ACIAD2590 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: ad7896db4e90228718c2ccc0fd908812.SwissProt.fasta
           11 sequences; 3,263 total letters



Query= ACIAD2590

Length=272
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q9KQI0 Aminodeoxychorismate lyase [Vibrio cholerae serotype O1 ...   140    5e-43
  P28305 Aminodeoxychorismate lyase [Escherichia coli (strain K12)]    138    5e-42
  Q56693 Aminodeoxychorismate lyase [Vibrio harveyi]                   123    1e-36
  P54692 D-alanine aminotransferase [Bacillus licheniformis]          69.3    3e-17
  P19938 D-alanine aminotransferase [Bacillus sp. (strain YM-1)]      67.8    9e-17
  G2JZ74 D-alanine aminotransferase [Listeria monocytogenes serot...  65.5    7e-16
  P0AB80 Branched-chain-amino-acid aminotransferase [Escherichia ...  56.2    1e-12
  P0A1A5 Branched-chain-amino-acid aminotransferase [Salmonella t...  55.8    2e-12
  P28821 Aminodeoxychorismate lyase [Bacillus subtilis (strain 168)]  55.5    2e-12
  P54694 D-alanine aminotransferase [Staphylococcus haemolyticus]     53.1    1e-11
  K7QHS5 Branched-chain amino acid aminotransferase 2, chloroplas...  48.1    6e-10


> Q9KQI0 Aminodeoxychorismate lyase [Vibrio cholerae serotype O1 
(strain ATCC 39315 / El Tor Inaba N16961)]
Length=267

 Score =  140 bits (354),  Expect = 5e-43
 Identities = 95/269 (35%), Positives = 145/269 (54%), Gaps = 15/269 (6%)

Query  1    MMWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVN  60
            M W   N Q   EV I DR+ QYGDGCFTT   ++G++Q    H ARL+ C + L +   
Sbjct  1    MYWV--NGQRRNEVPIHDRSFQYGDGCFTTILTKEGQVQQWSSHKARLQACLDILHIP-E  57

Query  61   LNWIDGSLEQMKTLGCVLT---GTIKILISRGEGQRGYTMPSHAADLYI----YFYPQSH  113
             NW D   + ++++  +L      +KI ISRG G RGY+ P+  ++  +    + +P  +
Sbjct  58   PNW-DRVWQGLQSM--ILPQEKAGLKIHISRGLGGRGYS-PTQVSESIVTISAFAFPAHY  113

Query  114  AIDQPAYLKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVV  173
               +   L  G+ + ++GL  P LAG K  NRLEQ++LK+E D  GW + + LDIN +V+
Sbjct  114  QAWRDKGLAVGICQQRMGL-NPLLAGHKHNNRLEQILLKREMDNAGWDDGVCLDINGKVI  172

Query  174  EGVSSNCFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSL  233
            E  ++N F   + T  TP LR+ GV GV R +I++  QQ  I  +     L +L   + +
Sbjct  173  ETTAANIFWCRDGTMFTPCLRHAGVAGVARRQILELAQQQEIPIVIDEFTLEDLLSAEEV  232

Query  234  FFCNALHPMNIVTHLQSQTLQTNICTQLY  262
            F  NAL  +  VT +  Q L     T+ +
Sbjct  233  FITNALLEVAPVTQIGQQRLTIGSMTRRF  261


> P28305 Aminodeoxychorismate lyase [Escherichia coli (strain K12)]
Length=269

 Score =  138 bits (347),  Expect = 5e-42
 Identities = 91/241 (38%), Positives = 130/241 (54%), Gaps = 9/241 (4%)

Query  7    NAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSVNLNWIDG  66
            N    + +++ DRA Q+GDGCFTTAR+ DGK+ L+  H+ RL++ C++L +S +  W   
Sbjct  5    NGHKQESLAVSDRATQFGDGCFTTARVIDGKVSLLSAHIQRLQDACQRLMISCDF-W--P  61

