ACIAD2545 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: f8eb2060ef99bac5fe2856014e47b427.TrEMBL.fasta
           27 sequences; 7,197 total letters



Query= ACIAD2545

Length=264
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F9F4 (E)-2-((N-methylformamido)methylene)succinate hydrolase ...   535    0.0   
  A0A1P8EF95 Alpha/beta hydrolase [Acinetobacter soli]                 512    0.0   
  A0A0M1I646 Alpha/beta hydrolase [Acinetobacter sp. C15]              512    0.0   
  N9BS04 AB hydrolase-1 domain-containing protein [Acinetobacter ...   512    0.0   
  A0A062FE15 Alpha/beta hydrolase fold family protein [Acinetobac...   454    2e-165
  A0A204ERY7 Alpha/beta hydrolase [Acinetobacter baumannii]            454    2e-165
  D0S2G3 Hydrolase, alpha/beta domain protein [Acinetobacter calc...   454    3e-165
  S3TCR5 AB hydrolase-1 domain-containing protein [Acinetobacter ...   454    4e-165
  N9KUR9 AB hydrolase-1 domain-containing protein [Acinetobacter ...   454    4e-165
  A0A0E1PT82 AB hydrolase-1 domain-containing protein [Acinetobac...   454    4e-165
  A0A1E2YQ87 Alpha/beta hydrolase [Acinetobacter pittii]               454    4e-165
  R8YGX0 AB hydrolase-1 domain-containing protein [Acinetobacter ...   453    5e-165
  A0A2G1TKR1 Alpha/beta hydrolase [Acinetobacter baumannii]            453    5e-165
  A0A062FKV6 Alpha/beta hydrolase fold family protein [Acinetobac...   453    5e-165
  B0VB91 AB hydrolase-1 domain-containing protein [Acinetobacter ...   453    8e-165
  A0A0D5YKA0 Alpha/beta fold hydrolase [Acinetobacter baumannii]       453    8e-165
  A0A0J0ZWP1 Ndr family protein [Acinetobacter baumannii MRSN 3527]    453    8e-165
  Q13KT2 3-oxoadipate enol-lactonase [Paraburkholderia xenovorans...  76.3    1e-19 
  B2DD14 Meta-cleavage compound hydrolase [Neptuniibacter sp. CAR...  76.3    2e-19 
  K7QTC4 Esterase [Oenococcus oeni]                                   72.4    3e-18 
  Q2HWH9 Meta-cleavage compound hydrolase [Nocardioides aromatici...  72.4    4e-18 
  A5VAT9 Alpha/beta hydrolase fold [Sphingomonas wittichii (strai...  72.0    5e-18 
  A5J2A5 Meta-cleavage pathway hydrolase protein [Sphingomonas wi...  71.2    9e-18 
  O86901 Hydrolase [Sphingomonas sp]                                  70.9    1e-17 
  E3W9G6 Putative hydrolase [Terrabacter sp. (strain DBF63)]          69.3    5e-17 
  Q8VPF0 3-oxoadipate enol-lactone hydrolase [Pseudomonas knackmu...  68.9    5e-17 
  A3FNW7 Esterase [uncultured organism]                               68.2    1e-16 


> Q6F9F4 (E)-2-((N-methylformamido)methylene)succinate hydrolase 
[Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=263

 Score =  535 bits (1379),  Expect = 0.0
 Identities = 263/263 (100%), Positives = 263/263 (100%), Gaps = 0/263 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG
Sbjct  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY
Sbjct  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER
Sbjct  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETTP  263
            HMVNLTAPEKVNQAMQAWLETTP
Sbjct  241  HMVNLTAPEKVNQAMQAWLETTP  263


