ACIAD2686 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 58155f584492ca5863af18fbe295b5ed.TrEMBL.fasta
           11 sequences; 3,615 total letters



Query= ACIAD2686

Length=333
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F925 Uncharacterized protein [Acinetobacter baylyi (strain AT...   677    0.0   
  N9BLC2 Type VI secretion protein [Acinetobacter soli NIPH 2899]      501    0.0   
  A0A1P8EES7 Type VI secretion protein [Acinetobacter soli]            500    0.0   
  S3TSC1 Type VI secretion protein [Acinetobacter colistiniresist...   479    3e-173
  N9PL54 Type VI secretion protein [Acinetobacter colistiniresist...   478    9e-173
  R9AVS5 Type VI secretion protein [Acinetobacter sp. CIP 110321]      476    7e-172
  N9PVW0 Type VI secretion protein [Acinetobacter sp. NIPH 2168]       476    7e-172
  A0A0B0KHP3 Uncharacterized protein ImpH/VasB [Acinetobacter sp....   476    7e-172
  N8UZ74 Type VI secretion protein [Acinetobacter sp. NIPH 758]        475    1e-171
  V2U789 Type VI secretion protein [Acinetobacter gyllenbergii NI...   475    1e-171
  R9TIT3 TssG [Campylobacter jejuni]                                  57.8    6e-13 


> Q6F925 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=332

 Score =  677 bits (1747),  Expect = 0.0
 Identities = 332/332 (100%), Positives = 332/332 (100%), Gaps = 0/332 (0%)

Query  1    MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK  60
            MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK
Sbjct  1    MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK  60

Query  61   TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT  120
            TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT
Sbjct  61   TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT  120

Query  121  VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN  180
            VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN
Sbjct  121  VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN  180

Query  181  TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG  240
            TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG
Sbjct  181  TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG  240

Query  241  KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV  300
            KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV
Sbjct  241  KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV  300

Query  301  HQMGLGQGVFLTSQASNQDNQDTCYSLIGAVA  332
            HQMGLGQGVFLTSQASNQDNQDTCYSLIGAVA
Sbjct  301  HQMGLGQGVFLTSQASNQDNQDTCYSLIGAVA  332


> N9BLC2 Type VI secretion protein [Acinetobacter soli NIPH 2899]
Length=332

 Score =  501 bits (1289),  Expect = 0.0
 Identities = 240/332 (72%), Positives = 282/332 (85%), Gaps = 0/332 (0%)

Query  1    MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK  60
            MR+ERWWQ TSVT++LF+   +FEFIQA RLLRHVP+ ++Q +WAS F FG+SL L FP 
Sbjct  1    MRSERWWQSTSVTENLFQTPKKFEFIQAIRLLRHVPFRLNQRRWASHFYFGTSLELGFPA  60

Query  61   TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT  120
            TEIEHLA+ ++RIE+ +L+VGLTGTQGALPYTYTNK+K+S+R QR+E QAFLGLFNHTL+
Sbjct  61   TEIEHLAKENDRIELVNLIVGLTGTQGALPYTYTNKVKRSARPQRKETQAFLGLFNHTLS  120

Query  121  VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN  180
             QYVDASLVHHLP+RYE+E+ENHYL ILHALNGYI+  HQ  ELDEYFAEFAGLMQGQN+
Sbjct  121  AQYVDASLVHHLPLRYEIEEENHYLKILHALNGYIAEQHQQPELDEYFAEFAGLMQGQNH  180

Query  181  TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG  240
            TA+AL+TML CIFKQ+V V+EFIREKF L+D QKT LGG  PSLLG+NTFCGD +EQ+DG
Sbjct  181  TAYALSTMLRCIFKQQVKVQEFIREKFALNDAQKTSLGGQNPSLLGVNTFCGDQVEQMDG  240

Query  241  KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV  300
            KIEIQIGPL+R+ YL FLPSG  S +LK IL TW +PTLLVD+RLIL  +DVQPF L SV
Sbjct  241  KIEIQIGPLQRQDYLRFLPSGEHSQRLKQILQTWSNPTLLVDVRLILKHEDVQPFQLSSV  300

