ACIAD2627 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 549638f6c93d9b0b4b01c59d68340a18.TrEMBL.fasta
           25 sequences; 4,969 total letters



Query= ACIAD2627

Length=213
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F980 Putative RNA polymerase sigma factor [Acinetobacter bayl...   424    2e-155
  A0A0M1I693 RNA polymerase sigma70 factor [Acinetobacter sp. C15]     390    4e-142
  N9BSQ5 Uncharacterized protein [Acinetobacter soli NIPH 2899]        389    1e-141
  A0A1P8EEW5 RNA polymerase sigma factor [Acinetobacter soli]          387    1e-140
  D0SK65 RNA polymerase factor sigma-70 [Acinetobacter junii SH205]    363    4e-131
  N9Q4J6 Uncharacterized protein [Acinetobacter sp. NIPH 2168]         360    5e-130
  A0A0B0KLF2 Putative RNA polymerase sigma factor [Acinetobacter ...   359    7e-130
  N8UXM2 Uncharacterized protein [Acinetobacter sp. NIPH 758]          358    1e-129
  N8QJE7 Uncharacterized protein [Acinetobacter sp. NIPH 809]          358    1e-129
  N9R332 Uncharacterized protein [Acinetobacter colistiniresistens]    358    1e-129
  K9BFJ4 RNA polymerase factor sigma-70 [Acinetobacter sp. WC-323]     358    1e-129
  N9RZN4 Uncharacterized protein [Acinetobacter sp. ANC 3880]          358    2e-129
  N9SXV4 Uncharacterized protein [Acinetobacter sp. CIP 70.18]         358    2e-129
  A0A2N0WFR3 RNA polymerase sigma factor [Acinetobacter proteolyt...   358    2e-129
  N8XN54 Uncharacterized protein [Acinetobacter sp. CIP 56.2]          358    2e-129
  Q6KBW7 RNA polymerase sigma factor [Burkholderia cepacia]           52.4    7e-12 
  Q9AE28 RNA polymerase sigma factor [Rhizobium leguminosarum]        51.6    1e-11 
  A0FHT5 Putative ECF sigma factor protein [uncultured bacterium]     48.9    9e-11 
  A0FHT7 Putative ECF sigma factor protein [uncultured bacterium]     48.5    1e-10 
  A0FHU3 Putative ECF sigma factor protein [uncultured bacterium]     48.1    2e-10 
  A0FHU0 Putative ECF sigma factor protein [uncultured bacterium]     48.1    2e-10 
  A0FHT9 Putative ECF sigma factor protein [uncultured bacterium]     46.6    6e-10 
  Q6W5B0 ECF sigma factor [Enterococcus faecalis]                     45.4    1e-09 
  O05735 Extracytoplasmic function alternative sigma factor [Myco...  46.2    2e-09 
  D7PC27 Putative sigma-24 [Streptomyces luridus]                     45.8    2e-09 


> Q6F980 Putative RNA polymerase sigma factor [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=212

 Score =  424 bits (1091),  Expect = 2e-155
 Identities = 212/212 (100%), Positives = 212/212 (100%), Gaps = 0/212 (0%)

Query  1    MTGFSISMDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLV  60
            MTGFSISMDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLV
Sbjct  1    MTGFSISMDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLV  60

Query  61   QEAFIALHKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVT  120
            QEAFIALHKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVT
Sbjct  61   QEAFIALHKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVT  120

Query  121  DVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEG  180
            DVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEG
Sbjct  121  DVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEG  180

Query  181  SVKTHYHRAIQGLRASLAHLNPSLGGSSDESR  212
            SVKTHYHRAIQGLRASLAHLNPSLGGSSDESR
Sbjct  181  SVKTHYHRAIQGLRASLAHLNPSLGGSSDESR  212


> A0A0M1I693 RNA polymerase sigma70 factor [Acinetobacter sp. C15]
Length=205

 Score =  390 bits (1003),  Expect = 4e-142
 Identities = 191/205 (93%), Positives = 202/205 (99%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQSR++RSTHEGTVEQRLKFFMQDV+GRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQSRTERSTHEGTVEQRLKFFMQDVSGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+ DEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSD+E+TDVVDETT
Sbjct  61   HKSYADKSIDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDDEITDVVDETT  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPF+FLDQAVTIEEIQ AI++LPVRQQQAFMLRAWEGFDTQTTAQIMNC+EGSVKTHYH
Sbjct  121  PNPFDFLDQAVTIEEIQDAISKLPVRQQQAFMLRAWEGFDTQTTAQIMNCTEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLRASLAHLNPSLGGSSDESR
Sbjct  181  RAIQGLRASLAHLNPSLGGSSDESR  205