Query  67   SLEQ-MKTLGCVL-TGTIKILISRGEGQRGY-TMPSHAAD--LYIYFYPQSHAIDQPAYL  121
             LEQ MKTL      G +K++ISRG G RGY T+ S  A   L +  YP  +   +   +
Sbjct  62   QLEQEMKTLAAEQQNGVLKVVISRGSGGRGYSTLNSGPATRILSVTAYPAHYDRLRNEGI  121

Query  122  KSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCF  181
               +   +LG   P LAG+K LNRLEQV+++   +Q    EAL LD    V E  ++N F
Sbjct  122  TLALSPVRLGR-NPHLAGIKHLNRLEQVLIRSHLEQTNADEALVLDSEGWVTECCAANLF  180

Query  182  IYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHP  241
                N   TP L   GV G+MR   I  + Q   + ++    L E  Q   +  CNAL P
Sbjct  181  WRKGNVVYTPRLDQAGVNGIMRQFCIRLLAQSSYQLVEVQASLEESLQADEMVICNALMP  240

Query  242  M  242
            +
Sbjct  241  V  241


 Score = 21.9 bits (45),  Expect = 0.14
 Identities = 15/49 (31%), Positives = 23/49 (47%), Gaps = 4/49 (8%)

Query  208  DRMQQLGIECIQRPVQLTELSQVQSLFFCNALHPMNIVTHLQSQTLQTN  256
            DR++  GI     PV+L     +  +   N L  + I +HL+    QTN
Sbjct  114  DRLRNEGITLALSPVRLGRNPHLAGIKHLNRLEQVLIRSHLE----QTN  158


> Q56693 Aminodeoxychorismate lyase [Vibrio harveyi]
Length=271

 Score =  123 bits (309),  Expect = 1e-36
 Identities = 80/247 (32%), Positives = 128/247 (52%), Gaps = 17/247 (7%)

Query  1    MMWCFKNAQPVKEVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQL-----  55
            M W   N  P   V + DR+ QYGDGCF+T + + G+++    H+ R++ C   L     
Sbjct  1    MFWV--NGLPQTHVPLGDRSFQYGDGCFSTIKTKKGQLEHWQAHVERMEACLTTLQIPFP  58

Query  56   DLSVNLNWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYT---MPSHAADLYIYFYPQS  112
            D    L+W   +  + ++ G      IKI ISRG G RGY+   +      +  + +P  
Sbjct  59   DWRTVLDWAMSATLKDESAG------IKIHISRGCGGRGYSPSGVEGPVVTISNFSFPAH  112

Query  113  HAIDQPAYLKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEV  172
            +   Q   ++ GV +T+LG+  P LAG K  NR+EQV+ K E D   +++A+TL++ N V
Sbjct  113  YLAWQERGVQLGVCETRLGI-QPLLAGHKHNNRIEQVLAKAEIDGTEFADAVTLNVQNHV  171

Query  173  VEGVSSNCFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQS  232
            +E   +N F   +    TP L  +GV GVMR ++++ +Q  G         LT+L     
Sbjct  172  IETTMANLFWVKDEKVFTPGLCLSGVAGVMRRKVLEYLQSEGYSVQVADFTLTDLLDADE  231

Query  233  LFFCNAL  239
            ++ CN+L
Sbjct  232  VWMCNSL  238


> P54692 D-alanine aminotransferase [Bacillus licheniformis]
Length=283

 Score = 69.3 bits (168),  Expect = 3e-17
 Identities = 57/243 (23%), Positives = 112/243 (46%), Gaps = 7/243 (3%)

Query  14   VSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQ--LDLSVNLNWIDGSLEQM  71
            V I+DR  Q+GDG +   RI +G +  +  H+ARL +   +  +DLS +   +   L+++
Sbjct  17   VDIEDRGYQFGDGVYEVIRIYNGILFTLDEHIARLYKSAAEIGIDLSFSEAELKSQLKEL  76

Query  72   KTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQP-AYLKSGVLKTQL  130
              +     G + + ++RG+  R +    + A L       +  I +P    ++GV     
Sbjct  77   VDINQRRDGGLYLQVTRGKAPRKH---QYGAGLTPQVTAYTFPIQKPEKEQQNGVSAITA  133

