKETGFSIRVGQRVVEIANPFAVMGFSEQESLLPIDQHTH  240

Query  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300
            HAYRLLMEYFCFPEKFNYLN +LS LK  +  Q  FE+LIHLKLNLND A VRNYSEL++
Sbjct  241  HAYRLLMEYFCFPEKFNYLNFDLSVLKGLLQQQNSFEILIHLKLNLNDQALVRNYSELNI  300

Query  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360
             NFKLFTTP INLFEKQAEPQKI+H QL+YPLITDAH+P+ YQVYSII+M M+REKT+QE
Sbjct  301  ANFKLFTTPAINLFEKQAEPQKISHTQLQYPLITDAHHPELYQVYSIIEMNMVREKTNQE  360

Query  361  QAIVPVLPFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDFVSTQ  420
            Q  +PVLPFFAMSHYH+ +V+FFY+L+        ++  +SIVSK L+PY   SDF+ST+
Sbjct  361  QTHLPVLPFFAMSHYHNDKVQFFYSLNYLPTQTKTMQMGYSIVSKHLKPYEIKSDFISTR  420

Query  421  LLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSLN  480
            LLCSN DLP+E L Q++  LNLNDS+LARRA++LKRPT PY F+++ NEQWRIISHLSLN
Sbjct  421  LLCSNGDLPHEALSQSNNILNLNDSSLARRALILKRPTSPYHFDKNSNEQWRIISHLSLN  480

Query  481  TLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGVK  540
            TLALMKG++LSH+KELLALYNLP SKEN LLIDA+KQLNFS T+KL+ AKPFPMF+RGVK
Sbjct  481  TLALMKGDALSHVKELLALYNLPHSKENILLIDALKQLNFSTTNKLMNAKPFPMFIRGVK  540

Query  541  AEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGKT  600
            AE++++ SVFRGHS+YIFSQL+SHI NLKVQ+NSFVDVV++DS+ QQE+YQCVQNVGGKT
Sbjct  541  AELAVNKSVFRGHSLYIFSQLLSHIFNLKVQINSFVDVVVKDSLNQQEIYQCVQNVGGKT  600

Query  601  LL  602
            LL
Sbjct  601  LL  602


> N9SUF0 Type VI secretion protein [Acinetobacter sp. NIPH 1867]
Length=602

 Score =  922 bits (2383),  Expect = 0.0
 Identities = 447/602 (74%), Positives = 524/602 (87%), Gaps = 0/602 (0%)

Query  1    VIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60
            +IE+LLPYYEKQLQEF QQSREFA KYPKIAQRL+LNQEQIDDPHIERLIQAFSLIAARI
Sbjct  1    MIEQLLPYYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARI  60

Query  61   DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS  120
            DKK+ADSYD FT SLFEVMFPQYLRHFPAC+VVSFED+ KLKQL+  HIIP++T LKSRS
Sbjct  61   DKKLADSYDLFTHSLFEVMFPQYLRHFPACTVVSFEDINKLKQLSAAHIIPQKTALKSRS  120

Query  121  FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK  180
            FKGVQCEFNT+ EVRLLPI+L  LEF+T   TH HL QNA+L+  F + N  Q W+  EK
Sbjct  121  FKGVQCEFNTSNEVRLLPITLSNLEFQTSPSTHMHLNQNATLSLKFEIFNDAQPWILDEK  180

Query  181  LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH  240
            LPIYLDAISNFPLQ+LD IF+KET FS+RVGH+  +I NPF +MGFSE E+LLP+DQHTH
Sbjct  181  LPIYLDAISNFPLQVLDSIFRKETGFSIRVGHRVVEIANPFAVMGFSEQESLLPIDQHTH  240

Query  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300
            HAYRLLMEYFCFPEKFNYLN +LS LK  +  Q +FE+LIHLKLNLND A VRNYSEL++
Sbjct  241  HAYRLLMEYFCFPEKFNYLNFDLSVLKGLLQQQNDFEVLIHLKLNLNDQAIVRNYSELNI  300

Query  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360
             NFKLFTTP INLFEKQAEPQKI+H QL+YPLITDAH+P+ YQVYSI +M M+REKT+QE
Sbjct  301  ANFKLFTTPAINLFEKQAEPQKISHTQLQYPLITDAHHPELYQVYSITEMNMVREKTNQE  360