> A0A1P8EF95 Alpha/beta hydrolase [Acinetobacter soli]
Length=263

 Score =  512 bits (1318),  Expect = 0.0
 Identities = 251/263 (95%), Positives = 257/263 (98%), Gaps = 0/263 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQI+YFSKHYHV+SLDMPGHG
Sbjct  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIDYFSKHYHVVSLDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QSTALAADAQLQDFVDWAIECI  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTALAADAQLQDFVDWAIECICALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT AAREAVIQRAEALKQGHLDI+TPLQRWFGQSEIEK ASERVK WLENVNMSGY
Sbjct  121  GVYKRTDAAREAVIQRAEALKQGHLDIDTPLQRWFGQSEIEKTASERVKSWLENVNMSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAYRAFAQGDLVYADGW+DI+CPALVLTGTDDPNSTAEMTIQMA+QAKHGTAIVIENER
Sbjct  181  TTAYRAFAQGDLVYADGWADIQCPALVLTGTDDPNSTAEMTIQMANQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETTP  263
            HMVNLTAPEKVNQAMQAWLET P
Sbjct  241  HMVNLTAPEKVNQAMQAWLETAP  263


> A0A0M1I646 Alpha/beta hydrolase [Acinetobacter sp. C15]
Length=263

 Score =  512 bits (1318),  Expect = 0.0
 Identities = 251/263 (95%), Positives = 257/263 (98%), Gaps = 0/263 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQI+YFSKHYHV+SLDMPGHG
Sbjct  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIDYFSKHYHVVSLDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QSTALAADAQLQDFVDWAIECI  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTALAADAQLQDFVDWAIECICALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT AAREAVIQRAEALKQGHLDI+TPLQRWFGQSEIEK ASERVK WLENVNMSGY
Sbjct  121  GVYKRTDAAREAVIQRAEALKQGHLDIDTPLQRWFGQSEIEKTASERVKSWLENVNMSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAYRAFAQGDLVYADGW+DI+CPALVLTGTDDPNSTAEMTIQMA+QAKHGTAIVIENER
Sbjct  181  TTAYRAFAQGDLVYADGWADIQCPALVLTGTDDPNSTAEMTIQMANQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETTP  263
            HMVNLTAPEKVNQAMQAWLET P
Sbjct  241  HMVNLTAPEKVNQAMQAWLETAP  263


> N9BS04 AB hydrolase-1 domain-containing protein [Acinetobacter 
soli NIPH 2899]
Length=263

 Score =  512 bits (1318),  Expect = 0.0
 Identities = 251/263 (95%), Positives = 257/263 (98%), Gaps = 0/263 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQI+YFSKHYHV+SLDMPGHG
Sbjct  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIDYFSKHYHVVSLDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QSTALAADAQLQDFVDWAIECI  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTALAADAQLQDFVDWAIECICALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT AAREAVIQRAEALKQGHLDI+TPLQRWFGQSEIEK ASERVK WLENVNMSGY
Sbjct  121  GVYKRTDAAREAVIQRAEALKQGHLDIDTPLQRWFGQSEIEKTASERVKSWLENVNMSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAYRAFAQGDLVYADGW+DI+CPALVLTGTDDPNSTAEMTIQMA+QAKHGTAIVIENER
Sbjct  181  TTAYRAFAQGDLVYADGWADIQCPALVLTGTDDPNSTAEMTIQMANQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETTP  263
            HMVNLTAPEKVNQAMQAWLET P
Sbjct  241  HMVNLTAPEKVNQAMQAWLETAP  263


> A0A062FE15 Alpha/beta hydrolase fold family protein [Acinetobacter 
baumannii 754286]
Length=263

 Score =  454 bits (1169),  Expect = 2e-165
 Identities = 222/262 (85%), Positives = 237/262 (90%), Gaps = 0/262 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L ADA+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPADAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTPQARHAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKTWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM IQMA QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMAIQMAKQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETT  262
            HMVNLTAP+KVN AMQAWLET+
Sbjct  241  HMVNLTAPDKVNNAMQAWLETS  262


