ACIAD2590 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: e486d0ade05dd329a42e04ee901d4097.TrEMBL.fasta
           27 sequences; 7,468 total letters



Query= ACIAD2590

Length=272
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F9B3 4-amino-4-deoxychorismate lyase [Acinetobacter baylyi (s...   554    0.0   
  A0A1P8EF00 Aminodeoxychorismate lyase [Acinetobacter soli]           358    2e-127
  N9BSK6 Aminodeoxychorismate lyase [Acinetobacter soli NIPH 2899]     357    6e-127
  A0A0M1I1W6 4-amino-4-deoxychorismate lyase [Acinetobacter sp. C15]   357    6e-127
  N8Y1K4 Aminodeoxychorismate lyase [Acinetobacter schindleri NIP...   342    9e-121
  A0A1J4NID2 Aminodeoxychorismate lyase [Acinetobacter sp. LCT-H3]     342    9e-121
  I4ZP66 4-amino-4-deoxychorismate lyase [Acinetobacter sp. HA]        342    9e-121
  A0A2S1FAJ8 Aminodeoxychorismate lyase [Acinetobacter schindleri]     342    9e-121
  D0S1F3 Aminodeoxychorismate lyase [Acinetobacter calcoaceticus ...   341    1e-120
  A0A013THN1 Aminodeoxychorismate lyase [Acinetobacter sp. 742879]     341    2e-120
  N9NDP4 Aminodeoxychorismate lyase [Acinetobacter sp. CIP 101934]     341    2e-120
  A0A1E2YQR2 Aminodeoxychorismate lyase [Acinetobacter pittii]         341    2e-120
  A0A242SUW4 Aminodeoxychorismate lyase [Acinetobacter pittii]         340    4e-120
  K8ZSN2 Aminodeoxychorismate lyase [Acinetobacter sp. WC-141]         340    4e-120
  N9ALH9 Aminodeoxychorismate lyase [Acinetobacter schindleri CIP...   340    4e-120
  A0A013RTN4 Aminodeoxychorismate lyase [Acinetobacter baumannii ...   340    4e-120
  A0A242U353 Aminodeoxychorismate lyase [Acinetobacter pittii]         340    4e-120
  Q9HZN6 4-amino-4-deoxychorismate lyase [Pseudomonas aeruginosa ...   153    2e-47 
  A0A2I6J4A3 Aminodeoxychorismate lyase [Lysobacter antibioticus]     88.2    1e-23 
  Q84CY7 D-alanine aminotransferase [Bacillus cereus]                 81.3    3e-21 
  Q81JD6 Branched-chain-amino-acid aminotransferase [Bacillus ant...  79.3    2e-20 
  Q84CY6 Branched-chain-amino-acid aminotransferase [Bacillus cer...  74.7    8e-19 
  Q84CY8 Branched-chain-amino-acid aminotransferase [Bacillus cer...  69.7    5e-17 
  Q84CY5 D-alanine aminotransferase [Bacillus cereus]                 69.3    7e-17 
  D3GDJ2 Probable branched-chain-amino-acid aminotransferase [Rhi...  62.4    2e-14 
  B8Y8J0 ADC lyase [Streptomyces sp. FR-008]                          62.0    2e-14 
  Q937U0 Probable branched-chain-amino-acid aminotransferase [Bru...  60.8    6e-14 


> Q6F9B3 4-amino-4-deoxychorismate lyase [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=271

 Score =  554 bits (1427),  Expect = 0.0
 Identities = 271/271 (100%), Positives = 271/271 (100%), Gaps = 0/271 (0%)

Query  1    MMWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVN  60
            MMWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVN
Sbjct  1    MMWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVN  60

Query  61   LNWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAY  120
            LNWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAY
Sbjct  61   LNWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAY  120

Query  121  LKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNC  180
            LKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNC
Sbjct  121  LKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNC  180

Query  181  FIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALH  240
            FIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALH
Sbjct  181  FIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALH  240

Query  241  PMNIVTHLQSQTLQTNICTQLYHILNLNQID  271
            PMNIVTHLQSQTLQTNICTQLYHILNLNQID
Sbjct  241  PMNIVTHLQSQTLQTNICTQLYHILNLNQID  271


> A0A1P8EF00 Aminodeoxychorismate lyase [Acinetobacter soli]
Length=270

 Score =  358 bits (920),  Expect = 2e-127
 Identities = 166/270 (61%), Positives = 212/270 (79%), Gaps = 0/270 (0%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            MWCFKNAQPV  V++QDRA QYGDGCF+TARI  G+IQL++RH  RL   C+QL L+V+L
Sbjct  1    MWCFKNAQPVAAVALQDRAFQYGDGCFSTARIVKGQIQLVNRHYERLNYACQQLGLNVDL  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
              I+ SL+Q+     VLTGT+K+LISRGEG RGY++P H ADLY++FYPQ+++   P Y+
Sbjct  61   KLIEQSLKQLTHQEIVLTGTLKLLISRGEGPRGYSVPDHNADLYVFFYPQAYSDTAPQYV  120

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            + G+L  ++GL MP + G+KTLNRLEQV+LK++ADQ GW+EAL  D+N  +VEGVSSNCF
Sbjct  121  EVGLLPRRIGLTMPDMVGIKTLNRLEQVLLKQQADQYGWAEALVADLNGNIVEGVSSNCF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
            IYLNN WITPELRYNGVRG+MR EI+DR QQ GI+ ++R + L EL QVQ+LFFCN LHP
Sbjct  181  IYLNNAWITPELRYNGVRGLMRTEILDRAQQAGIDILERQIHLDELDQVQALFFCNTLHP  240

Query  242  MNIVTHLQSQTLQTNICTQLYHILNLNQID  271
            M I + + S++L T  C  L+H L LNQID
Sbjct  241  MTIASRMHSRSLSTEACLTLFHTLKLNQID  270