Query  301  HQMGLGQGVFLTSQASNQDNQDTCYSLIGAVA  332
            H+ GLGQG FL S AS QD  DTCY+LIG VA
Sbjct  301  HEQGLGQGAFLMSAASGQDRDDTCYALIGVVA  332


> A0A1P8EES7 Type VI secretion protein [Acinetobacter soli]
Length=332

 Score =  500 bits (1287),  Expect = 0.0
 Identities = 240/332 (72%), Positives = 281/332 (85%), Gaps = 0/332 (0%)

Query  1    MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK  60
            MR+ERWWQ TSVT++LF+   +FEFIQA RLLRHVP+  +Q +WAS F FG+SL L FP 
Sbjct  1    MRSERWWQSTSVTENLFQTPKKFEFIQAIRLLRHVPFRFNQRRWASHFYFGTSLELGFPA  60

Query  61   TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT  120
            TEIEHLA+ ++RIE+ +L+VGLTGTQGALPYTYTNK+K+S+R QR+E QAFLGLFNHTL+
Sbjct  61   TEIEHLAKENDRIELVNLIVGLTGTQGALPYTYTNKVKRSARPQRKETQAFLGLFNHTLS  120

Query  121  VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN  180
             QYVDASLVHHLP+RYE+E+ENHYL ILHALNGYI+  HQ  ELDEYFAEFAGLMQGQN+
Sbjct  121  AQYVDASLVHHLPLRYEIEEENHYLKILHALNGYIAEQHQQPELDEYFAEFAGLMQGQNH  180

Query  181  TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG  240
            TA+AL+TML CIFKQ+V V+EFIREKF L+D QKT LGG  PSLLG+NTFCGD +EQ+DG
Sbjct  181  TAYALSTMLRCIFKQQVKVQEFIREKFALNDTQKTSLGGQNPSLLGVNTFCGDQVEQMDG  240

Query  241  KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV  300
            KIEIQIGPL+R+ YL FLPSG  S +LK IL TW +PTLLVD+RLIL  +DVQPF L SV
Sbjct  241  KIEIQIGPLQRQDYLRFLPSGEHSQRLKQILQTWSNPTLLVDVRLILKHEDVQPFQLSSV  300

Query  301  HQMGLGQGVFLTSQASNQDNQDTCYSLIGAVA  332
            H+ GLGQG FL S AS QD  DTCY+LIG VA
Sbjct  301  HEQGLGQGAFLMSAASGQDRDDTCYALIGVVA  332


> S3TSC1 Type VI secretion protein [Acinetobacter colistiniresistens]
Length=331

 Score =  479 bits (1233),  Expect = 3e-173
 Identities = 223/330 (68%), Positives = 276/330 (84%), Gaps = 0/330 (0%)

Query  1    MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK  60
            MRTERWWQD+SV D +F++ G FEF+Q+TRLLRH+P    Q  W+++FQF +S +LSFP 
Sbjct  1    MRTERWWQDSSVVDQVFKKAGSFEFVQSTRLLRHLPVAKRQQDWSNDFQFDTSFSLSFPA  60

Query  61   TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT  120
            TEIE L+  +ERI +T+LVVGLTGTQGALPYTYTNKLKQSSRQQR EI+AFLGLFNH LT
Sbjct  61   TEIEALSYQEERIHLTNLVVGLTGTQGALPYTYTNKLKQSSRQQRLEIKAFLGLFNHKLT  120

Query  121  VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN  180
             +YVDAS+ ++LP+RYE+EQENHYL+ILHALNGYI S H+ ++LDEYFAEF+GLMQGQNN
Sbjct  121  TKYVDASIAYNLPIRYEIEQENHYLDILHALNGYIRSQHEQHDLDEYFAEFSGLMQGQNN  180

Query  181  TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG  240
            TAHAL T+L C+F  +V ++EFI+E+F L DEQKTCLGG  PSLLGINTFCGDT++QIDG
Sbjct  181  TAHALKTVLGCVFDTQVHIQEFIKERFQLGDEQKTCLGGNNPSLLGINTFCGDTVQQIDG  240