> A0A204ERY7 Alpha/beta hydrolase [Acinetobacter baumannii]
Length=263

 Score =  454 bits (1169),  Expect = 2e-165
 Identities = 222/262 (85%), Positives = 237/262 (90%), Gaps = 0/262 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L ADA+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPADAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTPQARHAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKTWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM IQMA QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMAIQMAKQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETT  262
            HMVNLTAP+KVN AMQAWLET+
Sbjct  241  HMVNLTAPDKVNNAMQAWLETS  262


> D0S2G3 Hydrolase, alpha/beta domain protein [Acinetobacter calcoaceticus 
RUH2202]
Length=263

 Score =  454 bits (1168),  Expect = 3e-165
 Identities = 221/262 (84%), Positives = 238/262 (91%), Gaps = 0/262 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L ADA+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPADAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTTHARNAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKSWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM +QMA+QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMAVQMANQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETT  262
            HMVNLTAP+KVN AMQAWLET+
Sbjct  241  HMVNLTAPDKVNNAMQAWLETS  262


> S3TCR5 AB hydrolase-1 domain-containing protein [Acinetobacter 
baumannii NIPH 410]
Length=263

 Score =  454 bits (1167),  Expect = 4e-165
 Identities = 221/262 (84%), Positives = 237/262 (90%), Gaps = 0/262 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L ADA+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPADAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTPQARNAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKTWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM +QMA QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMALQMAKQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETT  262
            HMVNLTAP+KVN AMQAWLET+
Sbjct  241  HMVNLTAPDKVNNAMQAWLETS  262


> N9KUR9 AB hydrolase-1 domain-containing protein [Acinetobacter 
baumannii NIPH 80]
Length=263

 Score =  454 bits (1167),  Expect = 4e-165
 Identities = 221/262 (84%), Positives = 237/262 (90%), Gaps = 0/262 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L ADA+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPADAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTPQARNAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKTWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM +QMA QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMALQMAKQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETT  262
            HMVNLTAP+KVN AMQAWLET+
Sbjct  241  HMVNLTAPDKVNNAMQAWLETS  262


> A0A0E1PT82 AB hydrolase-1 domain-containing protein [Acinetobacter 
baumannii NCGM 237]
Length=263

 Score =  454 bits (1167),  Expect = 4e-165
 Identities = 221/262 (84%), Positives = 237/262 (90%), Gaps = 0/262 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L ADA+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPADAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTPQARHAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKTWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM +QMA QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMALQMAKQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETT  262
            HMVNLTAP+KVN AMQAWLET+
Sbjct  241  HMVNLTAPDKVNNAMQAWLETS  262


> A0A1E2YQ87 Alpha/beta hydrolase [Acinetobacter pittii]
Length=263

 Score =  454 bits (1167),  Expect = 4e-165
 Identities = 221/262 (84%), Positives = 237/262 (90%), Gaps = 0/262 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L ADA+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPADAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTPQARHAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKTWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM +QMA QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMALQMAKQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETT  262
            HMVNLTAP+KVN AMQAWLET+
Sbjct  241  HMVNLTAPDKVNNAMQAWLETS  262


> R8YGX0 AB hydrolase-1 domain-containing protein [Acinetobacter 
pittii ANC 4050]
Length=263

 Score =  453 bits (1166),  Expect = 5e-165
 Identities = 220/262 (84%), Positives = 238/262 (91%), Gaps = 0/262 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L +DA+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPSDAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTTQARNAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKSWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM +QMA+QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMAVQMANQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETT  262
            HMVNLTAP+KVN AMQAWLET+
Sbjct  241  HMVNLTAPDKVNNAMQAWLETS  262


> A0A2G1TKR1 Alpha/beta hydrolase [Acinetobacter baumannii]
Length=263

 Score =  453 bits (1166),  Expect = 5e-165
 Identities = 221/261 (85%), Positives = 236/261 (90%), Gaps = 0/261 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L ADA+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPADAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTPQARHAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKTWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM +QMA QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMALQMAKQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLET  261
            HMVNLTAP+KVN AMQAWLET
Sbjct  241  HMVNLTAPDKVNNAMQAWLET  261


