ACIAD2545 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 1ad091e7b532a2fa5074b989cfe27eaf.SwissProt.fasta
           13 sequences; 3,873 total letters



Query= ACIAD2545

Length=264
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P00632 3-oxoadipate enol-lactonase 2 [Acinetobacter baylyi (str...  76.6    5e-20
  Q59695 Dihydrolipoyllysine-residue acetyltransferase component ...  76.6    2e-19
  D4GEU7 Putative aminoacrylate hydrolase RutD [Pantoea ananatis ...  73.6    7e-19
  O32234 AB hydrolase superfamily protein YvaM [Bacillus subtilis...  69.7    1e-17
  B9JLT6 Putative aminoacrylate hydrolase RutD [Agrobacterium rad...  69.3    2e-17
  Q59093 3-oxoadipate enol-lactonase 1 [Acinetobacter baylyi (str...  68.6    4e-17
  Q9AQM4 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid ...  66.2    4e-16
  Q6AX59 Protein ABHD8 [Xenopus laevis]                               61.2    3e-14
  Q988D4 2-(acetamidomethylene)succinate hydrolase [Mesorhizobium...  60.5    4e-14
  Q5QZC0 Pimeloyl-[acyl-carrier protein] methyl ester esterase [I...  59.7    5e-14
  O31168 Non-heme chloroperoxidase [Kitasatospora aureofaciens]       58.5    2e-13
  P29715 Non-haem bromoperoxidase BPO-A2 [Kitasatospora aureofaci...  58.2    2e-13
  P27747 Dihydrolipoyllysine-residue acetyltransferase component ...  58.2    3e-13


> P00632 3-oxoadipate enol-lactonase 2 [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=267

 Score = 76.6 bits (187),  Expect = 5e-20
 Identities = 64/245 (26%), Positives = 100/245 (41%), Gaps = 9/245 (4%)

Query  17   FEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQSTALAADAQLQDFVD  76
            F Q +   L+  + +G     W  QI YF   Y VI  D  GHG S+      ++     
Sbjct  22   FGQADRPALIFSNSLGTNLSMWQQQIAYFQDKYFVICYDTRGHGASSTPVGPYRIDQLGT  81

Query  77   WAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLNGVYKRTHAAREAVIQR  136
              I  +  L +      G SMG L    +++  P+   ++ V N   K   A  +A   R
Sbjct  82   DVIALLDHLQIPQATFCGISMGGLTGQWLAIHFPERFNQVIVANTAAKIGEA--QAWQAR  139

Query  137  AEALKQGHLD--IETPLQRWFGQSEIEKIAS--ERVKLWLENVNMSGYTTAYRAFAQGDL  192
            A+ +++  L    +T   RWF    IE      E++   L   +  GY +   A A+ D+
Sbjct  140  AQLVREQGLTPIAQTAATRWFTPGFIEDSPEIVEKLSHDLAQGSAEGYASCCEALAEADV  199

Query  193  VYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENERHMVNLTAPEKVN  252
                    I  P LV+ G  DP +T      +     H T  V+E   H+ N+  P+  N
Sbjct  200  --RPQLQRISIPVLVIAGAQDPVTTVADGQFLCEHIVHSTLEVLE-ASHISNVEQPQAFN  256

Query  253  QAMQA  257
             A++A
Sbjct  257  HAVEA  261


> Q59695 Dihydrolipoyllysine-residue acetyltransferase component 
of acetoin cleaving system [Pseudomonas putida]
Length=370

 Score = 76.6 bits (187),  Expect = 2e-19
 Identities = 72/264 (27%), Positives = 112/264 (42%), Gaps = 33/264 (13%)

Query  12   RTAHYFEQGE--GEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQSTALAADA  69
            R   +FE G   G PLVL+HG G     W       +    VI+LD+PGHG+S       
Sbjct  121  RLLRWFELGGEGGTPLVLVHGFGGDLNNWLFNHPALAAERRVIALDLPGHGESAKALQRG  180

Query  70   QLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAV---------LN  120
             L +  +  +  +  L++   +LAGHSMG  ++  V+   P  V  +++         +N
Sbjct  181  DLDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVAGLAPQRVASLSLIASAGLGEAIN  240

Query  121  GVYKRTHAAREAVIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY  180
            G Y +   A         ALK   + +       F    +  +  + ++  L+   + G 
Sbjct  241  GQYLQGFVA----AANRNALKPQMVQL-------FADPAL--VTRQMLEDMLKFKRLEGV  287