> N9BSK6 Aminodeoxychorismate lyase [Acinetobacter soli NIPH 2899]
Length=270

 Score =  357 bits (917),  Expect = 6e-127
 Identities = 165/270 (61%), Positives = 211/270 (78%), Gaps = 0/270 (0%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            MWCFKNAQPV  V++QDRA QYGDGCF+TARI  G+IQL++RH  RL   C+QL L+V+L
Sbjct  1    MWCFKNAQPVASVALQDRAFQYGDGCFSTARIVKGQIQLVNRHYERLNYACQQLGLNVDL  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
              I+ SL+Q+      LTGT+K+LISRGEG RGY++P H ADLY++FYPQ+++   P Y+
Sbjct  61   KLIEQSLKQLTYQEIALTGTLKLLISRGEGPRGYSVPDHNADLYVFFYPQTYSDTAPQYV  120

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            + G+L  ++GL MP + G+KTLNRLEQV+LK++ADQ GW+EAL  D+N  +VEGVSSNCF
Sbjct  121  EVGLLPRRIGLTMPDMVGIKTLNRLEQVLLKQQADQYGWAEALVADLNGNIVEGVSSNCF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
            IYLNN WITPELRYNGVRG+MR EI+DR QQ GI+ ++R + L EL QVQ+LFFCN LHP
Sbjct  181  IYLNNAWITPELRYNGVRGLMRTEILDRAQQAGIDILERQIHLDELDQVQALFFCNTLHP  240

Query  242  MNIVTHLQSQTLQTNICTQLYHILNLNQID  271
            M I + + S++L T  C  L+H L LNQID
Sbjct  241  MTIASRMHSRSLSTEACLTLFHTLKLNQID  270


> A0A0M1I1W6 4-amino-4-deoxychorismate lyase [Acinetobacter sp. 
C15]
Length=270

 Score =  357 bits (917),  Expect = 6e-127
 Identities = 165/270 (61%), Positives = 211/270 (78%), Gaps = 0/270 (0%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            MWCFKNAQPV  V++QDRA QYGDGCF+TARI  G+IQL++RH  RL   C+QL L+V+L
Sbjct  1    MWCFKNAQPVASVALQDRAFQYGDGCFSTARIVKGQIQLVNRHYERLNYACQQLGLNVDL  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
              I+ SL+Q+      LTGT+K+LISRGEG RGY++P H ADLY++FYPQ+++   P Y+
Sbjct  61   KLIEQSLKQLTYQEIALTGTLKLLISRGEGPRGYSVPDHNADLYVFFYPQTYSDTAPQYV  120

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            + G+L  ++GL MP + G+KTLNRLEQV+LK++ADQ GW+EAL  D+N  +VEGVSSNCF
Sbjct  121  EVGLLPRRIGLTMPDMVGIKTLNRLEQVLLKQQADQYGWAEALVADLNGNIVEGVSSNCF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
            IYLNN WITPELRYNGVRG+MR EI+DR QQ GI+ ++R + L EL QVQ+LFFCN LHP
Sbjct  181  IYLNNAWITPELRYNGVRGLMRTEILDRAQQAGIDILERQIHLDELDQVQALFFCNTLHP  240

Query  242  MNIVTHLQSQTLQTNICTQLYHILNLNQID  271
            M I + + S++L T  C  L+H L LNQID
Sbjct  241  MTIASRMHSRSLSTEACLTLFHTLKLNQID  270


> N8Y1K4 Aminodeoxychorismate lyase [Acinetobacter schindleri NIPH 
900]
Length=270

 Score =  342 bits (876),  Expect = 9e-121
 Identities = 164/272 (60%), Positives = 209/272 (77%), Gaps = 6/272 (2%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            M CFKNAQ V ++ + DRA  YGDGCFTTARI + +I+L  RHL+RL    +++ L  +L
Sbjct  1    MLCFKNAQQVNQIDLLDRAFHYGDGCFTTARIRNNRIELQERHLSRLHISSQKMQLQADL  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQ---SHAIDQP  118
            N ID +LEQ++ L   L GT+KI++SRG GQRGY++P H AD+++Y+YPQ    H  +Q 
Sbjct  61   NLIDATLEQLRELTSSLNGTLKIILSRGIGQRGYSLPDHPADVWLYYYPQMLHEHHFEQ-  119

Query  119  AYLKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSS  178
              ++SGVL T LGLCMP+L GLKTLNRLEQV+LK+EADQQGWSEAL  D+  E+VEGVSS
Sbjct  120  --IESGVLNTALGLCMPQLVGLKTLNRLEQVMLKQEADQQGWSEALVCDVQGEIVEGVSS  177

Query  179  NCFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNA  238
            NCF+ +NNTWITPELRYNGV GVMRAEI++RM Q GI C QR + L E+S +QSLFFCNA
Sbjct  178  NCFLRINNTWITPELRYNGVTGVMRAEILERMLQQGIICEQRSLDLNEISSIQSLFFCNA  237

Query  239  LHPMNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            L PM IVT  + +TL T +C +L+H L+L+QI
Sbjct  238  LSPMKIVTQFEQKTLDTEVCIELFHRLHLHQI  269


> A0A1J4NID2 Aminodeoxychorismate lyase [Acinetobacter sp. LCT-H3]
Length=270

 Score =  342 bits (876),  Expect = 9e-121
 Identities = 164/272 (60%), Positives = 209/272 (77%), Gaps = 6/272 (2%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            M CFKNAQ V ++ + DRA  YGDGCFTTARI + +I+L  RHL+RL    +++ L  +L
Sbjct  1    MLCFKNAQQVNQIDLLDRAFHYGDGCFTTARIRNNRIELQERHLSRLHISSQKMQLQADL  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQ---SHAIDQP  118
            N ID +LEQ++ L   L GT+KI++SRG GQRGY++P H AD+++Y+YPQ    H  +Q 
Sbjct  61   NLIDATLEQLRELTSSLNGTLKIILSRGIGQRGYSLPDHPADVWLYYYPQMLHEHHFEQ-  119