> N9BSQ5 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=205

 Score =  389 bits (999),  Expect = 1e-141
 Identities = 190/205 (93%), Positives = 201/205 (98%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQSR++RSTHEGT EQRLKFFMQDV+GRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQSRTERSTHEGTAEQRLKFFMQDVSGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+ DEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSD+E+TDVVDETT
Sbjct  61   HKSYADKSIDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDDEITDVVDETT  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPF+FLDQAVTIEEIQ AI++LPVRQQQAFMLRAWEGFDTQTTAQIMNC+EGSVKTHYH
Sbjct  121  PNPFDFLDQAVTIEEIQDAISKLPVRQQQAFMLRAWEGFDTQTTAQIMNCTEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLRASLAHLNPSLGGSSDESR
Sbjct  181  RAIQGLRASLAHLNPSLGGSSDESR  205


> A0A1P8EEW5 RNA polymerase sigma factor [Acinetobacter soli]
Length=205

 Score =  387 bits (993),  Expect = 1e-140
 Identities = 189/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQSR++RSTHEGT EQRLKFFMQDV+GRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQSRTERSTHEGTAEQRLKFFMQDVSGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+ DEWYPLFYTILNNKLQDWRRKEARRSNPFSF KKVSLDSD+E+TDVVDETT
Sbjct  61   HKSYADKSIDEWYPLFYTILNNKLQDWRRKEARRSNPFSFLKKVSLDSDDEITDVVDETT  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPF+FLDQAVTIEEIQ AI++LPVRQQQAFMLRAWEGFDTQTTAQIMNC+EGSVKTHYH
Sbjct  121  PNPFDFLDQAVTIEEIQDAISKLPVRQQQAFMLRAWEGFDTQTTAQIMNCTEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLRASLAHLNPSLGGSSDESR
Sbjct  181  RAIQGLRASLAHLNPSLGGSSDESR  205


> D0SK65 RNA polymerase factor sigma-70 [Acinetobacter junii SH205]
Length=210

 Score =  363 bits (931),  Expect = 4e-131
 Identities = 176/210 (84%), Positives = 192/210 (91%), Gaps = 0/210 (0%)

Query  1    MTGFSISMDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLV  60
            MTGFSISMDLAPKQ+++D  TH GT EQRL+FFMQDVTGRALVMMESATQGQ GIAMDLV
Sbjct  1    MTGFSISMDLAPKQAQTDSGTHTGTAEQRLRFFMQDVTGRALVMMESATQGQQGIAMDLV  60

Query  61   QEAFIALHKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVT  120
            QEAFI+LHKSY+DK  DEWYPLFYTILNNKLQDWRRKEARR++PFS FKK+S+D DEE+ 
Sbjct  61   QEAFISLHKSYSDKTVDEWYPLFYTILNNKLQDWRRKEARRASPFSLFKKISIDDDEELI  120

Query  121  DVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEG  180
            DVVDE+TPNPFEFL+Q VT+EEIQ AI +LPVRQQQAFMLRAWEGFDT TTAQIMNCSEG
Sbjct  121  DVVDESTPNPFEFLNQEVTMEEIQDAIHKLPVRQQQAFMLRAWEGFDTITTAQIMNCSEG  180

Query  181  SVKTHYHRAIQGLRASLAHLNPSLGGSSDE  210
            SVKTHYHRAIQGLR +L HLNP  GGSSDE
Sbjct  181  SVKTHYHRAIQGLRIALEHLNPHSGGSSDE  210