Query  241  KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV  300
            KIEIQIGPL R+QYL FLP    + +LKH++ TWCSPTL +D+RLILD+++V+P CLDS 
Sbjct  241  KIEIQIGPLSREQYLAFLPDQPLNKKLKHLVQTWCSPTLFIDVRLILDKEEVRPICLDSA  300

Query  301  HQMGLGQGVFLTSQASNQDNQDTCYSLIGA  330
             ++GLGQG FL   A  Q N +T Y+L+GA
Sbjct  301  QEIGLGQGAFLMPSAQLQHNTETRYALLGA  330


> N9PL54 Type VI secretion protein [Acinetobacter colistiniresistens]
Length=331

 Score =  478 bits (1230),  Expect = 9e-173
 Identities = 224/330 (68%), Positives = 274/330 (83%), Gaps = 0/330 (0%)

Query  1    MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK  60
            MRTERWWQD+SV D +F++ G FEF+Q+TRLLRH+P    Q  W+ +FQF +S +LSFP 
Sbjct  1    MRTERWWQDSSVVDQVFKKAGSFEFVQSTRLLRHLPVAKRQQDWSDDFQFDTSFSLSFPA  60

Query  61   TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT  120
            TEIE L+  +ERI +T+LVVGLTGTQGALPYTYTNKLKQSSRQQR EI+AFLGLFNH LT
Sbjct  61   TEIEALSFQEERIHLTNLVVGLTGTQGALPYTYTNKLKQSSRQQRLEIKAFLGLFNHKLT  120

Query  121  VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN  180
             +YVDAS+ ++LP+RYE+EQENHYL+ILHALNGYI S H+ ++LDEYFAEF+GLMQGQNN
Sbjct  121  TKYVDASIAYNLPIRYEIEQENHYLDILHALNGYIRSQHEQHDLDEYFAEFSGLMQGQNN  180

Query  181  TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG  240
            TAHAL T+L C+F  +V ++EFI+E+F L DEQKTCLGG  PSLLGINTFCGDT++QIDG
Sbjct  181  TAHALKTVLGCVFDTQVHIQEFIKERFQLGDEQKTCLGGNNPSLLGINTFCGDTVQQIDG  240

Query  241  KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV  300
            KIEIQIGPL R+QYL FLP    + +LKH++ TWCSPTL +D+RLILD+D V+P CLDS 
Sbjct  241  KIEIQIGPLSREQYLAFLPDQPLNKKLKHLVQTWCSPTLFIDVRLILDKDAVRPICLDSA  300

Query  301  HQMGLGQGVFLTSQASNQDNQDTCYSLIGA  330
             ++GLGQG FL   A  Q N +T Y+L+GA
Sbjct  301  QEIGLGQGAFLMPSAQLQHNTETRYALLGA  330


> R9AVS5 Type VI secretion protein [Acinetobacter sp. CIP 110321]
Length=331

 Score =  476 bits (1224),  Expect = 7e-172
 Identities = 219/330 (66%), Positives = 276/330 (84%), Gaps = 0/330 (0%)

Query  1    MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK  60
            MRTERWWQD+SV D +F++ G FEFIQ+TRLLRH+P  + +  W+ +F+FG+S +LSFP 
Sbjct  1    MRTERWWQDSSVVDQVFKKPGSFEFIQSTRLLRHLPETIPKQDWSDDFKFGTSFSLSFPA  60

Query  61   TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT  120
            TEIE L+  D+R+ +T+LVVGLTGTQGALPYTYTNKLKQSSRQQR EI+AFLGLFNH LT
Sbjct  61   TEIEELSYQDQRVHLTNLVVGLTGTQGALPYTYTNKLKQSSRQQRLEIKAFLGLFNHKLT  120

Query  121  VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN  180
             +YVDASL ++L VRYE+EQ+NHYL+ILHALNGYI + H+  +LDEYFAEF+GLMQGQNN
Sbjct  121  AKYVDASLAYNLAVRYEIEQDNHYLDILHALNGYIRAQHEQQDLDEYFAEFSGLMQGQNN  180