Query  119  AYLKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSS  178
              ++SGVL T LGLCMP+L GLKTLNRLEQV+LK+EADQQGWSEAL  D+  E+VEGVSS
Sbjct  120  --IESGVLNTALGLCMPQLVGLKTLNRLEQVMLKQEADQQGWSEALVCDVQGEIVEGVSS  177

Query  179  NCFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNA  238
            NCF+ +NNTWITPELRYNGV GVMRAEI++RM Q GI C QR + L E+S +QSLFFCNA
Sbjct  178  NCFLRINNTWITPELRYNGVTGVMRAEILERMLQQGIICEQRSLDLNEISSIQSLFFCNA  237

Query  239  LHPMNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            L PM IVT  + +TL T +C +L+H L+L+QI
Sbjct  238  LSPMKIVTQFEQKTLDTEVCIELFHRLHLHQI  269


> I4ZP66 4-amino-4-deoxychorismate lyase [Acinetobacter sp. HA]
Length=270

 Score =  342 bits (876),  Expect = 9e-121
 Identities = 164/272 (60%), Positives = 209/272 (77%), Gaps = 6/272 (2%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            M CFKNAQ V ++ + DRA  YGDGCFTTARI + +I+L  RHL+RL    +++ L  +L
Sbjct  1    MLCFKNAQQVNQIDLLDRAFHYGDGCFTTARIRNNRIELQERHLSRLHISSQKMQLQADL  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQ---SHAIDQP  118
            N ID +LEQ++ L   L GT+KI++SRG GQRGY++P H AD+++Y+YPQ    H  +Q 
Sbjct  61   NLIDATLEQLRELTSSLNGTLKIILSRGIGQRGYSLPDHPADVWLYYYPQMLHEHHFEQ-  119

Query  119  AYLKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSS  178
              ++SGVL T LGLCMP+L GLKTLNRLEQV+LK+EADQQGWSEAL  D+  E+VEGVSS
Sbjct  120  --IESGVLNTALGLCMPQLVGLKTLNRLEQVMLKQEADQQGWSEALVCDVQGEIVEGVSS  177

Query  179  NCFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNA  238
            NCF+ +NNTWITPELRYNGV GVMRAEI++RM Q GI C QR + L E+S +QSLFFCNA
Sbjct  178  NCFLRINNTWITPELRYNGVTGVMRAEILERMLQQGIICEQRSLDLNEISSIQSLFFCNA  237

Query  239  LHPMNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            L PM IVT  + +TL T +C +L+H L+L+QI
Sbjct  238  LSPMKIVTQFEQKTLDTEVCIELFHRLHLHQI  269


> A0A2S1FAJ8 Aminodeoxychorismate lyase [Acinetobacter schindleri]
Length=270

 Score =  342 bits (876),  Expect = 9e-121
 Identities = 164/272 (60%), Positives = 209/272 (77%), Gaps = 6/272 (2%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            M CFKNAQ V ++ + DRA  YGDGCFTTARI + +I+L  RHL+RL    +++ L  +L
Sbjct  1    MLCFKNAQQVNQIDLLDRAFHYGDGCFTTARIRNNRIELQERHLSRLHISSQKMQLQADL  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQ---SHAIDQP  118
            N ID +LEQ++ L   L GT+KI++SRG GQRGY++P H AD+++Y+YPQ    H  +Q 
Sbjct  61   NLIDATLEQLRELTSSLNGTLKIILSRGIGQRGYSLPDHPADVWLYYYPQMLHEHHFEQ-  119

Query  119  AYLKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSS  178
              ++SGVL T LGLCMP+L GLKTLNRLEQV+LK+EADQQGWSEAL  D+  E+VEGVSS
Sbjct  120  --IESGVLNTALGLCMPQLVGLKTLNRLEQVMLKQEADQQGWSEALVCDVQGEIVEGVSS  177

Query  179  NCFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNA  238
            NCF+ +NNTWITPELRYNGV GVMRAEI++RM Q GI C QR + L E+S +QSLFFCNA
Sbjct  178  NCFLRINNTWITPELRYNGVTGVMRAEILERMLQQGIICEQRSLDLNEISSIQSLFFCNA  237

Query  239  LHPMNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            L PM IVT  + +TL T +C +L+H L+L+QI
Sbjct  238  LSPMKIVTQFEQKTLDTEVCIELFHRLHLHQI  269


> D0S1F3 Aminodeoxychorismate lyase [Acinetobacter calcoaceticus 
RUH2202]
Length=270

 Score =  341 bits (875),  Expect = 1e-120
 Identities = 161/269 (60%), Positives = 203/269 (75%), Gaps = 0/269 (0%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            MWCFKN QPV+ + + DRA  YGDGCFTT R+   +I+L  RH  RLK  C++L L+ + 
Sbjct  1    MWCFKNGQPVETIPLLDRAFHYGDGCFTTIRVFQNQIELKERHWERLKLACQKLSLTADF  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
              I+ SL+Q++    VL GT+KI+ISRGEG RGY++P H AD+YI+FYP++    QP ++
Sbjct  61   ELIEQSLQQLQKQHLVLNGTLKIVISRGEGDRGYSLPKHQADIYIWFYPKALEPFQPDFI  120

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            + GVL   LGL MP L GLK+LNRLEQV+LKKEADQ GW+EAL  D+   +VEGVSSNCF
Sbjct  121  QCGVLNQALGLTMPSLVGLKSLNRLEQVLLKKEADQLGWAEALVTDVQGYIVEGVSSNCF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
            I LN+ WITPELRYNGV GVMRAEI+ RMQ  GI C  R ++L E+S++QSLFFCNALHP
Sbjct  181  IRLNDRWITPELRYNGVHGVMRAEILARMQHHGIACEVRIIELDEVSEIQSLFFCNALHP  240

Query  242  MNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            M +VTHL  +TL+T  C  L+H+LNLNQI
Sbjct  241  MRVVTHLGEKTLETQACIDLFHLLNLNQI  269