> N9Q4J6 Uncharacterized protein [Acinetobacter sp. NIPH 2168]
Length=205

 Score =  360 bits (923),  Expect = 5e-130
 Identities = 175/205 (85%), Positives = 188/205 (92%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQ+R++  T   TVEQRL+FFMQDVTGRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQARTENGTDRSTVEQRLRFFMQDVTGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+TDEWYPLFYTILNNKLQDWRRKEARR++PFS FKK+SLD DEE+ DVVDE+T
Sbjct  61   HKSYADKSTDEWYPLFYTILNNKLQDWRRKEARRASPFSLFKKISLDDDEEIIDVVDEST  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPFEFLDQ VTIEEIQAAI QLPVRQQQAFMLRAWEGFDT TTAQIM+CSEGSVKTHYH
Sbjct  121  PNPFEFLDQEVTIEEIQAAINQLPVRQQQAFMLRAWEGFDTMTTAQIMDCSEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLR +L HLNP  GGSSDE R
Sbjct  181  RAIQGLRIALEHLNPHTGGSSDEKR  205


> A0A0B0KLF2 Putative RNA polymerase sigma factor [Acinetobacter 
sp. neg1]
Length=205

 Score =  359 bits (922),  Expect = 7e-130
 Identities = 174/205 (85%), Positives = 188/205 (92%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQ+R++  T   TVEQRL+FFMQDVTGRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQARTENGTDRSTVEQRLRFFMQDVTGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+TDEWYPLFYTILNNKLQDWRRKEARR++PFS FKK+SLD DEE+ DVVDE+T
Sbjct  61   HKSYADKSTDEWYPLFYTILNNKLQDWRRKEARRASPFSLFKKISLDDDEEIIDVVDEST  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPFEFLDQ VTIEEIQAAI QLPVRQQQAFMLRAWEGFDT TTAQ+M+CSEGSVKTHYH
Sbjct  121  PNPFEFLDQEVTIEEIQAAINQLPVRQQQAFMLRAWEGFDTMTTAQVMDCSEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLR +L HLNP  GGSSDE R
Sbjct  181  RAIQGLRIALEHLNPHTGGSSDEKR  205


> N8UXM2 Uncharacterized protein [Acinetobacter sp. NIPH 758]
Length=205

 Score =  358 bits (920),  Expect = 1e-129
 Identities = 174/205 (85%), Positives = 188/205 (92%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQ+R++  T   TVEQRL+FFMQDVTGRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQARTENGTDRSTVEQRLRFFMQDVTGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+TDEWYPLFYTILNNKLQDWRRKEARR++PFS FKK+SLD DEE+ DVVDE+T
Sbjct  61   HKSYADKSTDEWYPLFYTILNNKLQDWRRKEARRASPFSLFKKISLDDDEEIIDVVDEST  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPFEFLDQ VT+EEIQAAI QLPVRQQQAFMLRAWEGFDT TTAQIM+CSEGSVKTHYH
Sbjct  121  PNPFEFLDQEVTMEEIQAAINQLPVRQQQAFMLRAWEGFDTMTTAQIMDCSEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLR +L HLNP  GGSSDE R
Sbjct  181  RAIQGLRIALEHLNPHTGGSSDEKR  205


> N8QJE7 Uncharacterized protein [Acinetobacter sp. NIPH 809]
Length=205

 Score =  358 bits (920),  Expect = 1e-129
 Identities = 174/205 (85%), Positives = 189/205 (92%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQ+R++ ST   TVEQRL+FFMQDVTGRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQARTENSTDRSTVEQRLRFFMQDVTGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+T+EWYPLFYTILNNKLQDWRRKEARR++PFS FKK+SLD DEE+ DVVDE+T
Sbjct  61   HKSYADKSTEEWYPLFYTILNNKLQDWRRKEARRASPFSLFKKISLDDDEEIIDVVDEST  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPFEFLDQ VT+EEIQAAI QLPVRQQQAFMLRAWEGFDT TTAQIM+CSEGSVKTHYH
Sbjct  121  PNPFEFLDQEVTMEEIQAAINQLPVRQQQAFMLRAWEGFDTMTTAQIMDCSEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLR +L HLNP  GGSSDE R
Sbjct  181  RAIQGLRIALEHLNPHTGGSSDEKR  205


> N9R332 Uncharacterized protein [Acinetobacter colistiniresistens]
Length=205

 Score =  358 bits (920),  Expect = 1e-129
 Identities = 174/205 (85%), Positives = 189/205 (92%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQ+R++ ST   TVEQRL+FFMQDVTGRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQARTENSTDRSTVEQRLRFFMQDVTGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+T+EWYPLFYTILNNKLQDWRRKEARR++PFS FKK+SLD DEE+ DVVDE+T
Sbjct  61   HKSYADKSTEEWYPLFYTILNNKLQDWRRKEARRASPFSLFKKISLDDDEEIIDVVDEST  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPFEFLDQ VT+EEIQAAI QLPVRQQQAFMLRAWEGFDT TTAQIM+CSEGSVKTHYH
Sbjct  121  PNPFEFLDQEVTMEEIQAAINQLPVRQQQAFMLRAWEGFDTMTTAQIMDCSEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLR +L HLNP  GGSSDE R
Sbjct  181  RAIQGLRIALEHLNPHTGGSSDEKR  205