> A0A062FKV6 Alpha/beta hydrolase fold family protein [Acinetobacter 
baumannii 940793]
Length=263

 Score =  453 bits (1166),  Expect = 5e-165
 Identities = 221/261 (85%), Positives = 236/261 (90%), Gaps = 0/261 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L ADA+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPADAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTPQARHAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKTWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM +QMA QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMALQMAKQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLET  261
            HMVNLTAP+KVN AMQAWLET
Sbjct  241  HMVNLTAPDKVNNAMQAWLET  261


> B0VB91 AB hydrolase-1 domain-containing protein [Acinetobacter 
baumannii (strain AYE)]
Length=263

 Score =  453 bits (1165),  Expect = 8e-165
 Identities = 221/262 (84%), Positives = 237/262 (90%), Gaps = 0/262 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L A+A+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPAEAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTPQARHAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKTWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM IQMA QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMAIQMAKQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETT  262
            HMVNLTAP+KVN AMQAWLET+
Sbjct  241  HMVNLTAPDKVNNAMQAWLETS  262


> A0A0D5YKA0 Alpha/beta fold hydrolase [Acinetobacter baumannii]
Length=263

 Score =  453 bits (1165),  Expect = 8e-165
 Identities = 221/262 (84%), Positives = 237/262 (90%), Gaps = 0/262 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L A+A+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPAEAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTPQARHAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKTWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM IQMA QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMAIQMAKQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETT  262
            HMVNLTAP+KVN AMQAWLET+
Sbjct  241  HMVNLTAPDKVNNAMQAWLETS  262


> A0A0J0ZWP1 Ndr family protein [Acinetobacter baumannii MRSN 3527]
Length=263

 Score =  453 bits (1165),  Expect = 8e-165
 Identities = 221/262 (84%), Positives = 237/262 (90%), Gaps = 0/262 (0%)

Query  1    MISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHG  60
            M+SKTLQLSNNR AHYFEQGEGEPLVLIHGVGMQA AWYPQIEYFSKHYHVIS+DMPGHG
Sbjct  1    MMSKTLQLSNNRIAHYFEQGEGEPLVLIHGVGMQAAAWYPQIEYFSKHYHVISVDMPGHG  60

Query  61   QSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120
            QST L A+A+LQDFV+W IE I  LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN
Sbjct  61   QSTKLPAEAKLQDFVEWTIEFITALNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN  120

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            GVYKRT  AR AVIQRAE LK G +D+ETPLQRWFG+SE+E+IA+ +VK WLENV++SGY
Sbjct  121  GVYKRTPQARHAVIQRAEELKTGRIDVETPLQRWFGESEVERIAAAKVKTWLENVDLSGY  180

Query  181  TTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENER  240
            TTAY AFAQGD  YAD WS I CPALVLTGTDDPNSTAEM IQMA QAKHGTAIVIENER
Sbjct  181  TTAYSAFAQGDETYADDWSKITCPALVLTGTDDPNSTAEMAIQMAKQAKHGTAIVIENER  240

Query  241  HMVNLTAPEKVNQAMQAWLETT  262
            HMVNLTAP+KVN AMQAWLET+
Sbjct  241  HMVNLTAPDKVNNAMQAWLETS  262


> Q13KT2 3-oxoadipate enol-lactonase [Paraburkholderia xenovorans 
(strain LB400)]
Length=263

 Score = 76.3 bits (186),  Expect = 1e-19
 Identities = 67/244 (27%), Positives = 104/244 (43%), Gaps = 13/244 (5%)

Query  10   NNRTAHYFEQGEGEP----LVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQSTAL  65
            N    HY   GE       +VL + +G     W PQ+   SKH+ V+  D  GHG S A 
Sbjct  7    NGTELHYRIDGERHGNAPWIVLSNSLGTDLSMWAPQVAALSKHFRVLRYDTRGHGHSEAP  66

