ACIAD2627 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 361638900bfe733cca6428fecccd55f2.SwissProt.fasta
           12 sequences; 2,430 total letters



Query= ACIAD2627

Length=213
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P35165 ECF RNA polymerase sigma factor SigX [Bacillus subtilis ...  53.1    2e-12
  H8F0N6 ECF RNA polymerase sigma factor SigE [Mycobacterium tube...  51.6    1e-11
  P9WGG7 ECF RNA polymerase sigma factor SigE [Mycobacterium tube...  51.6    1e-11
  H8F2P4 ECF RNA polymerase sigma factor SigM [Mycobacterium tube...  49.3    4e-11
  O53590 ECF RNA polymerase sigma factor SigM [Mycobacterium tube...  49.3    4e-11
  A0R2D4 ECF RNA polymerase sigma factor SigE [Mycolicibacterium ...  45.4    1e-09
  O68887 RNA polymerase sigma-E factor [Streptomyces antibioticus]    43.9    3e-09
  A0A0H3CCX2 ECF RNA polymerase sigma factor SigF [Caulobacter vi...  43.5    4e-09
  Q06198 RNA polymerase sigma-H factor [Pseudomonas aeruginosa (s...  43.1    6e-09
  P38133 RNA polymerase sigma-E factor [Streptomyces coelicolor (...  42.0    1e-08
  O07582 ECF RNA polymerase sigma factor SigM [Bacillus subtilis ...  40.8    3e-08
  B3Q6P8 ECF RNA polymerase sigma factor EcfG [Rhodopseudomonas p...  40.8    4e-08


> P35165 ECF RNA polymerase sigma factor SigX [Bacillus subtilis 
(strain 168)]
Length=194

 Score = 53.1 bits (126),  Expect = 2e-12
 Identities = 43/150 (29%), Positives = 73/150 (49%), Gaps = 12/150 (8%)

Query  58   DLVQEAFIALHKSY---ADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLD  114
            DL+QE +I +  SY     +++++ + L  +I  +   DW RK+       +  +++   
Sbjct  32   DLLQEVYIRVLNSYHTFEGRSSEKTWLL--SIARHVAIDWFRKQQ------TIRQRILGT  83

Query  115  SDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQI  174
             D +  DV D+    P E   Q   + EI AA+ Q  + Q+   +LR  +G+  Q TA+ 
Sbjct  84   FDWDTQDVRDQQLL-PDELAVQHENVREIYAALDQCTIDQRAVIILRFIQGYSIQETAKA  142

Query  175  MNCSEGSVKTHYHRAIQGLRASLAHLNPSL  204
            +  SE  VKT  HR ++ LR  +  L   L
Sbjct  143  LRFSESKVKTTQHRGLKVLRKHMELLREEL  172


> H8F0N6 ECF RNA polymerase sigma factor SigE [Mycobacterium tuberculosis 
(strain ATCC 35801 / TMC 107 / Erdman)]
Length=257

 Score = 51.6 bits (122),  Expect = 1e-11
 Identities = 44/162 (27%), Positives = 66/162 (41%), Gaps = 20/162 (12%)

Query  51   GQHGIAMDLVQEAFIALHKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKK  110
            G    A DL QE FI + +S  +     +    + I  N   D  R+ AR          
Sbjct  104  GNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRAR----------  153

Query  111  VSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQT  170
            + +++  E  D V    PNP +    A    ++QAA+A LP   + A +L   EG   + 
Sbjct  154  IRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAAVVLCDIEGLSYEE  213

Query  171  TAQIMNCSEGSVKTHYHRAIQGLRASLA----------HLNP  202
                +    G+V++  HR  Q LR  LA          H+NP
Sbjct  214  IGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECAVHVNP  255


> P9WGG7 ECF RNA polymerase sigma factor SigE [Mycobacterium tuberculosis 
(strain ATCC 25618 / H37Rv)]
Length=257

 Score = 51.6 bits (122),  Expect = 1e-11
 Identities = 44/162 (27%), Positives = 66/162 (41%), Gaps = 20/162 (12%)