> K9BFJ4 RNA polymerase factor sigma-70 [Acinetobacter sp. WC-323]
Length=205

 Score =  358 bits (920),  Expect = 1e-129
 Identities = 174/205 (85%), Positives = 188/205 (92%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQ+R++  T   TVEQRL+FFMQDVTGRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQARTENGTDRSTVEQRLRFFMQDVTGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+TDEWYPLFYTILNNKLQDWRRKEARR++PFS FKK+SLD DEE+ DVVDE+T
Sbjct  61   HKSYADKSTDEWYPLFYTILNNKLQDWRRKEARRASPFSLFKKISLDDDEEIIDVVDEST  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPFEFLDQ VT+EEIQAAI QLPVRQQQAFMLRAWEGFDT TTAQIM+CSEGSVKTHYH
Sbjct  121  PNPFEFLDQEVTMEEIQAAINQLPVRQQQAFMLRAWEGFDTMTTAQIMDCSEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLR +L HLNP  GGSSDE R
Sbjct  181  RAIQGLRIALEHLNPHTGGSSDEKR  205


> N9RZN4 Uncharacterized protein [Acinetobacter sp. ANC 3880]
Length=205

 Score =  358 bits (919),  Expect = 2e-129
 Identities = 173/205 (84%), Positives = 189/205 (92%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQ+R++ ST   TVEQRL+FFMQDVTGRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQARTENSTDRSTVEQRLRFFMQDVTGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+T+EWYPLFYTILNNKLQDWRRKEARR++PFS FKK+SLD DEE+ DVVDE+T
Sbjct  61   HKSYADKSTEEWYPLFYTILNNKLQDWRRKEARRASPFSLFKKISLDDDEEIIDVVDEST  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPFEFLDQ VT+EEIQAA+ QLPVRQQQAFMLRAWEGFDT TTAQIM+CSEGSVKTHYH
Sbjct  121  PNPFEFLDQEVTMEEIQAAVNQLPVRQQQAFMLRAWEGFDTMTTAQIMDCSEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLR +L HLNP  GGSSDE R
Sbjct  181  RAIQGLRIALEHLNPHTGGSSDEKR  205


> N9SXV4 Uncharacterized protein [Acinetobacter sp. CIP 70.18]
Length=205

 Score =  358 bits (919),  Expect = 2e-129
 Identities = 173/205 (84%), Positives = 189/205 (92%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQ+R++ ST   TVEQRL+FFMQDVTGRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQARTENSTDRSTVEQRLRFFMQDVTGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+T+EWYPLFYTILNNKLQDWRRKEARR++PFS FKK+SLD DEE+ DVVDE+T
Sbjct  61   HKSYADKSTEEWYPLFYTILNNKLQDWRRKEARRASPFSLFKKISLDDDEEIIDVVDEST  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPFEFLDQ VT+EEIQAA+ QLPVRQQQAFMLRAWEGFDT TTAQIM+CSEGSVKTHYH
Sbjct  121  PNPFEFLDQEVTMEEIQAAVNQLPVRQQQAFMLRAWEGFDTMTTAQIMDCSEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLR +L HLNP  GGSSDE R
Sbjct  181  RAIQGLRIALEHLNPHTGGSSDEKR  205


> A0A2N0WFR3 RNA polymerase sigma factor [Acinetobacter proteolyticus]
Length=205

 Score =  358 bits (919),  Expect = 2e-129
 Identities = 173/205 (84%), Positives = 189/205 (92%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQ+R++ ST   TVEQRL+FFMQDVTGRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQARTENSTDRSTVEQRLRFFMQDVTGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+T+EWYPLFYTILNNKLQDWRRKEARR++PFS FKK+SLD DEE+ D+VDE+T
Sbjct  61   HKSYADKSTEEWYPLFYTILNNKLQDWRRKEARRASPFSLFKKISLDDDEEIIDIVDEST  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPFEFLDQ VT+EEIQAAI QLPVRQQQAFMLRAWEGFDT TTAQIM+CSEGSVKTHYH
Sbjct  121  PNPFEFLDQEVTMEEIQAAINQLPVRQQQAFMLRAWEGFDTMTTAQIMDCSEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLR +L HLNP  GGSSDE R
Sbjct  181  RAIQGLRIALEHLNPHTGGSSDEKR  205