Query  361  QAIVPVLPFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDFVSTQ  420
            Q  +PVLPFFAMSHYH+ +V+FFY+L+       +++  +SIVSK L+PY   SDF+ST+
Sbjct  361  QTHLPVLPFFAMSHYHNDKVQFFYSLNYLPTQTKNMQMGYSIVSKHLKPYEIKSDFISTK  420

Query  421  LLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSLN  480
            LLCSN DLP+E L Q++  LNLNDS+LARRA++LKRPT PY F+++ NEQWRIISHLSLN
Sbjct  421  LLCSNGDLPHEALSQSNNILNLNDSSLARRALILKRPTSPYHFDKNSNEQWRIISHLSLN  480

Query  481  TLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGVK  540
            TLALMKG++LSH+KELLALYNLP SKEN LLIDA+KQLNFS T+KL+ AKPFPMF+RGVK
Sbjct  481  TLALMKGDALSHVKELLALYNLPHSKENILLIDALKQLNFSTTNKLMNAKPFPMFIRGVK  540

Query  541  AEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGKT  600
            AE++++ SVFRGHS+YIFSQL+SHI NLKVQ+NSFVDVV++DS+ QQE+YQCVQNVGGKT
Sbjct  541  AELTVNKSVFRGHSLYIFSQLLSHIFNLKVQINSFVDVVVKDSLNQQEIYQCVQNVGGKT  600

Query  601  LL  602
            LL
Sbjct  601  LL  602


> N8UZS1 Type VI secretion protein [Acinetobacter sp. NIPH 758]
Length=602

 Score =  922 bits (2382),  Expect = 0.0
 Identities = 445/602 (74%), Positives = 526/602 (87%), Gaps = 0/602 (0%)

Query  1    VIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60
            +IE+LLPYYEKQLQEF QQSREFA KYPKIAQRL+LNQEQIDDPHIERLIQAFSLIAARI
Sbjct  1    MIEQLLPYYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARI  60

Query  61   DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS  120
            DKK+ DSYD FT SLFEVMFPQYLRHFPAC+VVSFED+ KLKQLT  HIIP++T LKSRS
Sbjct  61   DKKLEDSYDVFTHSLFEVMFPQYLRHFPACTVVSFEDINKLKQLTAAHIIPQKTALKSRS  120

Query  121  FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK  180
            FKGVQCEFNT  +VRLLPISL +LEF+TL  TH HL QNA+L+  F + N  Q W+  EK
Sbjct  121  FKGVQCEFNTTNDVRLLPISLTQLEFQTLPSTHMHLNQNATLSLKFEIFNDAQKWILDEK  180

Query  181  LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH  240
            LPIYLDAISNFPLQ+LD IF+K+T F+LRVG +  +I+NPFE+MGF+E E+LLP+DQHTH
Sbjct  181  LPIYLDAISNFPLQVLDSIFRKDTGFALRVGQRVVEISNPFEVMGFTEQESLLPIDQHTH  240

Query  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300
            HAYRLLMEYFCFPEKFNYLNL+LS+LK  +  Q +FE+LIHLKLNLND A VRNYSEL++
Sbjct  241  HAYRLLMEYFCFPEKFNYLNLDLSRLKGLLNQQNQFEILIHLKLNLNDQAVVRNYSELNI  300

Query  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360
             NFKLFTTP INLFEKQAEPQKI+H QL+YPLITDAH+P+ YQVYS+I+M M+REKT+QE
Sbjct  301  ANFKLFTTPAINLFEKQAEPQKISHTQLQYPLITDAHHPELYQVYSVIEMNMVREKTNQE  360

Query  361  QAIVPVLPFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDFVSTQ  420
            Q  +PVLPFFAMSHY + +V+FFY+L+         +  +SIVSK L+PY   SDF+ST+
Sbjct  361  QTHLPVLPFFAMSHYQNDKVQFFYSLNYVPAQNKTTQMGYSIVSKHLKPYEIKSDFISTR  420

Query  421  LLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSLN  480
            LLCSN DLP+E L Q++  LNLNDS+LARRA++LKRPT P+ F+++KNEQWRIISHLSLN
Sbjct  421  LLCSNGDLPHEALSQSNNILNLNDSSLARRALILKRPTSPFHFDKNKNEQWRIISHLSLN  480