Query  51   GQHGIAMDLVQEAFIALHKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKK  110
            G    A DL QE FI + +S  +     +    + I  N   D  R+ AR          
Sbjct  104  GNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRAR----------  153

Query  111  VSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQT  170
            + +++  E  D V    PNP +    A    ++QAA+A LP   + A +L   EG   + 
Sbjct  154  IRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAAVVLCDIEGLSYEE  213

Query  171  TAQIMNCSEGSVKTHYHRAIQGLRASLA----------HLNP  202
                +    G+V++  HR  Q LR  LA          H+NP
Sbjct  214  IGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECAVHVNP  255


> H8F2P4 ECF RNA polymerase sigma factor SigM [Mycobacterium tuberculosis 
(strain ATCC 35801 / TMC 107 / Erdman)]
Length=196

 Score = 49.3 bits (116),  Expect = 4e-11
 Identities = 42/150 (28%), Positives = 66/150 (44%), Gaps = 25/150 (17%)

Query  56   AMDLVQEAFIALHKSYA----DKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKV  111
            A D +Q+A ++ H+       D A   W  L   ++N  L   RR +A  + P       
Sbjct  61   ADDALQDAMLSAHRGAGSFRYDAAVSSW--LHRIVVNACLDRLRRAKAHPTAPL------  112

Query  112  SLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTT  171
                 E+V  V D T         Q  T   +Q A+ +LPV Q+ A +    +G+    T
Sbjct  113  -----EDVYPVADRTA--------QVETAIAVQRALMRLPVEQRAAVVAVDMQGYSIADT  159

Query  172  AQIMNCSEGSVKTHYHRAIQGLRASLAHLN  201
            A+++  +EG+VK+   RA   L   L +LN
Sbjct  160  ARMLGVAEGTVKSRCARARARLARLLGYLN  189


> O53590 ECF RNA polymerase sigma factor SigM [Mycobacterium tuberculosis 
(strain ATCC 25618 / H37Rv)]
Length=196

 Score = 49.3 bits (116),  Expect = 4e-11
 Identities = 42/150 (28%), Positives = 66/150 (44%), Gaps = 25/150 (17%)

Query  56   AMDLVQEAFIALHKSYA----DKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKV  111
            A D +Q+A ++ H+       D A   W  L   ++N  L   RR +A  + P       
Sbjct  61   ADDALQDAMLSAHRGAGSFRYDAAVSSW--LHRIVVNACLDRLRRAKAHPTAPL------  112

Query  112  SLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTT  171
                 E+V  V D T         Q  T   +Q A+ +LPV Q+ A +    +G+    T
Sbjct  113  -----EDVYPVADRTA--------QVETAIAVQRALMRLPVEQRAAVVAVDMQGYSIADT  159

Query  172  AQIMNCSEGSVKTHYHRAIQGLRASLAHLN  201
            A+++  +EG+VK+   RA   L   L +LN
Sbjct  160  ARMLGVAEGTVKSRCARARARLARLLGYLN  189


> A0R2D4 ECF RNA polymerase sigma factor SigE [Mycolicibacterium 
smegmatis (strain ATCC 700084 / mc(2)155)]
Length=257

 Score = 45.4 bits (106),  Expect = 1e-09
 Identities = 38/148 (26%), Positives = 60/148 (41%), Gaps = 10/148 (7%)

Query  51   GQHGIAMDLVQEAFIALHKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKK  110
            G    A DL QE FI + +S  +     +    + I  N   D  R+  R          
Sbjct  110  GNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRGR----------  159

Query  111  VSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQT  170
            + +++  E  D V    PNP +    +    ++QAA+  LP   + A +L   EG   + 
Sbjct  160  IRMEALPEDYDRVPAEDPNPEQIYHDSRLGADLQAALDSLPPEFRAAVVLCDIEGLSYEE  219

Query  171  TAQIMNCSEGSVKTHYHRAIQGLRASLA  198
                +    G+V++  HR  Q LR  LA
Sbjct  220  IGATLGVKLGTVRSRIHRGRQQLRDYLA  247