> A0A013THN1 Aminodeoxychorismate lyase [Acinetobacter sp. 742879]
Length=270

 Score =  341 bits (874),  Expect = 2e-120
 Identities = 162/269 (60%), Positives = 202/269 (75%), Gaps = 0/269 (0%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            MWCFKN QPV+ + + DRA  YGDGCFTT R+   +I+L  RH  RLK  C++L L+VN 
Sbjct  1    MWCFKNGQPVETIPLLDRAFHYGDGCFTTIRVFQNQIELKERHWQRLKLACQKLSLTVNF  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
              I+ S++Q++    VL GT+KI+ISRGEG RGYT+P H AD+YI+FYP++     P ++
Sbjct  61   ELIELSVQQLQKQNLVLNGTLKIVISRGEGDRGYTLPKHEADIYIWFYPKALEPCMPDFI  120

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            + GVL   LGL MP L GLK+LNRLEQV+LKKEADQ GW+EAL  D+   +VEGVSSNCF
Sbjct  121  QCGVLNQALGLTMPSLVGLKSLNRLEQVLLKKEADQLGWAEALVTDVQGYIVEGVSSNCF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
            I LN+ WITPELRYNGV GVMRAEI+ RMQ  GI C  R ++L E+S++QSLFFCNAL+P
Sbjct  181  IRLNDRWITPELRYNGVHGVMRAEILARMQHHGIACEVRVIELDEVSEIQSLFFCNALNP  240

Query  242  MNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            M +VTHL  +TL T  C  L+HILNLNQI
Sbjct  241  MRVVTHLGEKTLDTQACIDLFHILNLNQI  269


> N9NDP4 Aminodeoxychorismate lyase [Acinetobacter sp. CIP 101934]
Length=270

 Score =  341 bits (874),  Expect = 2e-120
 Identities = 162/269 (60%), Positives = 206/269 (77%), Gaps = 0/269 (0%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            M CFKNAQ V ++ + DRA  YGDGCFTTARI + +I+L  RHL+RL    +++ L  +L
Sbjct  1    MLCFKNAQQVNQIDLLDRAFHYGDGCFTTARIRNNRIELQERHLSRLHISSQKMQLQADL  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
            + ID +LEQ++ L   L GT+KI++SRG GQRGY++P H AD+++Y+YPQ         +
Sbjct  61   SLIDATLEQLRELTSNLNGTLKIILSRGIGQRGYSLPDHPADVWLYYYPQMLPEHHFEQI  120

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            +SGVL T LGLCMP+L GLKTLNRLEQVILK+EADQQGWSEAL  D+  E+VEGVSSNCF
Sbjct  121  ESGVLNTALGLCMPQLVGLKTLNRLEQVILKQEADQQGWSEALVCDVQGEIVEGVSSNCF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
            + +NNTWITPELRYNGV GVMRAEI++RM Q GI C QR + L E+S +QSLFFCNAL P
Sbjct  181  LRINNTWITPELRYNGVTGVMRAEILERMLQQGIMCEQRSLDLNEISSIQSLFFCNALSP  240

Query  242  MNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            M IVT  + +TL T +C +L+H L+L+QI
Sbjct  241  MKIVTQFEQKTLDTEVCIELFHRLHLHQI  269


> A0A1E2YQR2 Aminodeoxychorismate lyase [Acinetobacter pittii]
Length=270

 Score =  341 bits (874),  Expect = 2e-120
 Identities = 163/269 (61%), Positives = 201/269 (75%), Gaps = 0/269 (0%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            MWCFKN QPV+ + + DRA  YGDGCFTT RI   +I+L  RH  RLK  C++L L+ N 
Sbjct  1    MWCFKNGQPVETIPLLDRAFHYGDGCFTTIRIFQNQIELKERHWQRLKLACQKLFLTANF  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
              I+ SL+Q++    VL GT+KI+ISRGEG RGYT+P H AD+YI+FYP++     P ++
Sbjct  61   ELIEQSLQQLQNQNLVLNGTLKIVISRGEGDRGYTLPKHEADIYIWFYPKALEPCMPDFI  120

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            + GVL   LGL MP L GLK+LNRLEQV+LKKEADQ GW+EAL  D+   +VEGVSSNCF
Sbjct  121  QCGVLNQALGLTMPSLVGLKSLNRLEQVLLKKEADQLGWAEALVTDVQGYIVEGVSSNCF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
            I LN+ WITPELRYNGV GVMRAEI+ RMQ  GI C  R ++L E+S++QSLFFCNAL+P
Sbjct  181  IRLNDRWITPELRYNGVHGVMRAEILARMQHHGIACEVRVIELDEVSEIQSLFFCNALNP  240

Query  242  MNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            M +VTHL  +TL T  C  L+HILNLNQI
Sbjct  241  MRVVTHLGEKTLDTQACIDLFHILNLNQI  269


> A0A242SUW4 Aminodeoxychorismate lyase [Acinetobacter pittii]
Length=270

 Score =  340 bits (872),  Expect = 4e-120
 Identities = 161/269 (60%), Positives = 202/269 (75%), Gaps = 0/269 (0%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            MWCFKN QPV+ + + DRA  YGDGCFTT R+   +I+L  RH  RLK  C++L L+VN 
Sbjct  1    MWCFKNGQPVETIPLLDRAFHYGDGCFTTIRVFQNQIELKERHWQRLKLACQKLSLTVNF  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
              I+ SL+Q++    VL GT+KI+ISRGEG RGY++P H AD+YI+FYP++     P ++
Sbjct  61   ELIELSLQQLQKQNLVLNGTLKIVISRGEGDRGYSLPKHEADIYIWFYPKALEPFMPDFI  120

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            + GVL   LGL MP L GLK+LNRLEQV+LKKEADQ GW+EAL  D+   +VEG+SSNCF
Sbjct  121  QCGVLNQALGLTMPSLVGLKSLNRLEQVLLKKEADQLGWAEALVTDVQGYIVEGISSNCF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
            I LN+ WITPELRYNGV GVMRAEI+ RMQ  GI C  R ++L E+S++QSLFFCNAL+P
Sbjct  181  IRLNDRWITPELRYNGVHGVMRAEILARMQHHGIACEVRVIELDEVSEIQSLFFCNALNP  240