Query  181  TTAYR----AFAQGDLVYADGWSDI-ECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIV  235
              A R    A A GD    D  S + + PALV+ G  D    A +    A +      +V
Sbjct  288  DEALRQLALAIADGDRQRHDLRSVLGQHPALVVWGGKD----AIIPASHARKGPEAEVLV  343

Query  236  IENERHMVNLTAPEKVNQAMQAWL  259
            +    HMV + A E+VNQ M A+L
Sbjct  344  LPEAGHMVQMEAAEQVNQQMLAFL  367


> D4GEU7 Putative aminoacrylate hydrolase RutD [Pantoea ananatis 
(strain LMG 20103)]
Length=275

 Score = 73.6 bits (179),  Expect = 7e-19
 Identities = 58/250 (23%), Positives = 102/250 (41%), Gaps = 9/250 (4%)

Query  18   EQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQST-ALAADAQLQDFVD  76
            +  + E +VL  G+G     W PQ+   S H+ V+  D  G G S  ++ A  +++D  D
Sbjct  9    QNADAETVVLSSGLGGSGGFWQPQLAMLSAHFRVVVYDQYGTGASQGSVPAGYRMEDMAD  68

Query  77   WAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLNGVYKRTHAAREAVIQR  136
                 ++ LN+   +L GH++G ++   +++  P L++ + V+NG        R     R
Sbjct  69   ELAGLLNALNISRCHLVGHALGGIMGLHLALRYPALLQSLVVINGWTVLNSQTRRCFDVR  128

Query  137  AEALKQGHLDIETPLQRWF-----GQSEIEKIASERVKLWLENV-NMSGYTTAYRAFAQG  190
               L    +D     Q  F       SE E    E  +  + N   M       +A    
Sbjct  129  RNLLLNSGVDAYVQAQPLFLYPGDWLSEHEAFLQEERQHQVANFQGMENLLHRLQALMDS  188

Query  191  DLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENERHMVNLTAPEK  250
            DL        +  P L L+  DD       +  +A +  HG  + +    H +++T P+ 
Sbjct  189  DL--TTSLKGVIAPTLALSAKDDLLVPWSCSADLASRLPHGEHLQMGYGGHAMSVTDPDT  246

Query  251  VNQAMQAWLE  260
             N  +  WL+
Sbjct  247  FNPILLDWLQ  256


> O32234 AB hydrolase superfamily protein YvaM [Bacillus subtilis 
(strain 168)]
Length=256

 Score = 69.7 bits (169),  Expect = 1e-17
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 2/122 (2%)

Query  6    LQLSNNRTAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQSTAL  65
            + + + +   Y E G+G P++ IH  GM  + +Y Q    SKH+ VI  D+ GHG S  +
Sbjct  4    ISIDSRKHLFYEEYGQGIPIIFIHPPGMGRKVFYYQ-RLLSKHFRVIFPDLSGHGDSDHI  62

Query  66   AADAQLQDFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLNGVYKR  125
               A +  + +   + +  L++    L G+S G LI   +  TRPD V  + +L+G Y  
Sbjct  63   DQPASISYYANEIAQFMDALHIDKAVLFGYSAGGLIAQHIGFTRPDKVSHL-ILSGAYPA  121

Query  126  TH  127
             H
Sbjct  122  VH  123


> B9JLT6 Putative aminoacrylate hydrolase RutD [Agrobacterium radiobacter 
(strain K84 / ATCC BAA-868)]
Length=262

 Score = 69.3 bits (168),  Expect = 2e-17
 Identities = 57/255 (22%), Positives = 107/255 (42%), Gaps = 15/255 (6%)

Query  15   HYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQSTALAAD-AQLQD  73
            H  ++ + + ++L  G+G     W PQIE  +  + +++ D  G G++     D   +  
Sbjct  6    HGLDRPDAKTIILSSGLGGSGSYWAPQIEALATDFRIVTYDHRGTGRTGGDVPDTGGISA  65

Query  74   FVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLNGVYKRTHAAREAV  133
              D  +E    L L   +  GH++G LI   +++ RP+L+ ++ ++N   K    +    
Sbjct  66   MADDVLEIAARLQLDRFDFMGHALGGLIGLDIALRRPELIGKLILINAWSKADPHSGRCF  125

Query  134  IQRAEALKQGHLDIETPLQR-------WFGQSEIEKIASER--VKLWLENVNMSGYTTAY  184
              R E L++  ++     Q        W  ++     A ER  V  +    N+     A 
Sbjct  126  DIRIELLERSGVEAFVKAQPLFLYPAVWMSENAERMAADERHGVAHFQGKANVLKRIAAL  185