> O68887 RNA polymerase sigma-E factor [Streptomyces antibioticus]
Length=180

 Score = 43.9 bits (102),  Expect = 3e-09
 Identities = 40/146 (27%), Positives = 69/146 (47%), Gaps = 24/146 (16%)

Query  56   AMDLVQEAFIALH---KSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVS  112
            A DL+Q A    +   +  ADK   + Y L   ++N + + WR +            K+ 
Sbjct  34   AQDLLQTALARTYGRWEGIADKRLADAY-LRRVMINTRTEWWRAR------------KLE  80

Query  113  LDSDEEVTDV-VDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTT  171
                E++ D  V+++T    +  D+A+ ++    A+  L  +Q+   +LR WE   T+ T
Sbjct  81   EVPTEQLPDARVEDSTE---QHADRALLMD----AMKVLAPKQRSVVVLRHWEQMSTEET  133

Query  172  AQIMNCSEGSVKTHYHRAIQGLRASL  197
            A  +  S G+VK+  HRA+  LR  L
Sbjct  134  AAALGMSAGTVKSTLHRALARLREEL  159


> A0A0H3CCX2 ECF RNA polymerase sigma factor SigF [Caulobacter 
vibrioides (strain NA1000 / CB15N)]
Length=179

 Score = 43.5 bits (101),  Expect = 4e-09
 Identities = 39/145 (27%), Positives = 59/145 (41%), Gaps = 20/145 (14%)

Query  51   GQHGIAMDLVQEAFIALH-KSYADKATDEWYPLFYTILNNKLQD-WRRKEARRSNPFSFF  108
            G  G   DLVQE  +A+H K     +   +    + +   KL D WRR++ R++ P    
Sbjct  44   GAPGDVEDLVQETLLAVHLKRSTWDSAQSFTAWAHAVARYKLIDHWRRRKIRQTLPL---  100

Query  109  KKVSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDT  168
                    E+  D + +  P+P   L       E+  A+A LP RQ+         G   
Sbjct  101  --------EDHVDFLADDAPDPGVAL-------ELDRALASLPQRQRMLVSDVKLTGLSL  145

Query  169  QTTAQIMNCSEGSVKTHYHRAIQGL  193
                     SEG+ K   HRA++ L
Sbjct  146  AEAGARAGISEGAAKVALHRALKAL  170


> Q06198 RNA polymerase sigma-H factor [Pseudomonas aeruginosa 
(strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 
12228 / 1C / PRS 101 / PAO1)]
Length=193

 Score = 43.1 bits (100),  Expect = 6e-09
 Identities = 41/153 (27%), Positives = 65/153 (42%), Gaps = 18/153 (12%)

Query  56   AMDLVQEAFIALHKSYADKATDE-WYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLD  114
            A D+ QEAFI  +++  +   D  +Y   Y I  N  ++      RR            D
Sbjct  47   AQDVAQEAFIKAYRALGNFRGDSAFYTWLYRIAINTAKNHLVARGRRPP----------D  96

Query  115  SDEEVTDVV---DETTPNPFEFLDQAVTIEEIQAA----IAQLPVRQQQAFMLRAWEGFD  167
            SD    D      +      E  ++A+  +EI+A     I QLP   + A  LR +EG  
Sbjct  97   SDVTAEDAEFFEGDHALKDIESPERAMLRDEIEATVHQTIQQLPEDLRTALTLREFEGLS  156

Query  168  TQTTAQIMNCSEGSVKTHYHRAIQGLRASLAHL  200
             +  A +M C  G+V++   RA + +  +L  L
Sbjct  157  YEDIATVMQCPVGTVRSRIFRAREAIDKALQPL  189


> P38133 RNA polymerase sigma-E factor [Streptomyces coelicolor 
(strain ATCC BAA-471 / A3(2) / M145)]
Length=177

