ACIAD2687 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 2d741efdcb64979fb342e8238c35f26e.SwissProt.fasta
           1 sequences; 570 total letters



Query= ACIAD2687

Length=603
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q5ZXN5 Phosphocholine hydrolase Lem3 [Legionella pneumophila su...  36.2    3e-06


> Q5ZXN5 Phosphocholine hydrolase Lem3 [Legionella pneumophila 
subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 
7513)]
Length=570

 Score = 36.2 bits (82),  Expect = 3e-06
 Identities = 15/66 (23%), Positives = 32/66 (48%), Gaps = 0/66 (0%)

Query  333  ITDAHYPDAYQVYSIIDMQMIREKTHQEQAIVPVLPFFAMSHYHDHQVKFFYALHQQKLT  392
            +TDA YP ++ +  II  + +     + + ++ ++      H+H+  VK    + +  + 
Sbjct  288  LTDAPYPSSFDIARIITQRAMSRSLERRKTLIKLINEIEQQHFHEKSVKTINEVLEYFIK  347

Query  393  KHHVET  398
              HVET
Sbjct  348  TGHVET  353


 Score = 18.9 bits (37),  Expect = 0.62
 Identities = 7/10 (70%), Positives = 8/10 (80%), Gaps = 0/10 (0%)

Query  147  KTLQHTHAHL  156
            KTLQHT A +
Sbjct  159  KTLQHTEASM  168


 Score = 17.3 bits (33),  Expect = 1.9
 Identities = 5/26 (19%), Positives = 15/26 (58%), Gaps = 0/26 (0%)

Query  337  HYPDAYQVYSIIDMQMIREKTHQEQA  362
            +YP+ +Q+ + +    ++ +   E+A
Sbjct  416  NYPEKHQILAPLFKARVKSEADLEEA  441


 Score = 15.8 bits (29),  Expect = 5.5
 Identities = 25/120 (21%), Positives = 47/120 (39%), Gaps = 30/120 (25%)

Query  180  KLPIYLDAI----SNFP--LQLLDQIFKKETRFSLRVGHQSFDINNPFEMMGFS--EAEA  231
            ++P +LD +     N+P   Q+L  +FK   +          D+   F  +     + E 
Sbjct  402  RIPYHLDELIRGFINYPEKHQILAPLFKARVK-------SEADLEEAFHRLSLEMVQPEI  454

Query  232  LLPLDQ-HTHHAYR---------LLMEYF----CFPEKFNYLNLNLSQLKAFITTQTEFE  277
              P+ + H   A++         +L  YF        K NY    L+ L A+++ ++  E
Sbjct  455  ECPISETHFERAFKKETLDKTQAVLTHYFRISTGLDSKKNYQE-RLNDLSAYLSKESSLE  513



Lambda      K        H        a         alpha
   0.324    0.137    0.398    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 301678


  Database: 2d741efdcb64979fb342e8238c35f26e.SwissProt.fasta
    Posted date:  Oct 1, 2020  8:00 AM
  Number of letters in database: 570
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40