Query  242  MNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            M +VTHL  +TL T  C  L+HILNLNQI
Sbjct  241  MRVVTHLGEKTLDTQACIDLFHILNLNQI  269


> K8ZSN2 Aminodeoxychorismate lyase [Acinetobacter sp. WC-141]
Length=270

 Score =  340 bits (872),  Expect = 4e-120
 Identities = 161/269 (60%), Positives = 203/269 (75%), Gaps = 0/269 (0%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            MWCFKN QPV+ + + DRA  YGDGCFTT R+ + KI+L  RH  RLK  C++L L+ + 
Sbjct  1    MWCFKNGQPVETIPLLDRAFHYGDGCFTTIRVFENKIELQERHWERLKLACQKLSLTADF  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
              I+ SL+Q++    VL GT+KI+ISRG G RGY++P H AD+YI+FYP++    QP ++
Sbjct  61   ELIEQSLQQLQKQNLVLNGTLKIVISRGIGDRGYSLPKHDADIYIWFYPKALEQFQPDFI  120

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            + GVL   LGL MP L GLK+LNRLEQV+LKKEADQ GW+EAL  D+   +VEGVSSNCF
Sbjct  121  QCGVLNQALGLTMPSLVGLKSLNRLEQVVLKKEADQLGWAEALVTDVQGYIVEGVSSNCF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
            I LN+ WITPELRYNGV GVMRAEI+ RMQ  GI C  R ++L E+S++QSLFFCNAL+P
Sbjct  181  IRLNDRWITPELRYNGVHGVMRAEILARMQHHGIACEVRVIELDEVSEIQSLFFCNALNP  240

Query  242  MNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            M +VTHL  +TL+T  C  L+HILNLNQI
Sbjct  241  MRVVTHLGEKTLETQACIDLFHILNLNQI  269


> N9ALH9 Aminodeoxychorismate lyase [Acinetobacter schindleri CIP 
107287]
Length=270

 Score =  340 bits (872),  Expect = 4e-120
 Identities = 163/272 (60%), Positives = 208/272 (76%), Gaps = 6/272 (2%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            M CFKNAQ V ++ + DRA  YGDGCFTTARI + +I+L  RHL+RL    +++ L  +L
Sbjct  1    MLCFKNAQQVNQIDLLDRAFHYGDGCFTTARIRNNRIELQERHLSRLHISSQKMQLQADL  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQ---SHAIDQP  118
            N ID +LEQ++ L   L GT+KI++SRG GQRGY++P H AD+++Y+YPQ    H  +Q 
Sbjct  61   NLIDATLEQLRDLTSSLNGTLKIILSRGIGQRGYSLPDHPADVWLYYYPQMLHEHHFEQ-  119

Query  119  AYLKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSS  178
              ++SGVL T LGLCMP+L GLKTLNRLEQV+LK+EADQQGW EAL  D+  E+VEGVSS
Sbjct  120  --IESGVLNTALGLCMPQLVGLKTLNRLEQVMLKQEADQQGWGEALVCDVQGEIVEGVSS  177

Query  179  NCFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNA  238
            NCF+ +NNTWITPELRYNGV GVMRAEI++RM Q GI C QR + L E+S +QSLFFCNA
Sbjct  178  NCFLRINNTWITPELRYNGVTGVMRAEILERMLQQGIICEQRSLDLNEISSIQSLFFCNA  237

Query  239  LHPMNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            L PM IVT  + +TL T +C +L+H L+L+QI
Sbjct  238  LSPMKIVTQFEQKTLDTEVCIELFHRLHLHQI  269


> A0A013RTN4 Aminodeoxychorismate lyase [Acinetobacter baumannii 
573719]
Length=270

 Score =  340 bits (872),  Expect = 4e-120
 Identities = 163/269 (61%), Positives = 202/269 (75%), Gaps = 0/269 (0%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            MWCFKN QPV+ + + DRA  YGDGCFTT R+   +I+L  RHL RLK  C++L L+VN 
Sbjct  1    MWCFKNGQPVETIPLLDRAFHYGDGCFTTIRVFQNQIELKERHLQRLKLACQKLSLTVNF  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
              I+ SL+Q++    VL GT+KI+ISRGEG RGY++P H AD+YI+FYP++     P  +
Sbjct  61   ELIELSLQQLQKQNLVLNGTLKIVISRGEGDRGYSLPKHEADIYIWFYPKAIEPFVPDSI  120

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            + GVL   LGL MP L GLK+LNRLEQV+LKKEADQ GW+EAL  D+   +VEGVSSNCF
Sbjct  121  QCGVLNQALGLTMPSLVGLKSLNRLEQVLLKKEADQLGWAEALVTDVQGYIVEGVSSNCF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
            I LN+ WITPELRYNGV GVMRAEI+ RMQ  GI C  R ++L E+S++QSLFFCNAL+P
Sbjct  181  IRLNDRWITPELRYNGVHGVMRAEILARMQHHGIACEVRVIELDEVSEIQSLFFCNALNP  240

Query  242  MNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            M +VTHL  +TL T  C  L+HILNLNQI
Sbjct  241  MRVVTHLGEKTLDTQACIDLFHILNLNQI  269


> A0A242U353 Aminodeoxychorismate lyase [Acinetobacter pittii]
Length=270

 Score =  340 bits (872),  Expect = 4e-120
 Identities = 163/269 (61%), Positives = 202/269 (75%), Gaps = 0/269 (0%)

Query  2    MWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNL  61
            MWCFKN QPV+ + + DRA  YGDGCFTT R+   +I+L  RHL RLK  C++L L+VN 
Sbjct  1    MWCFKNGQPVETIPLLDRAFHYGDGCFTTIRVFQNQIELKERHLQRLKLACQKLSLTVNF  60

Query  62   NWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
              I+ SL+Q++    VL GT+KI+ISRGEG RGY++P H AD+YI+FYP++     P  +
Sbjct  61   ELIELSLQQLQKQNLVLNGTLKIVISRGEGDRGYSLPKHEADIYIWFYPKAIEPFVPDSI  120