> N8XN54 Uncharacterized protein [Acinetobacter sp. CIP 56.2]
Length=205

 Score =  358 bits (919),  Expect = 2e-129
 Identities = 173/205 (84%), Positives = 189/205 (92%), Gaps = 0/205 (0%)

Query  8    MDLAPKQSRSDRSTHEGTVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIAL  67
            MDLAPKQ+R++ ST   TVEQRL+FFMQDVTGRALVMMESATQGQ GIAMDLVQEAFI+L
Sbjct  1    MDLAPKQARTENSTDRSTVEQRLRFFMQDVTGRALVMMESATQGQQGIAMDLVQEAFISL  60

Query  68   HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETT  127
            HKSYADK+T+EWYPLFYTILNNKLQDWRRKEARR++PFS FKK+SLD DEE+ DVVDE+T
Sbjct  61   HKSYADKSTEEWYPLFYTILNNKLQDWRRKEARRASPFSLFKKISLDDDEEIIDVVDEST  120

Query  128  PNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYH  187
            PNPFEFLDQ VT+EEIQAA+ QLPVRQQQAFMLRAWEGFDT TTAQIM+CSEGSVKTHYH
Sbjct  121  PNPFEFLDQEVTMEEIQAAVNQLPVRQQQAFMLRAWEGFDTMTTAQIMDCSEGSVKTHYH  180

Query  188  RAIQGLRASLAHLNPSLGGSSDESR  212
            RAIQGLR +L HLNP  GGSSDE R
Sbjct  181  RAIQGLRIALEHLNPHTGGSSDEKR  205


> Q6KBW7 RNA polymerase sigma factor [Burkholderia cepacia]
Length=199

 Score = 52.4 bits (124),  Expect = 7e-12
 Identities = 37/144 (26%), Positives = 65/144 (45%), Gaps = 3/144 (2%)

Query  58   DLVQEAFIALHKSYAD-KATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLDSD  116
            D+ Q+AFI  +++    +    +Y   Y I  N  +++   + RR+   +       ++ 
Sbjct  49   DVAQDAFIKAYRALPQFRGESAFYTWLYRIAVNTAKNYLATQGRRAPTSTEADAEEAETF  108

Query  117  EEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMN  176
             +   + D  TP       Q    E + AA+A LP   +QA  LR  EG   +  A++M 
Sbjct  109  SDADQLRDINTPESMLMSKQIA--ETVNAAMALLPEELRQAITLREIEGLSYEEIAEMMG  166

Query  177  CSEGSVKTHYHRAIQGLRASLAHL  200
            C  G+V++   RA + + A L  L
Sbjct  167  CPIGTVRSRIFRAREAIAAKLRPL  190


> Q9AE28 RNA polymerase sigma factor [Rhizobium leguminosarum]
Length=185

 Score = 51.6 bits (122),  Expect = 1e-11
 Identities = 45/149 (30%), Positives = 73/149 (49%), Gaps = 18/149 (12%)

Query  51   GQHGIAMDLVQEAFIAL--HKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFF  108
            G+H  A DLVQ+A +     + + +  T+    LF TIL N+L    RK  R        
Sbjct  29   GRHDRADDLVQDAIMKAWAKQDHFEMGTNMKAWLF-TILRNELYSQMRKSGREVQ-----  82

Query  109  KKVSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDT  168
                 DSD   T+ +    P+ +  LD    +++ + A+ QLP  Q++A +L    GF  
Sbjct  83   -----DSDGLFTESM-AMHPSQYGALD----LQDFKKALDQLPPDQREAIILVGASGFSY  132

Query  169  QTTAQIMNCSEGSVKTHYHRAIQGLRASL  197
            +  A+I  C+ G++K+  +RA Q L+  L
Sbjct  133  EEAAEICGCAVGTIKSRVNRARQRLQELL  161