Query  481  TLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGVK  540
            TLALMKG++LSH+KELLALYNLP SKEN LLIDA+KQL+FS T+KLV +KPFPMF+RGVK
Sbjct  481  TLALMKGDALSHVKELLALYNLPHSKENILLIDALKQLSFSTTNKLVNSKPFPMFIRGVK  540

Query  541  AEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGKT  600
            AE++++ SVFRGHS+YIFSQL+SHI NLKVQ+NSFVDVV++DS+ QQE+YQCVQNVGGKT
Sbjct  541  AELAVNKSVFRGHSLYIFSQLLSHIFNLKVQINSFVDVVVKDSLNQQEIYQCVQNVGGKT  600

Query  601  LL  602
            LL
Sbjct  601  LL  602


> N9Q5W0 Type VI secretion protein [Acinetobacter sp. NIPH 2168]
Length=602

 Score =  920 bits (2378),  Expect = 0.0
 Identities = 444/602 (74%), Positives = 525/602 (87%), Gaps = 0/602 (0%)

Query  1    VIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60
            +IE+LLPYYEKQLQEF QQSREFA KYPKIAQRL+LNQEQIDDPHIERLIQAFSLIAARI
Sbjct  1    MIEQLLPYYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARI  60

Query  61   DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS  120
            DKK+ DSYD FT SLFEVMFPQYLRHFPAC+VVSFED+ KLKQLT  HIIP++T LKSRS
Sbjct  61   DKKLEDSYDVFTHSLFEVMFPQYLRHFPACTVVSFEDINKLKQLTAAHIIPQKTALKSRS  120

Query  121  FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK  180
            FKGVQCEFNT  +VRLLPISL++LEF+T   TH HL QNA+L+  F + N  Q W+  EK
Sbjct  121  FKGVQCEFNTTNDVRLLPISLIQLEFQTSPSTHMHLNQNATLSLKFEIFNDAQKWMLDEK  180

Query  181  LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH  240
            LPIYLDAISNFPLQ+LD IF+K+T F+LRVG    +I+NPFE+MGF+E E+LLP+DQHTH
Sbjct  181  LPIYLDAISNFPLQVLDSIFRKDTGFALRVGQHVVEISNPFEVMGFTEQESLLPIDQHTH  240

Query  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300
            HAYRLLMEYFCFPEKFNYLNL+LS+LK  +  Q +FE+LIHLKLNLND A VRNYSEL++
Sbjct  241  HAYRLLMEYFCFPEKFNYLNLDLSRLKGLLNQQNQFEILIHLKLNLNDQAVVRNYSELNI  300

Query  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360
             NFKLFTTP INLFEKQAEPQKI+H QL+YPLITDAH+P+ YQVYS+I+M M+REKT+QE
Sbjct  301  ANFKLFTTPAINLFEKQAEPQKISHTQLQYPLITDAHHPELYQVYSVIEMNMVREKTNQE  360

Query  361  QAIVPVLPFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDFVSTQ  420
            Q  +PVLPFFAMSHY + +V+FFY+L+         +  +SIVSK L+PY   SDF+ST+
Sbjct  361  QTHLPVLPFFAMSHYQNDKVQFFYSLNYVPAQNKTTQMGYSIVSKHLKPYEIKSDFISTR  420

Query  421  LLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSLN  480
            LLCSN DLP+E L Q++  LNLNDS+LARRA++LKRPT P+ F+++KNEQWRIISHLSLN
Sbjct  421  LLCSNGDLPHEALSQSNNILNLNDSSLARRALILKRPTSPFHFDKNKNEQWRIISHLSLN  480

Query  481  TLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGVK  540
            TLALMKG++LSH+KELLALYNLP SKEN LLIDA+KQL+FS T+KLV +KPFPMF+RGVK
Sbjct  481  TLALMKGDALSHVKELLALYNLPHSKENILLIDALKQLSFSTTNKLVNSKPFPMFIRGVK  540

Query  541  AEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGKT  600
            AE++++ SVFRGHS+YIFSQL+SHI NLKVQ+NSFVDVV++DS+ QQE+YQCVQNVGGKT
Sbjct  541  AELAVNKSVFRGHSLYIFSQLLSHIFNLKVQINSFVDVVVKDSLNQQEIYQCVQNVGGKT  600

Query  601  LL  602
            LL
Sbjct  601  LL  602


> A0A143G7N4 Type VI secretion system protein ImpG [Acinetobacter 
sp. TGL-Y2]
Length=602