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            + GVL   LGL MP L GLK+LNRLEQV+LKKEADQ GW+EAL  D+   +VEGVSSNCF
Sbjct  121  QCGVLNQALGLTMPSLVGLKSLNRLEQVLLKKEADQLGWAEALVTDVQGYIVEGVSSNCF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
            I LN+ WITPELRYNGV GVMRAEI+ RMQ  GI C  R ++L E+S++QSLFFCNAL+P
Sbjct  181  IRLNDRWITPELRYNGVHGVMRAEILARMQHHGIACEVRVIELDEVSEIQSLFFCNALNP  240

Query  242  MNIVTHLQSQTLQTNICTQLYHILNLNQI  270
            M +VTHL  +TL T  C  L+HILNLNQI
Sbjct  241  MRVVTHLGEKTLDTQACIDLFHILNLNQI  269


> Q9HZN6 4-amino-4-deoxychorismate lyase [Pseudomonas aeruginosa 
(strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / 
LMG 12228 / 1C / PRS 101 / PAO1)]
Length=271

 Score =  153 bits (386),  Expect = 2e-47
 Identities = 91/240 (38%), Positives = 135/240 (56%), Gaps = 16/240 (7%)

Query  7    NAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNLNWIDG  66
            + +P  E+S++DR L YGDG F T  +  G  +L+ RHLARL+E C +L + ++      
Sbjct  6    DGRPAAELSVRDRGLAYGDGLFETLAVRAGTPRLLERHLARLEEGCRRLAIPLDT----A  61

Query  67   SLEQMKTLGCVLTG--TIKILISRGEGQRGYTMPSHAADLYIYF------YPQSHAIDQP  118
            +L Q     C   G    K++++RGEG RGY  P+ A+   I        YP+ H     
Sbjct  62   ALRQELLAFCAALGDGVAKLIVTRGEGLRGYAPPAEASPRRILSGSPRPAYPERH---WQ  118

Query  119  AYLKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSS  178
              ++    +T+L    P LAGLK LNRLEQV+ + E    G +E L LD++  VVEGV S
Sbjct  119  QGVRLFACRTRLAE-QPLLAGLKHLNRLEQVLARAEWSDAGHAEGLMLDVHERVVEGVFS  177

Query  179  NCFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNA  238
            N  + L+ T + P+LR  GV GVMRAE+++R + +G+    R V + EL+    +F CN+
Sbjct  178  NLLLVLDGTLVAPDLRRCGVAGVMRAELLERAEGIGVPLAIRDVSMAELATADEVFLCNS  237


> A0A2I6J4A3 Aminodeoxychorismate lyase [Lysobacter antibioticus]
Length=267

 Score = 88.2 bits (217),  Expect = 1e-23
 Identities = 74/254 (29%), Positives = 113/254 (44%), Gaps = 28/254 (11%)

Query  5    FKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNLNWI  64
            F   + V  +S  DR   YGDG F T R   G++     H ARL    ++L L      +
Sbjct  2    FLGTRRVDALSPYDRGHAYGDGLFETLRAHRGELPWWDAHWARLARGAQRLRLP-----L  56

Query  65   DGSLEQMKTLGCVLTG---TIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYL  121
                +       VL G    +K++++RGEG RGY   + A  ++       H +  PA  
Sbjct  57   PDPAQVRSEASQVLAGLDAVLKLILTRGEGGRGYAPSAQAEPVWTI---SRHPLP-PASP  112

Query  122  KSGVLKTQLGLCM---PKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSS  178
              G+      L +   P LAGLK  NRLEQV+ + E D     E L  D +  VV   ++
Sbjct  113  AGGLTLRWCDLPLSEQPALAGLKHCNRLEQVLARAEWDDPAIDEGLLCDASGAVVCATAA  172

Query  179  NCFIYLNNTWITPELRYNGVRGVMRAEIID----RMQQLGIECIQRPVQLTELSQVQSLF  234
            N F+     W TP +  +GV GV R  +++    R+Q+L  +         ++    ++F
Sbjct  173  NVFVLQAGVWRTPPVDRSGVAGVCRQVLMELAEVRVQRLNAD---------DVLGADAVF  223

Query  235  FCNALHPMNIVTHL  248
             CNA+  +  V  L
Sbjct  224  LCNAVRGILPVARL  237


> Q84CY7 D-alanine aminotransferase [Bacillus cereus]
Length=291

 Score = 81.3 bits (199),  Expect = 3e-21
 Identities = 63/234 (27%), Positives = 113/234 (48%), Gaps = 10/234 (4%)

Query  6    KNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDL---SVNLN  62
            K  QP+  V++++R  Q+GDG +   R+ DGK  L+  HL R      ++ L        
Sbjct  19   KEEQPM--VALEERGFQFGDGIYEVFRLYDGKPHLLDLHLERFFNSMAEIKLIPPFTKEE  76

Query  63   WIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQP-AYL  121
             ++   + ++       G + + ISRG  QR +    + +DL   ++    +  +P A +
Sbjct  77   LVEELYQMIEKNQFQEDGNVYLQISRGAQQRNHV---YESDLQPTYFANLVSFPRPVASM  133

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
            ++G+  T       K   +K+LN L  +++K + ++QG+ EA+ L  +  V EG  SN F
Sbjct  134  EAGIKVTVEEDIRWKFCHIKSLNLLPNIMIKNKINEQGYQEAI-LVRDGIVTEGCHSNFF  192

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFF  235
            I  NN  IT    +  + G+ R  +I   ++L I+  +R   L E+   +  FF
Sbjct  193  IVKNNKLITHPADHFILHGITRHYVITLAKELHIDVEEREFSLQEVYDAEECFF  246


> Q81JD6 Branched-chain-amino-acid aminotransferase [Bacillus anthracis]
Length=298

 Score = 79.3 bits (194),  Expect = 2e-20
 Identities = 65/263 (25%), Positives = 110/263 (42%), Gaps = 15/263 (6%)