Query  131  GLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCFIYLNNTWIT  190
                     +K+LN L  V++K++A +    EA+ +  +  V EG SSN ++   N   T
Sbjct  134  DDMRWLRCDIKSLNLLYNVMIKQKAQEASAFEAILIR-DGLVTEGTSSNVYVAKQNVIYT  192

Query  191  PELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHPMNIVTHLQS  250
              +    + G+ R +++   ++ G+   ++ V   EL     +F  +    +  VT +  
Sbjct  193  HPVTTLILNGITRMKVLQLCEENGLNYEEKAVTKDELLNADEVFITSTTAEVIPVTSIDG  252

Query  251  QTL  253
            QT+
Sbjct  253  QTI  255


> P19938 D-alanine aminotransferase [Bacillus sp. (strain YM-1)]
Length=283

 Score = 67.8 bits (164),  Expect = 9e-17
 Identities = 60/255 (24%), Positives = 115/255 (45%), Gaps = 10/255 (4%)

Query  7    NAQPVKEVSI----QDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSV--N  60
            N Q VK+  +    +DR  Q+GDG +   ++ +G++  ++ H+ RL    E++ +++   
Sbjct  7    NDQIVKDEEVKIDKEDRGYQFGDGVYEVVKVYNGEMFTVNEHIDRLYASAEKIRITIPYT  66

Query  61   LNWIDGSLEQMKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQP-A  119
             +     L ++     + TG I   ++RG   R +  P +     I  Y + +   +P  
Sbjct  67   KDKFHQLLHELVEKNELNTGHIYFQVTRGTSPRAHQFPENTVKPVIIGYTKEN--PRPLE  124

Query  120  YLKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSN  179
             L+ GV  T +         +K+LN L  V+ K+EA ++G  EA+ L  NN V EG SSN
Sbjct  125  NLEKGVKATFVEDIRWLRCDIKSLNLLGAVLAKQEAHEKGCYEAI-LHRNNTVTEGSSSN  183

Query  180  CFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNAL  239
             F   +    T       ++G+ R  +I    ++ +   + P    E  ++  LF  +  
Sbjct  184  VFGIKDGILYTHPANNMILKGITRDVVIACANEINMPVKEIPFTTHEALKMDELFVTSTT  243

Query  240  HPMNIVTHLQSQTLQ  254
              +  V  +  + ++
Sbjct  244  SEITPVIEIDGKLIR  258


> G2JZ74 D-alanine aminotransferase [Listeria monocytogenes serotype 
1/2a (strain 10403S)]
Length=289

 Score = 65.5 bits (158),  Expect = 7e-16
 Identities = 59/242 (24%), Positives = 111/242 (46%), Gaps = 12/242 (5%)

Query  14   VSIQDRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCEQLDLSV--NLNWIDGSLEQM  71
            V I+DR  Q+GDG +   R+ +GK    + H+ RL     ++DL +  +   +   LE++
Sbjct  17   VDIEDRGYQFGDGVYEVVRLYNGKFFTYNEHIDRLYASAAKIDLVIPYSKEELRELLEKL  76

Query  72   KTLGCVLTGTIKILISRG-EGQRGYTMPSHAADLYIYFYPQSHAIDQP----AYLKSGVL  126
                 + TG + + ++RG +  R + +P    D  +     + A + P     +++ G  
Sbjct  77   VAENNINTGNVYLQVTRGVQNPRNHVIPD---DFPLEGVLTAAAREVPRNERQFVEGGTA  133

Query  127  KTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCFIYLNN  186
             T+  +   +   +K+LN L  ++ K +A QQ   EA+ L    +V E  +SN  I  + 
Sbjct  134  ITEEDVRWLR-CDIKSLNLLGNILAKNKAHQQNALEAI-LHRGEQVTECSASNVSIIKDG  191

Query  187  TWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNALHPMNIVT  246
               T       + G+ R  IID  ++ GI   +    LT+L +   +F  +    +  +T
Sbjct  192  VLWTHAADNLILNGITRQVIIDVAKKNGIPVKEADFTLTDLREADEVFISSTTIEITPIT  251