Query  66   AADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLNGVYKR  125
                 ++      +  + TL +   N  G SMG L    ++    D ++R+A+ N    R
Sbjct  67   KGPYTIEQLTGDVLGLMDTLKIARANFCGLSMGGLTGVALAARHADRIERVALCN-TAAR  125

Query  126  THAAREAVIQRAEALKQG-HLDIETPLQRWF--GQSEIEKIASERVKLWLENVNMSGYTT  182
              +    V +  +A  +G H   +  L RWF     E E +    ++    + +  GY +
Sbjct  126  IGSPEVWVPRAVKARTEGMHALADAVLPRWFTADYMEREPVVLAMIRDVFVHTDKEGYAS  185

Query  183  AYRAFAQGDL-VYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENERH  241
               A    DL   A G   I+ PALV++GT D  +T     ++A QA  G   V  +  H
Sbjct  186  NCEAIDAADLRPEAPG---IKVPALVISGTHDLAATPAQGRELA-QAIAGARYVELDASH  241

Query  242  MVNL  245
            + N+
Sbjct  242  ISNI  245


> B2DD14 Meta-cleavage compound hydrolase [Neptuniibacter sp. CAR-SF]
Length=282

 Score = 76.3 bits (186),  Expect = 2e-19
 Identities = 67/234 (29%), Positives = 105/234 (45%), Gaps = 41/234 (18%)

Query  16   YFEQGEGEPLVLIHGVGMQAEA---WYPQIEYFSKHYHVISLDMPGHGQS----TALAAD  68
            Y E G G+P++LIHG G  AE+   W   I Y +K Y VI++DM G G++       + D
Sbjct  29   YLEAGSGKPIILIHGGGAGAESEGNWKNVIPYLAKEYRVIAMDMIGFGKTDKPDLLYSQD  88

Query  69   AQLQDFVDWAIECIHTLNLG-PVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN--GVYKR  125
             +++  VD+    +  +     V+L G+SMG     GVSV R DLV  + ++   G+   
Sbjct  89   LRIKHLVDF----VEVMGFDQKVSLIGNSMGGATALGVSVERKDLVDSLVLMGSAGLVTE  144

Query  126  TH----------AAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENV  175
             H            R+ +I   +AL     +IE            EK+ + R     ++ 
Sbjct  145  LHDDLKPIVNYDFTRKGMINLIKALTNSSFEIE------------EKMVNTRFDFATDHE  192

Query  176  NMSGYTTAYRAFA-QGDLVYADGW-SDIECPALVLTGTDD---PNSTAEMTIQM  224
                Y    +    QG L Y D +   ++ P LV+ G DD   P STA   +++
Sbjct  193  TRKSYAATMQWIRDQGGLYYDDDYIRQLKIPTLVVQGKDDKVVPISTAYKFLEL  246


> K7QTC4 Esterase [Oenococcus oeni]
Length=256

 Score = 72.4 bits (176),  Expect = 3e-18
 Identities = 59/218 (27%), Positives = 101/218 (46%), Gaps = 13/218 (6%)

Query  2    ISKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQ  61
            + K L  S+     Y   G+G+ +++IHGV    E++   + Y ++ Y V   D+ GHG 
Sbjct  1    MEKKLTTSDGTKIAYDINGKGKTMLMIHGVTDCKESYDSDLSYLTEKYQVYRYDLRGHGN  60

Query  62   STALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLNG  121
            S        L+D ++  IE I  L L    L G S+GS I  G++V  P+ + ++ +LN 
Sbjct  61   SDHPKKQFDLEDHINDGIELIKQLKLEDFVLYGGSLGSYIAQGIAVRIPERINKL-ILN-  118

Query  122  VYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEI----EKIAS-ERVKLWLENVN  176
                  AA+      AE  K+  +  +T  +R +    +    + IAS E+  L    ++
Sbjct  119  ----VSAAKNPDSALAETAKKDSIPEKTSERREYCIKHLTHDPKNIASIEKSGLQKNTLD  174