Query  3    WCFKNAQPVKE----VSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLS  58
            W F N + V +    VS+ D    YGDG F   R+  G +  +  HL RL E  + + L 
Sbjct  5    WIFLNGEFVPKDEAKVSVYDHGYLYGDGVFEGIRVYSGNVFRLREHLVRLYESAKSIMLE  64

Query  59   V--NLNWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAID  116
            +  +L+ I   + +      +  G I++++SRG G  G    S      +    Q     
Sbjct  65   IPYSLDEITNIVVETIRQNKLSNGYIRLVVSRGAGNLGLDPDSCTKPNVVVIAEQLSLFP  124

Query  117  QPAYLKS------GVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINN  170
            Q  Y K          + +  +  P++   K+LN L  ++++ EA   G  EAL L+   
Sbjct  125  QEYYEKGIPVVTVATRRNRPDVLSPQV---KSLNYLNNILVRIEAKLAGVQEALMLNDQG  181

Query  171  EVVEGVSSNCFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQV  230
             V EG   N FI   N  ITP      + G+ R  I++  ++LG +  +      ++   
Sbjct  182  YVAEGSGDNVFIVKGNKLITPPSSAGALEGITRNAILEIGEKLGYDVREELFTRHDVYVA  241

Query  231  QSLFFCNALHPMNIVTHLQSQTL  253
              +F       +  VT +  +T+
Sbjct  242  DEVFLTGTAAEVIAVTTVDGRTI  264


> Q84CY6 Branched-chain-amino-acid aminotransferase [Bacillus cereus]
Length=298

 Score = 74.7 bits (182),  Expect = 8e-19
 Identities = 65/264 (25%), Positives = 114/264 (43%), Gaps = 17/264 (6%)

Query  3    WCFKNAQPVKE----VSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQ--LD  56
            W F N + V +    VS+ D    YGDG F   R+  G +  +  HL RL E  +   L+
Sbjct  5    WIFLNGEFVPKDEAKVSVYDHGYLYGDGVFEGIRVYSGNVFRLREHLVRLYESAKSILLE  64

Query  57   LSVNLNWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAAD------LYIYFYP  110
            +  +L+ +   + +      +  G I++++SRG G  G    S          + I  +P
Sbjct  65   IPYSLDEVTNIVVETIRHNKLSNGYIRLVVSRGAGNLGLDPDSCRKPNVVVIAVPISLFP  124

Query  111  QSH-AIDQPAYLKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDIN  169
            Q +  ID P  +     + +  +  P++   K+LN L  ++++  A   G  EAL L+  
Sbjct  125  QEYYEIDIPV-VTVATRRNRPDVLSPQV---KSLNYLNNILVRIVAKLAGVQEALMLNDQ  180

Query  170  NEVVEGVSSNCFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQ  229
              V EG   N FI   N  ITP      + G+ R  I++  ++LG +  +      ++  
Sbjct  181  GYVAEGSGDNVFIVKGNKLITPPSSAGALEGITRNAILEIGEKLGYDVREELFTRHDVYV  240

Query  230  VQSLFFCNALHPMNIVTHLQSQTL  253
               +F       +  VT +  +T+
Sbjct  241  ADEVFLTGTAAEVIAVTTVDGRTI  264


> Q84CY8 Branched-chain-amino-acid aminotransferase [Bacillus cereus]
Length=299

 Score = 69.7 bits (169),  Expect = 5e-17
 Identities = 60/224 (27%), Positives = 90/224 (40%), Gaps = 27/224 (12%)

Query  14   VSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNLNWIDGSLEQMKT  73
            VS+ D    YGDG F   R   G +  +  H+ RL E  E   +    N  DG      +
Sbjct  20   VSVYDHGFLYGDGVFKGIRSYGGNVFCIKEHVKRLDEISE---IYFTNNSNDGRRNGRSS  76

Query  74   LGCVLTGT-----IKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYLKSGVLKT  128
            L  +         I++++SRG+G  G    S      I    Q     Q  Y        
Sbjct  77   LHTLQKNEYTDAYIRLIVSRGKGDLGLDPRSCVKPSVIIIAEQLKLFPQEFY--------  128

Query  129  QLGLCMPKLAG-----------LKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVS  177
              GL +  +A            +K++N L  V++K EA Q G  EAL L+    V EG  
Sbjct  129  DNGLSVVSVASRRNTPDALDPRIKSMNYLNNVLVKIEAAQAGVLEALMLNQQGYVCEGSG  188

Query  178  SNCFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRP  221
             N F+  +   + P      + G+ R  +I+  ++L I C +RP
Sbjct  189  DNVFVVKDGKVLAPPSYLGALEGITRNSVIELCERLSIPCEERP  232


> Q84CY5 D-alanine aminotransferase [Bacillus cereus]
Length=306

 Score = 69.3 bits (168),  Expect = 7e-17
 Identities = 64/250 (26%), Positives = 110/250 (44%), Gaps = 18/250 (7%)

Query  14   VSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNLNWIDGSLEQMKT  73
            + +++R  Q+GDG +   R+  G   L+  H+ RL    E+++LS+       S  ++ T
Sbjct  39   IELEERGSQFGDGVYEVIRLYKGNFHLLDPHITRLYRSMEEVELSLPF-----SKAELIT  93

Query  74   LGCVL--------TGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPA-YLKSG  124
            L   L         GTI + +SRG   R +   S+     IY Y      ++PA +++ G
Sbjct  94   LLYKLIERNHFHEDGTIYLQVSRGVQARTHVF-SYDTPPTIYAYITKK--ERPALWIEYG  150

Query  125  VLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCFIYL  184
            +              +K+LN L  V+   +A+++G  EAL L  N  V EG  SN F+  
Sbjct  151  IRAISEPDTRWLRCDIKSLNLLPNVLAATKAERKGCKEAL-LVRNGIVTEGSHSNFFLIK  209