 Score =  919 bits (2375),  Expect = 0.0
 Identities = 446/602 (74%), Positives = 518/602 (86%), Gaps = 0/602 (0%)

Query  1    VIEELLPYYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARI  60
            +IEELLPYYEKQLQEF QQSREFA KYPKIAQRL+LNQEQIDDPHIERLIQAFSLIAAR+
Sbjct  1    MIEELLPYYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARV  60

Query  61   DKKIADSYDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRS  120
            DKK+ADSYD FTR+LFEVMFPQYLRHFP C+VVSFEDL K+KQLTE H IP+QT LKSRS
Sbjct  61   DKKLADSYDVFTRALFEVMFPQYLRHFPGCTVVSFEDLNKVKQLTEAHFIPQQTTLKSRS  120

Query  121  FKGVQCEFNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSLLNPLQSWLYQEK  180
            FKGVQCEFNT  +V+LLPISL  L FKT    H HL QNA+L   F + N  Q+WL  EK
Sbjct  121  FKGVQCEFNTTQDVKLLPISLSHLNFKTNPTAHMHLNQNATLVLGFEIFNQAQTWLVNEK  180

Query  181  LPIYLDAISNFPLQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFSEAEALLPLDQHTH  240
            LPIYLDAISNFPLQ+LD IFK  T FS++VG+++ +INNPF +MGF E ++LLP+DQHTH
Sbjct  181  LPIYLDAISNFPLQVLDSIFKSSTGFSIKVGNRAVEINNPFTVMGFDETQSLLPIDQHTH  240

Query  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300
            HAYRLLMEYFCF EK+N+LNL+LS LK  I  Q+ FE+ IH KLNLND A +RNYSEL++
Sbjct  241  HAYRLLMEYFCFSEKYNFLNLDLSVLKGIIKEQSNFEIQIHFKLNLNDQAVIRNYSELNI  300

Query  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360
             NFKLF+TP INLFEK AEPQKINH+QLEYPL+TDAH+P+ YQVYSII+M MIREKT+Q+
Sbjct  301  ANFKLFSTPAINLFEKSAEPQKINHKQLEYPLLTDAHHPEFYQVYSIIEMNMIREKTNQD  360

Query  361  QAIVPVLPFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDFVSTQ  420
            Q   P+LPFFAMSHYHD +V+FFYAL+  +L   +VET +SI+SK L PY+T SDF+ST+
Sbjct  361  QVFFPILPFFAMSHYHDEKVQFFYALNPAQLHSKYVETGYSIISKHLTPYDTKSDFISTK  420

Query  421  LLCSNRDLPYEVLGQTHTSLNLNDSNLARRAVVLKRPTLPYQFEQHKNEQWRIISHLSLN  480
            LLCSNR+LP+E L Q++  LNLNDS+LARRA+VLKRP+LP+QFEQ++ EQWRIISHLSLN
Sbjct  421  LLCSNRNLPHEALSQSNNILNLNDSSLARRALVLKRPSLPHQFEQNQKEQWRIISHLSLN  480

Query  481  TLALMKGESLSHLKELLALYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKPFPMFVRGVK  540
            TLALMKG+++SH+KELL LYNLP++KENHLLIDAIKQ+ F LTHKLVEAKPFPMFVRGVK
Sbjct  481  TLALMKGDAVSHVKELLELYNLPKTKENHLLIDAIKQVEFGLTHKLVEAKPFPMFVRGVK  540

Query  541  AEISIDTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELYQCVQNVGGKT  600
              + ID  VFRGHS+YIFSQL+SH+ NLKVQMNSFVDVVI D   QQELYQCVQNVGGK 
Sbjct  541  VSLHIDEQVFRGHSLYIFSQLLSHVFNLKVQMNSFVDVVIFDVHSQQELYQCVQNVGGKK  600

Query  601  LL  602
            LL
Sbjct  601  LL  602


> R9TJM9 TssF [Campylobacter jejuni]
Length=573

 Score =  155 bits (392),  Expect = 8e-44
 Identities = 158/612 (26%), Positives = 274/612 (45%), Gaps = 62/612 (10%)

Query  8    YYEKQLQEFSQQSREFALKYPKIAQRLALNQEQIDDPHIERLIQAFSLIAARIDKKIADS  67
            YY+K+L+   ++   F   YPK+   LA +     DP IER+I+  + ++++I +++ ++
Sbjct  7    YYQKELEYLYEKREYFIKNYPKLTPFLAYDSI---DPDIERIIENLASLSSKIHQELDEN  63