 Score = 42.0 bits (97),  Expect = 1e-08
 Identities = 36/145 (25%), Positives = 67/145 (46%), Gaps = 22/145 (15%)

Query  56   AMDLVQEAFIALH---KSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVS  112
            A DL+Q A    +   ++  DK   + Y L   ++N + + WR +           K   
Sbjct  32   AQDLLQTALARTYGRWETIEDKRLADAY-LRRVMINTRTEWWRAR-----------KLEE  79

Query  113  LDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTA  172
            + +++     +D+ T    +  D+A+ ++ ++     L  +Q+   +LR WE   T+ TA
Sbjct  80   VPTEQLPESPMDDATE---QHADRALLMDVLKV----LAPKQRSVVVLRHWEQMSTEETA  132

Query  173  QIMNCSEGSVKTHYHRAIQGLRASL  197
              +  S G+VK+  HRA+  LR  L
Sbjct  133  AALGMSAGTVKSTLHRALARLREEL  157


> O07582 ECF RNA polymerase sigma factor SigM [Bacillus subtilis 
(strain 168)]
Length=163

 Score = 40.8 bits (94),  Expect = 3e-08
 Identities = 41/171 (24%), Positives = 73/171 (43%), Gaps = 18/171 (11%)

Query  25   TVEQRLKFFMQDVTGRALVMMESATQGQHGIAMDLVQEAFIALHKSYADKATDEWYPLFY  84
            T+++  + +M DV    L M    T+ +H +A DL+QE F+  +         +  P  +
Sbjct  2    TIDEIYQMYMNDVYRFLLSM----TKDKH-LAEDLLQETFMRAYIHIHSYDHSKVKPWLF  56

Query  85   TILNNKLQDWRRKEARRSNPFSFFKKVSLDSDEEVTDVVDETTPNPFEFLDQAVTIEEIQ  144
             +  N   D+ RK           KK    SD+ +  +      +P     Q    E + 
Sbjct  57   QVARNAFIDYVRKH----------KKEVTISDDLIGSLFQNAVQSPAH---QVEIKEVLT  103

Query  145  AAIAQLPVRQQQAFMLRAWEGFDTQTTAQIMNCSEGSVKTHYHRAIQGLRA  195
              +++LP   ++A  L   +  + +  + IMN SE + K+   RA Q L+A
Sbjct  104  GYMSELPDNYREALTLYYLKELNYKEASHIMNISEANFKSVLFRARQRLKA  154


> B3Q6P8 ECF RNA polymerase sigma factor EcfG [Rhodopseudomonas 
palustris (strain TIE-1)]
Length=181

 Score = 40.8 bits (94),  Expect = 4e-08
 Identities = 40/143 (28%), Positives = 62/143 (43%), Gaps = 16/143 (11%)

Query  56   AMDLVQEAFI-ALHKSYADKATDEWYPLFYTILNNKLQDWRRKEARRSNPFSFFKKVSLD  114
            A DLVQE  + AL    + +         +TIL N  +   RK  R             D
Sbjct  32   ADDLVQETLLRALANIDSFQPGSNLPAWLFTILRNLFRSDYRKRRREVE----------D  81

Query  115  SDEEVTDVVDETTPNPFEFLDQAVTIEEIQAAIAQLPVRQQQAFMLRAWEGFDTQTTAQI  174
            +D      + ++ P     L+     EE +AA+ +LP  Q++A +L    GF  +  A I
Sbjct  82   ADGSYAKTL-KSQPGQTAHLE----FEEFRAALDKLPQDQREALILVGASGFSYEDAAAI  136

Query  175  MNCSEGSVKTHYHRAIQGLRASL  197
              C+ G++K+  +RA   L A L
Sbjct  137  CGCAVGTIKSRVNRARSKLSALL  159



Lambda      K        H        a         alpha
   0.320    0.131    0.381    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 345450


  Database: 361638900bfe733cca6428fecccd55f2.SwissProt.fasta
    Posted date:  Sep 21, 2020  4:56 AM
  Number of letters in database: 2,430
  Number of sequences in database:  12



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40