Query  247  HL  248
            H+
Sbjct  252  HI  253


 Score = 17.7 bits (34),  Expect = 3.1
 Identities = 9/26 (35%), Positives = 12/26 (46%), Gaps = 0/26 (0%)

Query  6    KNAQPVKEVSIQDRALQYGDGCFTTA  31
            KN  PVKE       L+  D  F ++
Sbjct  217  KNGIPVKEADFTLTDLREADEVFISS  242


> P0AB80 Branched-chain-amino-acid aminotransferase [Escherichia 
coli (strain K12)]
Length=309

 Score = 56.2 bits (134),  Expect = 1e-12
 Identities = 57/235 (24%), Positives = 100/235 (43%), Gaps = 15/235 (6%)

Query  13   EVSIQDRALQYGDGCFTTARIED---GKIQLMHR-HLARLKECCEQLDLSVNLNWIDGSL  68
            +V +   AL YG   F   R  D   G +   HR H+ RL +  +     V+ + ID  +
Sbjct  22   KVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIYRFPVSQS-IDELM  80

Query  69   EQMKTL---GCVLTGTIKILISRGEGQRGYTMPS-HAADLYIYFYPQSHAIDQPAYLKSG  124
            E  + +     + +  I+ LI  G+   G   P+ ++ D+ I  +P    +   A L+ G
Sbjct  81   EACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGAYLGAEA-LEQG  139

Query  125  V--LKTQLGLCMPKL---AGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSN  179
            +  + +      P     A     N L  +++  EA + G+ E + LD+N  + EG   N
Sbjct  140  IDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGEN  199

Query  180  CFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLF  234
             F   +    TP    + + G+ R  II   ++LGIE  ++ +    L     +F
Sbjct  200  LFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVF  254


> P0A1A5 Branched-chain-amino-acid aminotransferase [Salmonella 
typhimurium (strain LT2 / SGSC1412 / ATCC 700720)]
Length=309

 Score = 55.8 bits (133),  Expect = 2e-12
 Identities = 56/235 (24%), Positives = 97/235 (41%), Gaps = 15/235 (6%)

Query  13   EVSIQDRALQYGDGCFTTARIED---GKIQLMHR-HLARLKECCEQLDLSVNLNWIDGSL  68
            +V +   AL YG   F   R  D   G +   HR H+ RL++  +     V+ + ID  +
Sbjct  22   KVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLRDSAKIYRFPVSQS-IDELM  80

Query  69   EQMKTL---GCVLTGTIKILISRGEGQRGYTMP-SHAADLYIYFYPQ-----SHAIDQPA  119
            E  + +     + +  I+ L+  G+   G   P  +  D+ I  +P      + A+DQ  
Sbjct  81   EACRDVIRKNNLTSAYIRPLVFVGDVGMGVNPPPGYTTDVIIAAFPWGAYLGAEALDQGI  140

Query  120  YLKSGVLKTQLGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSN  179
                          +P  A     N L  +++  EA + G+ E + LD+N  + EG   N
Sbjct  141  DAMVSSWNRAAPNTIPTAAKAGG-NYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGEN  199

Query  180  CFIYLNNTWITPELRYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLF  234
             F   +    TP    + + G+ R  II   ++LGIE  ++ +    L     +F
Sbjct  200  LFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESLYLADEVF  254


> P28821 Aminodeoxychorismate lyase [Bacillus subtilis (strain 
168)]
Length=293

 Score = 55.5 bits (132),  Expect = 2e-12
 Identities = 53/226 (23%), Positives = 94/226 (42%), Gaps = 5/226 (2%)

Query  18   DRALQYGDGCFTTARIEDGKIQLMHRHLARLKECCE--QLDLSVNLNWIDGSLEQMKTLG  75
            D    YG G F T R+ +G   L+  H+ RL+   +  Q++ +V+ + I   L+++  L 
Sbjct  20   DHGFLYGIGVFETFRLYEGCPFLLDWHIERLERALKDLQIEYTVSKHEILEMLDKLLKLN  79