Query  177  MSGYTTAYRAFAQGDLVYADGWSDIECPALVLTGTDDP  214
                  A ++    D  + D  +  +CPAL+ +G  DP
Sbjct  175  AEDEYRALKSITAFD--FRDQLNKTDCPALITSGIYDP  210


> Q2HWH9 Meta-cleavage compound hydrolase [Nocardioides aromaticivorans]
Length=279

 Score = 72.4 bits (176),  Expect = 4e-18
 Identities = 64/254 (25%), Positives = 110/254 (43%), Gaps = 10/254 (4%)

Query  16   YFEQGEGEPLVLIHGVGMQAEA---WYPQIEYFSKHYHVISLDMPGHGQSTALAADAQL-  71
            Y+E G GEPLVLIHG G  A+A   W     Y + H+ VI+ DM G GQS     D    
Sbjct  22   YWESGTGEPLVLIHGGGAGADARGNWSGCFPYLTPHFRVIAYDMVGFGQSVPDNPDFAFT  81

Query  72   -QDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN--GVYKRTHA  128
                +D     +  L L   +  G+SMG     G+++  P+ +  + ++   G+ ++  A
Sbjct  82   QPSRIDHLAAFLDALGLERASFVGNSMGGATALGLAMRNPERIATLTLMGSAGLTRQFSA  141

Query  129  AREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY-TTAYRAF  187
                ++   E    G   I   L     Q   E++   R +L  +N  M  Y  T     
Sbjct  142  ELSTMLDYTEPSLDGMRRIVGALTHPRYQPS-EELVQYRYQLTQDNRVMDAYRATMAWIR  200

Query  188  AQGDLVY-ADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENERHMVNLT  246
             QG L Y  +  + ++   LV++G +D     +++++      +     I +  H   L 
Sbjct  201  EQGGLFYPEEDIARVKSKTLVVSGREDQVVPLDLSVRFHQLLDNSRLCSIAHCGHWAMLE  260

Query  247  APEKVNQAMQAWLE  260
             P+K+  A+  +++
Sbjct  261  HPDKLASAVVGFID  274


> A5VAT9 Alpha/beta hydrolase fold [Sphingomonas wittichii (strain 
RW1 / DSM 6014 / JCM 10273)]
Length=277

 Score = 72.0 bits (175),  Expect = 5e-18
 Identities = 71/261 (27%), Positives = 106/261 (41%), Gaps = 16/261 (6%)

Query  3    SKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEA---WYPQIEYFSKHYHVISLDMPGH  59
            SK +     RT HY E GEG+PLVL+HG G  A+    +      F++H  VI+ DM G 
Sbjct  7    SKFIDCDGIRT-HYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGF  65

Query  60   GQSTA--LAADAQLQDF-VDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRM  116
            GQ+ A   A  A  Q    D  I  I  L L  + L G+SMG     G ++  P+L+ R+
Sbjct  66   GQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNSMGGTTACGAALKAPELIDRL  125

Query  117  AVLNGVYKRTH----AARE--AVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKL  170
             ++      +     A R+  A +   +  ++G   I   L   +     + I   R + 
Sbjct  126  VLMGAAVNISPDDMVANRDDLAAVMSYDGSEEGMRKIIAALTHSY--QPTDDIVHYRHEA  183

Query  171  WLENVNMSGYTTAYRAFAQGDLVYA-DGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAK  229
             L     + Y        Q  L Y+ +  + +  P LVL G +D        I       
Sbjct  184  SLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIP  243

Query  230  HGTAIVIENERHMVNLTAPEK  250
                 V  N  H V +  PE+
Sbjct  244  QAIGHVFPNCGHWVMIEYPEE  264


> A5J2A5 Meta-cleavage pathway hydrolase protein [Sphingomonas 
wittichii (strain RW1 / DSM 6014 / JCM 10273)]
Length=279