> A0FHT5 Putative ECF sigma factor protein [uncultured bacterium]
Length=175

 Score = 48.9 bits (115),  Expect = 9e-11
 Identities = 34/141 (24%), Positives = 64/141 (45%), Gaps = 8/141 (6%)

Query  51   GQHGIAMDLVQEAFIALHKSYADKATDEWYPLFYTILNNKLQD-WRRKEARRSNPFSFFK  109
            G    A DL Q+ F    K    ++ ++     + I  N L+D WRR+++R  +      
Sbjct  29   GSSADAADLAQDTFAQWLKWPGRQSVEQPRAFLFQIARNLLRDHWRRQQSRGQD------  82

Query  110  KVSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQ  169
             +   +  +    ++     P E  +Q   +  + AA+A+LP R+++AF+L  ++G    
Sbjct  83   -LDRPAANDEPAALEGEAAGPGERFEQQQRLSHLAAALAELPPRRREAFVLHKFDGLSQV  141

Query  170  TTAQIMNCSEGSVKTHYHRAI  190
              A+ M  S   V+ H   A+
Sbjct  142  EVAERMGISLSMVEKHIASAL  162


> A0FHT7 Putative ECF sigma factor protein [uncultured bacterium]
Length=175

 Score = 48.5 bits (114),  Expect = 1e-10
 Identities = 34/141 (24%), Positives = 63/141 (45%), Gaps = 8/141 (6%)

Query  51   GQHGIAMDLVQEAFIALHKSYADKATDEWYPLFYTILNNKLQD-WRRKEARRSNPFSFFK  109
            G    A DL Q+ F    K    ++ ++     + I  N L+D WRR+++R  +      
Sbjct  29   GSSADAADLAQDTFAQWLKWPGRQSVEQPRAFLFQIARNLLRDHWRRQQSRGQD------  82

Query  110  KVSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQ  169
             +   +  +    ++     P E   Q   +  + AA+A+LP R+++AF+L  ++G    
Sbjct  83   -IDRPAANDEPAALEGEAAGPGERFGQQQRLSHLAAALAELPPRRREAFVLHKFDGLSQV  141

Query  170  TTAQIMNCSEGSVKTHYHRAI  190
              A+ M  S   V+ H   A+
Sbjct  142  EVAERMGISLSMVEKHIASAL  162


> A0FHU3 Putative ECF sigma factor protein [uncultured bacterium]
Length=175

 Score = 48.1 bits (113),  Expect = 2e-10
 Identities = 34/141 (24%), Positives = 64/141 (45%), Gaps = 8/141 (6%)

Query  51   GQHGIAMDLVQEAFIALHKSYADKATDEWYPLFYTILNNKLQD-WRRKEARRSNPFSFFK  109
            G    A DL Q+ F    K    ++ ++     + I  N L+D WRR+++R  +      
Sbjct  29   GSSADAADLAQDTFDQWLKWPGRQSVEQPRAFLFQIARNLLRDHWRRQQSRGQD------  82

Query  110  KVSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQ  169
             +   +  +    ++     P E  +Q   +  + AA+A+LP R+++AF+L  ++G    
Sbjct  83   -LDRPAANDEPAALEGEAAGPGERFEQQQRLSHLAAALAELPPRRREAFVLHKFDGLSQV  141

Query  170  TTAQIMNCSEGSVKTHYHRAI  190
              A+ M  S   V+ H   A+
Sbjct  142  EVAERMGISLSMVEKHIASAL  162


> A0FHU0 Putative ECF sigma factor protein [uncultured bacterium]
Length=175

 Score = 48.1 bits (113),  Expect = 2e-10
 Identities = 35/141 (25%), Positives = 63/141 (45%), Gaps = 8/141 (6%)

Query  51   GQHGIAMDLVQEAFIALHKSYADKATDEWYPLFYTILNNKLQD-WRRKEARRSNPFSFFK  109
            G    A DL Q+ F    K    ++ ++     + I  N L+D WRR+++R  +     +
Sbjct  29   GSSADAADLAQDTFAQWLKWPGRQSVEQPRAFLFQIARNLLRDHWRRQQSRGQD----LE  84

Query  110  KVSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQ  169
            + + D +  V +        P E  +    +  + AA+A LP R+++AF+L  ++G    
Sbjct  85   RPAADDERAVPEA---EVAGPGERFEHQQRLSHLAAALADLPPRRREAFVLHKFDGLSQA  141