Query  181  TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG  240
            TAHAL T+L+C+F Q+V ++EF++E F+L+DEQKT LGG+ PSLLG+NTFCGDT++QIDG
Sbjct  181  TAHALKTVLSCVFNQQVQIQEFVKETFHLADEQKTSLGGSNPSLLGVNTFCGDTVQQIDG  240

Query  241  KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV  300
            KIEIQIGPL R+QYL FLP    + +LKH++ TWCSPTL +D+RLILD+ ++ P CLDS 
Sbjct  241  KIEIQIGPLSREQYLAFLPDQPLNKKLKHLIQTWCSPTLFIDVRLILDKREINPICLDSG  300

Query  301  HQMGLGQGVFLTSQASNQDNQDTCYSLIGA  330
            HQ+GLGQG FL      Q N +T Y+L+GA
Sbjct  301  HQVGLGQGAFLMPSEQLQHNTETRYALLGA  330


> N9PVW0 Type VI secretion protein [Acinetobacter sp. NIPH 2168]
Length=331

 Score =  476 bits (1224),  Expect = 7e-172
 Identities = 223/330 (68%), Positives = 274/330 (83%), Gaps = 0/330 (0%)

Query  1    MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK  60
            MR ERWWQD+SV D +F++ G FEFIQ+TRLLRH+P    Q  W+ +F+FG+S +LSFP 
Sbjct  1    MRAERWWQDSSVVDQIFKKAGSFEFIQSTRLLRHLPVPSRQQDWSDDFKFGTSFSLSFPA  60

Query  61   TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT  120
            TEIE L+  DERI +T+LVVGLTGTQGALPYTYTNKLKQSSRQQR+EI+AFLGLFNH LT
Sbjct  61   TEIEELSYQDERIHLTNLVVGLTGTQGALPYTYTNKLKQSSRQQRQEIKAFLGLFNHKLT  120

Query  121  VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN  180
             +YVDAS+ ++LPVRYE+EQ+NHYL+ILHALNGYI S H+ ++LDEYFAEF+GLMQGQNN
Sbjct  121  TKYVDASIAYNLPVRYEIEQKNHYLDILHALNGYIRSQHEQHDLDEYFAEFSGLMQGQNN  180

Query  181  TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG  240
            TAHAL T+L  +F  +V ++EFI+EKF L DEQKT LGG+ PSLLGINTFCGDT+EQIDG
Sbjct  181  TAHALKTILGRVFDTQVQIQEFIKEKFQLGDEQKTTLGGSHPSLLGINTFCGDTVEQIDG  240

Query  241  KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV  300
            KIEIQIGPL R+QYL FLP+   + +LK ++ TWCSPTL +D+RLILD++++ P CLDS 
Sbjct  241  KIEIQIGPLNREQYLAFLPNQPLNKKLKDLIQTWCSPTLFIDVRLILDKNEISPICLDSS  300

Query  301  HQMGLGQGVFLTSQASNQDNQDTCYSLIGA  330
            H+MGLGQG FL      Q N +T Y+L+GA
Sbjct  301  HEMGLGQGAFLMPSVQLQHNSETRYALLGA  330


> A0A0B0KHP3 Uncharacterized protein ImpH/VasB [Acinetobacter sp. 
neg1]
Length=331

 Score =  476 bits (1224),  Expect = 7e-172
 Identities = 223/330 (68%), Positives = 274/330 (83%), Gaps = 0/330 (0%)

Query  1    MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK  60
            MR ERWWQD+SV D +F++ G FEFIQ+TRLLRH+P    Q  W+ +F+FG+S +LSFP 
Sbjct  1    MRAERWWQDSSVVDQIFKKAGSFEFIQSTRLLRHLPVPSRQQDWSDDFKFGTSFSLSFPA  60

Query  61   TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT  120
            TEIE L+  DERI +T+LVVGLTGTQGALPYTYTNKLKQSSRQQR+EI+AFLGLFNH LT
Sbjct  61   TEIEELSYQDERIHLTNLVVGLTGTQGALPYTYTNKLKQSSRQQRQEIKAFLGLFNHKLT  120