 Score = 71.2 bits (173),  Expect = 9e-18
 Identities = 73/263 (28%), Positives = 108/263 (41%), Gaps = 18/263 (7%)

Query  3    SKTLQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEA---WYPQIEYFSKHYHVISLDMPGH  59
            SK +     RT HY E GEG+PLVL+HG G  A+    +      F++H  VI+ DM G 
Sbjct  7    SKFIDCDGIRT-HYIEMGEGDPLVLVHGGGAGADGRSNFADNFPIFARHMRVIAYDMVGF  65

Query  60   GQSTA--LAADAQLQDF-VDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRM  116
            GQ+ A   A  A  Q    D  I  I  L L  + L G+SMG     G ++  P+L+ R+
Sbjct  66   GQTDAPDPAGFAYTQAARTDHLISFIKALGLSKICLIGNSMGGTTACGAALKAPELIDRL  125

Query  117  AVLNGVYKRTH----AARE--AVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKL  170
             ++      +     A R+  A +   +  ++G   I   L   +     + I   R + 
Sbjct  126  VLMGAAVNISPDDMVANRDDLAAVMSYDGSEEGMRKIIAALTHSY--QPTDDIVHYRHEA  183

Query  171  WLENVNMSGYTTAYRAFAQGDLVYA-DGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAK  229
             L     + Y        Q  L Y+ +  + +  P LVL G +D        I       
Sbjct  184  SLRPTTTAAYKATMGWAKQNGLYYSPEQLASLTMPVLVLGGKNDVMVPVRKVIDQILAIP  243

Query  230  HGTAI--VIENERHMVNLTAPEK  250
               AI  V  N  H V +  PE+
Sbjct  244  QAQAIGHVFPNCGHWVMIEYPEE  266


> O86901 Hydrolase [Sphingomonas sp]
Length=278

 Score = 70.9 bits (172),  Expect = 1e-17
 Identities = 48/116 (41%), Positives = 63/116 (54%), Gaps = 11/116 (9%)

Query  15   HYFEQGEGEPLVLIHGVGMQAEA---WYPQ-IEYFSKHYHVISLDMPGHGQSTA---LAA  67
            HY E GEG+PL+LIHG G  A+A   W    +   +K   VI+LDM G G S A      
Sbjct  17   HYIEMGEGKPLILIHGGGAGADARGNWEKLCMPLLAKDRRVIALDMVGFGYSDAPDPEGF  76

Query  68   DAQLQDFVDWAIECIHTLNL----GPVNLAGHSMGSLITTGVSVTRPDLVKRMAVL  119
            D  L+  VD  I  I  +NL    GPV++ G+SMG   T   ++ RPDLV  M ++
Sbjct  77   DYGLECRVDQLIAFIEAMNLVEATGPVDIIGNSMGGRTTLATAIRRPDLVGDMVLM  132


> E3W9G6 Putative hydrolase [Terrabacter sp. (strain DBF63)]
Length=280

 Score = 69.3 bits (168),  Expect = 5e-17
 Identities = 37/114 (32%), Positives = 61/114 (54%), Gaps = 5/114 (4%)

Query  9    SNNRTAHYFEQGEGEPLVLIHGVGMQAEAW---YPQIEYFSKHYHVISLDMPGHGQSTAL  65
            + N   HY+E GEG P+VL+HG G  A  W      IE  ++ +HV ++DMPG G+S A+
Sbjct  14   TKNWNIHYYEAGEGHPVVLLHGGGPGATGWSNYASNIEALAESFHVFAVDMPGWGESDAV  73

Query  66   AADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVL  119
            + D    D V+ A++ +  L +      G+SMG   +  ++  +P  V  +  +
Sbjct  74   SFDE--VDHVEAAVQFLDALGIEKAAFVGNSMGGHTSIRLAAEQPGRVSHLITM  125


> Q8VPF0 3-oxoadipate enol-lactone hydrolase [Pseudomonas knackmussii]
Length=262