Query  76   CVLTGT--IKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQPAYLKSGVLKTQLGLC  133
             +  G   +++ IS G   +G+   ++     + F  Q      P   +  VL  +    
Sbjct  80   DIKDGNARVRLNISAGISDKGFVAQTYDKPTVLCFVNQLKPESLPLQKEGKVLSIRRNTP  139

Query  134  MPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCFIYLNNTWITPEL  193
                  LK+ + L  +  K+E       E + L  +  V EG+ SN F        TP L
Sbjct  140  EGSFR-LKSHHYLNNMYAKREIGNDPRVEGIFLTEDGAVAEGIISNVFWRKGRCIYTPSL  198

Query  194  RYNGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLFFCNAL  239
                + GV R  II+  + +G+E      +L  L      +  N++
Sbjct  199  DTGILDGVTRRFIIENAKDIGLELKTGRYELEALLTADEAWMTNSV  244


> P54694 D-alanine aminotransferase [Staphylococcus haemolyticus]
Length=282

 Score = 53.1 bits (126),  Expect = 1e-11
 Identities = 50/197 (25%), Positives = 88/197 (45%), Gaps = 6/197 (3%)

Query  13   EVSIQDRALQYGDGCFTTARIEDGKIQLMHRHLAR-LKECCE-QLDLSVNLNWIDGSLEQ  70
            +VS +DR   +GDG +   R  DGK+  +  H  R ++   E QLDL   +  +   + +
Sbjct  17   KVSYEDRGYVFGDGIYEYIRAYDGKLFTVTEHFERFIRSASEIQLDLGYTVEELIDVVRE  76

Query  71   MKTLGCVLTGTIKILISRGEGQRGYTMPSHAADLYIYFYPQSHAIDQP-AYLKSGVLKTQ  129
            +  +  +  G I I  +RG   R ++ P+      I  + +S+  D+P   L++G+    
Sbjct  77   LLKVNNIQNGGIYIQATRGVAPRNHSFPTPEVKPVIMAFAKSY--DRPYDDLENGINAAT  134

Query  130  LGLCMPKLAGLKTLNRLEQVILKKEADQQGWSEALTLDINNEVVEGVSSNCFIYLNNTWI  189
            +         +K+LN L  V+ K+ A +    EA+       V EG SSN +   +    
Sbjct  135  VEDIRWLRCDIKSLNLLGNVLAKEYAVKYNAGEAIQ-HRGETVTEGASSNVYAIKDGAIY  193

Query  190  TPELRYNGVRGVMRAEI  206
            T  +    + G+ R  I
Sbjct  194  THPVNNYILNGITRKVI  210


> K7QHS5 Branched-chain amino acid aminotransferase 2, chloroplastic 
[Humulus lupulus]
Length=408

 Score = 48.1 bits (113),  Expect = 6e-10
 Identities = 32/99 (32%), Positives = 53/99 (54%), Gaps = 3/99 (3%)

Query  139  GLKTLNRLEQVI-LKKEADQQGWSEALTLD-INNEVVEGVSS-NCFIYLNNTWITPELRY  195
            G+KT+     V+  +  A +QG+S+ L LD ++ + +E VSS N F+   N   TP ++ 
Sbjct  252  GVKTIGNYAAVLKAQSAAKEQGYSDVLYLDCVHKKYLEEVSSCNIFVVKGNLIFTPAIKG  311

Query  196  NGVRGVMRAEIIDRMQQLGIECIQRPVQLTELSQVQSLF  234
              + G+ R  IID  + LG +  +R V + EL     +F
Sbjct  312  TILPGITRKSIIDVARTLGFQVEERLVHVDELLDADEVF  350



Lambda      K        H        a         alpha
   0.324    0.138    0.423    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644230


  Database: ad7896db4e90228718c2ccc0fd908812.SwissProt.fasta
    Posted date:  Sep 28, 2020  2:52 PM
  Number of letters in database: 3,263
  Number of sequences in database:  11



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40