Query  121  VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN  180
             +YVDAS+ ++LPVRYE+EQ+NHYL+ILHALNGYI S H+ ++LDEYFAEF+GLMQGQNN
Sbjct  121  TKYVDASIAYNLPVRYEIEQKNHYLDILHALNGYIRSQHEQHDLDEYFAEFSGLMQGQNN  180

Query  181  TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG  240
            TAHAL T+L  +F  +V ++EFI+EKF L DEQKT LGG+ PSLLGINTFCGDT+EQIDG
Sbjct  181  TAHALKTILGRVFDTQVQIQEFIKEKFQLGDEQKTTLGGSHPSLLGINTFCGDTVEQIDG  240

Query  241  KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV  300
            KIEIQIGPL R+QYL FLP+   + +LK ++ TWCSPTL +D+RLILD++++ P CLDS 
Sbjct  241  KIEIQIGPLSREQYLAFLPNQPLNKKLKDLIQTWCSPTLFIDVRLILDKNEISPICLDSS  300

Query  301  HQMGLGQGVFLTSQASNQDNQDTCYSLIGA  330
            H+MGLGQG FL      Q N +T Y+L+GA
Sbjct  301  HEMGLGQGAFLMPSVQLQHNSETRYALLGA  330


> N8UZ74 Type VI secretion protein [Acinetobacter sp. NIPH 758]
Length=331

 Score =  475 bits (1223),  Expect = 1e-171
 Identities = 223/330 (68%), Positives = 274/330 (83%), Gaps = 0/330 (0%)

Query  1    MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK  60
            MR ERWWQD+SV D +F++ G FEFIQ+TRLLRH+P    Q  W+ +F+FG+S +LSFP 
Sbjct  1    MRAERWWQDSSVVDQIFKKAGSFEFIQSTRLLRHLPAPSRQQDWSDDFKFGTSFSLSFPA  60

Query  61   TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT  120
            TEIE L+  DERI +T+LVVGLTGTQGALPYTYTNKLKQSSRQQR+EI+AFLGLFNH LT
Sbjct  61   TEIEELSYQDERIHLTNLVVGLTGTQGALPYTYTNKLKQSSRQQRQEIKAFLGLFNHKLT  120

Query  121  VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN  180
             +YVDAS+ ++LPVRYE+EQ+NHYL+ILHALNGYI S H+ ++LDEYFAEF+GLMQGQNN
Sbjct  121  TKYVDASIAYNLPVRYEIEQKNHYLDILHALNGYIRSQHEQHDLDEYFAEFSGLMQGQNN  180

Query  181  TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG  240
            TAHAL T+L  +F  +V ++EFI+EKF L DEQKT LGG+ PSLLGINTFCGDT+EQIDG
Sbjct  181  TAHALKTILGRVFDTQVQIQEFIKEKFQLGDEQKTTLGGSNPSLLGINTFCGDTVEQIDG  240

Query  241  KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV  300
            KIEIQIGPL R+QYL FLP+   + +LK ++ TWCSPTL +D+RLILD++++ P CLDS 
Sbjct  241  KIEIQIGPLNREQYLAFLPNQPLNKKLKDLIQTWCSPTLFIDVRLILDKNEISPICLDSS  300

Query  301  HQMGLGQGVFLTSQASNQDNQDTCYSLIGA  330
            H+MGLGQG FL      Q N +T Y+L+GA
Sbjct  301  HEMGLGQGAFLMPSVQLQHNSETRYALLGA  330


> V2U789 Type VI secretion protein [Acinetobacter gyllenbergii 
NIPH 230]
Length=331

 Score =  475 bits (1222),  Expect = 1e-171
 Identities = 219/330 (66%), Positives = 274/330 (83%), Gaps = 0/330 (0%)

Query  1    MRTERWWQDTSVTDHLFRQFGRFEFIQATRLLRHVPYHMDQTQWASEFQFGSSLALSFPK  60
            MR ERWWQD+SV D +F++ G FEFIQ+TRLLRH P      +W+ +F+FG+S +LSFP 
Sbjct  1    MRAERWWQDSSVVDQVFKKSGSFEFIQSTRLLRHYPQASQVKRWSEDFKFGTSFSLSFPA  60

Query  61   TEIEHLAQSDERIEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAFLGLFNHTLT  120
            TEIE L+  D+RI +T+LVVGLTGTQGALPYTYTNKLKQSSRQQR EI+ FLGLFNH LT
Sbjct  61   TEIEELSYQDQRIHLTNLVVGLTGTQGALPYTYTNKLKQSSRQQRLEIKEFLGLFNHKLT  120

Query  121  VQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEFAGLMQGQNN  180
             +YVDASL ++L VRYE+EQ+NHYL+ILHALNGYI + H+  +LDEYFAEF+GLMQGQNN
Sbjct  121  AKYVDASLAYNLAVRYEIEQDNHYLDILHALNGYIRAQHEQQDLDEYFAEFSGLMQGQNN  180

Query  181  TAHALTTMLTCIFKQKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINTFCGDTIEQIDG  240
            TAHAL T+L+C+F Q+V ++EF++E F+L+DEQKT LGG+ PSLLG+NTFCGDT++QIDG
Sbjct  181  TAHALKTVLSCVFNQQVQIQEFVKETFHLADEQKTSLGGSNPSLLGVNTFCGDTVQQIDG  240

Query  241  KIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQDDVQPFCLDSV  300
            KIEIQIGPL R+QYL FLP    + +LKH++ TWCSPTL +D+RLILD+ D++P CLDS+
Sbjct  241  KIEIQIGPLPREQYLAFLPDQPLNKKLKHLIQTWCSPTLFIDVRLILDKHDIKPICLDSM  300

Query  301  HQMGLGQGVFLTSQASNQDNQDTCYSLIGA  330
            HQ+GLGQG FL      Q N +T Y+L+GA
Sbjct  301  HQIGLGQGAFLMPSEQLQHNTETRYALLGA  330


> R9TIT3 TssG [Campylobacter jejuni]
Length=302

 Score = 57.8 bits (138),  Expect = 6e-13
 Identities = 59/257 (23%), Positives = 106/257 (41%), Gaps = 12/257 (5%)

Query  55   ALSFPKTEIEHLAQSDER---IEMTSLVVGLTGTQGALPYTYTNKLKQSSRQQRREIQAF  111
            +L  P  +IE +  S+     IE+    +GL G    LP    +KL ++    +     F
Sbjct  32   SLKHPNKDIEKIIFSEHEQSVIELFINFMGLHGVSSQLPSFMLDKLSRNEDGDQGWT-LF  90

Query  112  LGLFNHTLTVQYVDASLVHHLPVRYEVEQENHYLNILHALNGYISSHHQHNELDEYFAEF  171
               FNH L   + D   + + P  +    ++    IL ++ G      +  ++ + +  F
Sbjct  91   FDFFNHYLLWIFFDVISLKNYPRSFNENFKDSISKILFSMLGI-----KEYDIAKKYLPF  145

Query  172  AGLMQGQNNTAHALTTMLTCIFK--QKVMVKEFIREKFYLSDEQKTCLGGAQPSLLGINT  229
            A L+         +  +L   FK   K+ + E +  +  +S+ QK  LG  + ++LG N 
Sbjct  146  APLLLSLRRPKTHIERVLQVNFKLKDKLSIIENLPHQILISNSQKNNLG-IKNNILGNNF  204

Query  230  FCGDTIEQIDGKIEIQIGPLKRKQYLDFLPSGRASTQLKHILATWCSPTLLVDLRLILDQ  289
              GD       KI I I  +  ++ + F+P+G     LK+ +    +    VDL L ++ 
Sbjct  205  ILGDKFISYQNKIAIYIKDISYQEAVKFMPNGTKHDDLKNSIMFLTNNEFCVDLYLKINY  264

Query  290  DDVQPFCLDSVHQMGLG  306
                 F L   +   LG
Sbjct  265  SSEMKFVLGEENTAKLG  281



Lambda      K        H        a         alpha
   0.324    0.136    0.412    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 904859


  Database: 58155f584492ca5863af18fbe295b5ed.TrEMBL.fasta
    Posted date:  Oct 1, 2020  5:51 AM
  Number of letters in database: 3,615
  Number of sequences in database:  11



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40