 Score = 68.9 bits (167),  Expect = 5e-17
 Identities = 61/263 (23%), Positives = 109/263 (41%), Gaps = 13/263 (5%)

Query  5    TLQLSNNRTAHYFEQGEGEP-LVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQST  63
            T++L++    +  E   G P LVL + +G     W  Q+  F++H+ V+  D  GHG S 
Sbjct  3    TVKLADGELNYLLEGPAGAPVLVLSNSLGTDLHMWDAQVPAFTQHFQVLRYDTRGHGASL  62

Query  64   ALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLNGVY  123
                   ++      +  +  L++   +  G SMG LI   +++  P+ ++R+ + N   
Sbjct  63   VTEGPYSIEQNGRDVLALLDALDIAKASFCGLSMGGLIGQWLAINAPERIERLVLCNTAA  122

Query  124  KRTHAAREAVIQRAEALKQGHLD-----IETPLQRWFGQ--SEIEKIASERVKLWLENVN  176
            K      E    R + +  G L       +  + RWF    +  E    E +   L   +
Sbjct  123  K--IGTPEVWNPRIDTVLAGGLQPMRDLRDASISRWFTPDFAAAEPGKVEPIVAMLAQTS  180

Query  177  MSGYTTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVI  236
              GY     A    D  + +    I  P LV+ G+ DP +T E    M  +   G  +V 
Sbjct  181  PQGYAANCAAVRDAD--FREQLGAILAPTLVVCGSGDPVTTTEHGRFMQERIA-GAELVE  237

Query  237  ENERHMVNLTAPEKVNQAMQAWL  259
             +  H+ N+ A +  +Q +  +L
Sbjct  238  FHAAHLSNVQAGDAFSQKVLGFL  260


> A3FNW7 Esterase [uncultured organism]
Length=270

 Score = 68.2 bits (165),  Expect = 1e-16
 Identities = 59/269 (22%), Positives = 118/269 (44%), Gaps = 18/269 (7%)

Query  2    ISKTLQLSNNRTAHYFEQGEG--EPLVLIHGVGMQAEAWYPQIEYFS-KHYHVISLDMPG  58
            I   + +S +   HY E       P++L+HG+G     W+ Q E  S   + V++ D+ G
Sbjct  6    IMPAVDISEHVCIHYEEVNPAGSPPVLLLHGLGSAGADWFFQFEALSGAGFRVLAPDLRG  65

Query  59   HGQSTALAADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAV  118
             G+S+A      ++   D     +  LN  P ++ G SMG  +   +++  P+LV ++ +
Sbjct  66   FGRSSA-PPKITVKAMADDTAIFLKKLNAHPAHVVGISMGGTVALQLALDHPELVSKLVL  124

Query  119  LNGVYKRTHAAREAVIQRAEALKQGHL-----DIETPLQRWF---GQSEIEKIASERVKL  170
            +N   +    + + V+     L    L       E   +R F   GQ  +     +R+  
Sbjct  125  VNTFARLKFTSPKEVLYLLTRLLVASLMGPEKQAEMVARRVFPHPGQETLRNNLRQRIL-  183

Query  171  WLENVNMSGYTTAYRAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKH  230
               + N   Y +A ++  + D+ +     +++ P LV+TG +D     ++  +MA    +
Sbjct  184  ---HTNPYSYRSALQSLQKFDVSHR--LKELKMPVLVITGAEDTTVPPKVQEEMAKAIPN  238

Query  231  GTAIVIENERHMVNLTAPEKVNQAMQAWL  259
               +V+E   H +    P+  N+ +  +L
Sbjct  239  ARHVVVEGSGHGIIADNPQTFNRILIEFL  267



Lambda      K        H        a         alpha
   0.319    0.132    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1286376


  Database: f8eb2060ef99bac5fe2856014e47b427.TrEMBL.fasta
    Posted date:  Oct 1, 2020  6:28 AM
  Number of letters in database: 7,197
  Number of sequences in database:  27



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40