Query  68   YDFFTRSLFEVMFPQYLRHFPACSVVSFEDLQKLKQLTEPHIIPKQTKLKSRSFKGVQCE  127
                  SL  ++ P Y    P+  +  F+  Q  K+     IIPK T +KS+      CE
Sbjct  64   IPHIAESLINIVSPNYTNPLPSLCMQEFKFEQNSKE--NNLIIPKGTLIKSKPIDKCVCE  121

Query  128  FNTAYEVRLLPISLVKLEFKTLQHTHAHLTQNASLNFHFSL-LNPLQSWLYQ---EKLPI  183
            F T Y+V L  IS+ ++   +         +N    F+ +L +N  ++ +     EK+ +
Sbjct  122  FKTVYDVYLYSISISEVFISS---------KNQDYTFNLTLQVNKAETKICDLGLEKINL  172

Query  184  YL--DAISNFPLQLLDQIFKKETRFSLRVGHQSFDINN-PFEMMGFSEAEALLPLDQHTH  240
            YL  D   +  L L    + KE +       + F +N    E +G +  E+ L  +    
Sbjct  173  YLGNDTYMSSTLLLYMHSYLKELKIQXLDTDEEFFLNTYNXEKIGLNPDESSLSYNDLGF  232

Query  241  HAYRLLMEYFCFPEKFNYLNLNLSQLKAFITTQTEFELLIHLKLNLNDPASVRNYSELDV  300
             A+ LL EYF  P KFN+L +N   +      +T   + I  K +   PA+     EL  
Sbjct  233  EAFSLLREYFFMPHKFNFLRINGLDILNNCQGKT---INIEFKFSKPFPANCIFRKEL--  287

Query  301  ENFKLFTTPVINLFEKQAEPQKINHQQLEYPLITDAHYPDAYQVYSIIDMQMIREKTHQE  360
                L  TP+IN+F K AEP   NH++  Y +  D   P AY++     +Q ++ K H  
Sbjct  288  --LSLSMTPIINIFTKSAEPLINNHKKDSYRIFVDRSQPKAYEI-----IQTLQVKAHNS  340

Query  361  QAIVPVL----PFFAMSHYHDHQVKFFYALHQQKLTKHHVETRFSIVSKQLEPYNTTSDF  416
            +    +L     F       D+Q K FY+++ +K +K  V +  S  S  +       + 
Sbjct  341  EGGKRLLKNYKSFERFEFLKDNQ-KDFYSVNTKKNSKGEVFSEISFFSSYI-----MDET  394

Query  417  VSTQLLCSNRDLPYEVLGQTHTSLNLNDSNLA-RRAVVLKRPTLPYQFEQ---HKNEQWR  472
            +S  LLCSN DLP        + L + D N    + V  K   +P +  +     N  W+
Sbjct  395  ISIDLLCSNGDLP--------SKLKIGDINTCDLKGVDTKNVEIPSETRRCSVDGNLLWK  446

Query  473  IISHLSLNTLALMKGESLSHLKELLA-LYNLPRSKENHLLIDAIKQLNFSLTHKLVEAKP  531
            ++S LS +   ++  ++   + E  + L N    K   LL ++I  +    T+ + E   
Sbjct  447  LVSVLSFSYQTILSKKAFFGVLESYSFLDNQSNWKIYKLLQESIIDIQSKSTYLIDE---  503

Query  532  FPMFVRGVKAEISI-DTSVFRGHSVYIFSQLVSHILNLKVQMNSFVDVVIRDSVRQQELY  590
              +  +G  A  SI D+  +    VY+   ++S  L     +NSF ++ IR  +  +E+ 
Sbjct  504  -NITKKGTLAIFSIKDSKFYTLGEVYLLGLIISKFLASFASINSFCELKIR-CLDSKEIL  561

Query  591  QCVQNVGGKTLL  602
                + G K L+
Sbjct  562  HYPASFGKKALI  573



Lambda      K        H        a         alpha
   0.324    0.137    0.398    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3294549


  Database: ae333f1bc291e96fb33feea4baef18e2.TrEMBL.fasta
    Posted date:  Oct 1, 2020  6:49 AM
  Number of letters in database: 6,595
  Number of sequences in database:  11



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40