Query  185  NNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHPMNI  244
            N T  T    +  + G++R  ++     L I   +    + ++ Q    FF      +  
Sbjct  210  NGTLYTHPANHLILNGIIRQYVLSLANTLHIPVQEELFSVRDVYQADECFFTGTTIEILP  269

Query  245  VTHLQSQTLQ  254
            +THL    +Q
Sbjct  270  MTHLDGTAIQ  279


 Score = 17.7 bits (34),  Expect = 7.2
 Identities = 8/21 (38%), Positives = 10/21 (48%), Gaps = 0/21 (0%)

Query  10   PVKEVSIQDRALQYGDGCFTT  30
            PV+E     R +   D CF T
Sbjct  241  PVQEELFSVRDVYQADECFFT  261


> D3GDJ2 Probable branched-chain-amino-acid aminotransferase [Rhizobium 
leguminosarum bv. viciae]
Length=285

 Score = 62.4 bits (150),  Expect = 2e-14
 Identities = 54/244 (22%), Positives = 109/244 (45%), Gaps = 4/244 (2%)

Query  14   VSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNLNWIDGSLEQMKT  73
            V I+DR  Q+ DG +    +  G I  + RHL RL     +L ++  ++    +    +T
Sbjct  17   VHIEDRGYQFADGVYEVCEVRHGYIVDLTRHLNRLDRSLGELRIAWPMSRAALTQVIRET  76

Query  74   L--GCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQS-HAIDQPAYLKSGVLKTQL  130
            L    V  G   + ++RG  +R +  P+      +    +S  A    A   +G+    L
Sbjct  77   LRRNHVRNGLFYMQVTRGVARRDHVFPAEGTPPSLVITAKSTDAKIIAAKNANGIKAITL  136

Query  131  GLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCFIY-LNNTWI  189
                     +K++  L   + +++A + G  EA+ +D +  V EG ++N +I   + T +
Sbjct  137  VDNRWDRVDIKSVGLLPNAMARQQAKEAGAQEAIYVDGDGMVKEGAATNVWIVDPDGTLV  196

Query  190  TPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHPMNIVTHLQ  249
            T    +  +RG+ R  ++D   +LG++  +R   ++E+   + +F   A     +V  + 
Sbjct  197  TRPAEHGILRGITRTTLMDVAAKLGLQIAERSFSVSEMLAAREVFLTAATSICFLVVSVD  256

Query  250  SQTL  253
             Q +
Sbjct  257  GQAI  260


> B8Y8J0 ADC lyase [Streptomyces sp. FR-008]
Length=273

 Score = 62.0 bits (149),  Expect = 2e-14
 Identities = 59/242 (24%), Positives = 100/242 (41%), Gaps = 10/242 (4%)

Query  13   EVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDL-SVNLNWIDGSLEQM  71
            +VS+ D  L  GDG F T +  DG+   + RHL RL      L L   +L+ +  +   +
Sbjct  16   QVSVLDHGLTVGDGVFETVKTVDGRALALTRHLDRLARSARGLGLPEPDLDEVRRACAAV  75

Query  72   KTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYLKSGVLKTQLG  131
                 V  G ++I  + G    G         L +         +  A +     + + G
Sbjct  76   LAAEPVPLGRLRITYTGGLSPLGSDRGDDTPTLVVALGEAHPRPETTAVVTVDWTRNERG  135

Query  132  LCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCFIYLNNTWITP  191
                 L+GLKT +  E V+    A +QG +EAL  +    + EG  SN F+ L+    TP
Sbjct  136  A----LSGLKTTSYAENVVALARAREQGATEALFANTVGALCEGTGSNVFVVLDGEIHTP  191

Query  192  ELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHPMNIVTHLQSQ  251
             +    + G+ RA      +  G    + P+ +  L +   +F  ++L  +  V  +  +
Sbjct  192  PVSSGCLAGITRAL---TAEWTGARETELPMDV--LERADEIFLTSSLRDVQGVHRVDGR  246

Query  252  TL  253
            TL
Sbjct  247  TL  248


> Q937U0 Probable branched-chain-amino-acid aminotransferase [Brucella 
suis]
Length=289

 Score = 60.8 bits (146),  Expect = 6e-14
 Identities = 55/247 (22%), Positives = 111/247 (45%), Gaps = 12/247 (5%)

Query  14   VSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNLN-----WIDGSL  68
            +SI DR   +GDG +    + +GK+     H+ RL+    ++ +++ ++      I+  L
Sbjct  23   ISIFDRGFLFGDGIYEVTAVLEGKLVDSEPHMQRLRRSTGEIGIAMPMSEDEIVTIEREL  82

Query  69   EQMKTLGCVLTGTIKILISRGE-GQRGYTMPSHAADLYIYFYPQSHAIDQPAYLKSGVLK  127
             +   L     G + + ++RG  G R +   ++     + F  +++ +D+PA LK+G   
Sbjct  83   IRRNKL---TEGLVYLQVTRGNGGDRDFVPAANMKPSVVLFTQEANLLDKPA-LKTGAHV  138

Query  128  TQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCFIYLNNT  187
              L     K   +KT+  L Q + K+ A   G  EA  ++ +  V EG SS  +I   + 
Sbjct  139  LSLDDLRWKRRDIKTVCLLPQALTKEIAKNAGCDEAWMIE-DGYVTEGASSTAYIVTRDD  197

Query  188  WITPELRYN-GVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHPMNIVT  246
             I      N  + G  R  ++  + + G++  +R   + E    +  F  +A   +  +T
Sbjct  198  VIVTRPNSNFTLPGCTRLSLLQLITETGMKLEERLFTIDEAYAAKEAFLTSAGTFVTPIT  257

Query  247  HLQSQTL  253
             +  +T+
Sbjct  258  VIDGKTI  264



Lambda      K        H        a         alpha
   0.324    0.138    0.423    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1394775


  Database: e486d0ade05dd329a42e04ee901d4097.TrEMBL.fasta
    Posted date:  Sep 28, 2020  1:49 PM
  Number of letters in database: 7,468
  Number of sequences in database:  27



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40