Query  170  TTAQIMNCSEGSVKTHYHRAI  190
              A  M  S   V+ H   A+
Sbjct  142  EVAARMGISLSMVEKHIASAL  162


> A0FHT9 Putative ECF sigma factor protein [uncultured bacterium]
Length=175

 Score = 46.6 bits (109),  Expect = 6e-10
 Identities = 34/141 (24%), Positives = 62/141 (44%), Gaps = 8/141 (6%)

Query  51   GQHGIAMDLVQEAFIALHKSYADKATDEWYPLFYTILNNKLQD-WRRKEARRSNPFSFFK  109
            G    A DL Q+ F    K    ++ ++     + I  N L+D WRR+++R  +      
Sbjct  29   GSSADAADLAQDTFAQWLKWPGRQSVEQPRAFLFQIARNLLRDHWRRQQSRGQD------  82

Query  110  KVSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQ  169
             +   +  +    ++     P E   Q   +  + AA+A+LP R+++AF+L   +G    
Sbjct  83   -LDRPAANDEPAALEGEAAGPGERFGQQQRLSHLAAALAELPPRRREAFVLHKLDGLSQV  141

Query  170  TTAQIMNCSEGSVKTHYHRAI  190
              A+ M  S   V+ H   A+
Sbjct  142  EVAERMGISLSMVEKHIASAL  162


> Q6W5B0 ECF sigma factor [Enterococcus faecalis]
Length=165

 Score = 45.4 bits (106),  Expect = 1e-09
 Identities = 39/145 (27%), Positives = 71/145 (49%), Gaps = 25/145 (17%)

Query  57   MDLVQEAFI----ALHKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVS  112
            +D++QE+F     A+ K       D W   F+ IL +   D+ RK+ R +        V 
Sbjct  41   LDVIQESFEKALKAIQKGPDINDFDAW---FFRILLSVATDYWRKKKREA--------VH  89

Query  113  LDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTA  172
            ++ DE V  +++    NP        +  EI+  I QL    ++  +L+ +EGF  +  A
Sbjct  90   IEKDEHVLALLN----NPQR------SFLEIEEIINQLDSPNREIILLKFFEGFTLKEIA  139

Query  173  QIMNCSEGSVKTHYHRAIQGLRASL  197
             I++ +E ++KT  +R++  LR+ L
Sbjct  140  LILDINENTIKTKMYRSLNELRSLL  164


> O05735 Extracytoplasmic function alternative sigma factor [Mycobacterium 
avium]
Length=251

 Score = 46.2 bits (108),  Expect = 2e-09
 Identities = 38/148 (26%), Positives = 61/148 (41%), Gaps = 10/148 (7%)

Query  51   GQHGIAMDLVQEAFIALHKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKK  110
            G    A DL QE FI + +S  +     +    + I  N   D  R+ +R          
Sbjct  101  GNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRSR----------  150

Query  111  VSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQT  170
            + +++  E  + V    PNP E    +    ++QAA+  LP   + A +L   EG   + 
Sbjct  151  IRMEALPEDYERVPADEPNPEEIYHDSRLGPDLQAALDSLPPEFRAAVVLCDIEGLSYEE  210

Query  171  TAQIMNCSEGSVKTHYHRAIQGLRASLA  198
                +    G+V++  HR  Q LR  LA
Sbjct  211  IGATLGVKLGTVRSRIHRGRQALRDYLA  238


> D7PC27 Putative sigma-24 [Streptomyces luridus]
Length=207

 Score = 45.8 bits (107),  Expect = 2e-09
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 4/63 (6%)

Query  135  DQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYHRAIQGLR  194
            DQ V +    AA+ +LP RQ++A +LR W G      A+ M  S GSVKTH  R I  L 
Sbjct  145  DQRVLV----AALRKLPTRQREALVLRHWLGLKESEIAEAMGISCGSVKTHTARGIAALT  200

Query  195  ASL  197
             ++
Sbjct  201  QAM  203



Lambda      K        H        a         alpha
   0.320    0.131    0.381    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 670149


  Database: 549638f6c93d9b0b4b01c59d68340a18.TrEMBL.fasta
    Posted date:  Sep 21, 2020  6:03 AM
  Number of letters in database: 4,969
  Number of sequences in database:  25



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40