Query  185  RAFAQGDLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENERHMVN  244
            RAF   D +     S+I  P LV+   DD       ++++A         + +   H VN
Sbjct  186  RAFDIDDRL-----SEIRTPTLVVGTRDDLLVPYTRSVRLAEGLSAAELALSDFGAHAVN  240

Query  245  LTAPEKVNQAMQAWL  259
            +  PE+ N  +  +L
Sbjct  241  VVEPEEFNNKVLRFL  255


> Q59093 3-oxoadipate enol-lactonase 1 [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=266

 Score = 68.6 bits (166),  Expect = 4e-17
 Identities = 58/242 (24%), Positives = 105/242 (43%), Gaps = 12/242 (5%)

Query  25   LVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQSTALAADAQLQDFVDWAIECIHT  84
            +V  + +G     W PQ+      Y V++ D  GHGQS  +  +  LQ+  +  ++ +  
Sbjct  30   IVFSNSLGTDHGMWQPQVAALKSQYRVVTYDTRGHGQSDVI-ENTTLQNLGEDVLDILDA  88

Query  85   LNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLNGVYKRTHAAREAVIQRAEALKQGH  144
            LN+   +  G SMG L    + + +      + V N   K      +    RAEA++   
Sbjct  89   LNIEKAHFCGISMGGLTALWLGIYQAARFYSITVANSAAKIW--TEDGWNARAEAVEANG  146

Query  145  LD--IETPLQRWFGQS---EIEKIASERVKLWLENVNMSGYTTAYRAFAQGDLVYADGWS  199
            L   + +   RWF      + + +A + ++  L +    GY  A RA A+ D+   +  +
Sbjct  147  LADLVASTHTRWFSDKFDYKNDNLAQKTIQS-LADTPAQGYANACRALAKADV--REKLA  203

Query  200  DIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENERHMVNLTAPEKVNQAMQAWL  259
             I  P L++ G+ DP +T      M    +     VI+   H+ N+  PEK  Q    ++
Sbjct  204  SISIPTLIIAGSADPVTTITDGEFMQQHIQCNQFEVID-ASHLSNIEQPEKFIQIFSGFV  262

Query  260  ET  261
            ++
Sbjct  263  KS  264


> Q9AQM4 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid 
hydrolase [Pseudomonas resinovorans]
Length=290

 Score = 66.2 bits (160),  Expect = 4e-16
 Identities = 63/264 (24%), Positives = 104/264 (39%), Gaps = 34/264 (13%)

Query  16   YFEQGEGEPLVLIHGVGMQAEA---WYPQIEYFSKHYHVISLDMPGHGQSTALAADAQLQ  72
            Y E G+G+P++LIHG G  AE+   W   I   ++HY VI++DM G G++     +    
Sbjct  30   YLEAGKGQPVILIHGGGAGAESEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQD  89

Query  73   DFVDWAIECIHTLNL-GPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLN--GVYKRTHA-  128
              +    + I  +N  G V++ G+SMG     GVSV   +LV  + ++   G+    H  
Sbjct  90   RRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEIHED  149

Query  129  ---------AREAVIQRAEALKQGHLDIETPL---QRWFGQSEIEKIASERVKLWLENVN  176
                      RE ++   +AL      I+  +   +  +   E  + A      W+    
Sbjct  150  LRPIINYDFTREGMVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIRE--  207

Query  177  MSGYTTAYRAFAQGDLVYADGW-SDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIV  235
                        QG L Y   +   +  P LV+ G DD     E   +           +
Sbjct  208  ------------QGGLFYDPEFIRKVPVPTLVVHGKDDKVVPVETAYKFLDLIDDSWGYI  255

Query  236  IENERHMVNLTAPEKVNQAMQAWL  259
            I +  H   +  PE    A  ++L
Sbjct  256  IPHCGHWAMIEHPEDFANATLSFL  279


> Q6AX59 Protein ABHD8 [Xenopus laevis]
Length=424

 Score = 61.2 bits (147),  Expect = 3e-14
 Identities = 67/249 (27%), Positives = 108/249 (43%), Gaps = 16/249 (6%)

Query  25   LVLIHGVGMQAEAWYPQIEYFSK-HYHVISLDMPGHGQSTALAADAQLQDF-VDWAIECI  82
            L  IHGVG   + W  Q+++FSK  Y V++ D+ GHG STA    A    + +   + CI
Sbjct  169  LFFIHGVGGSLDIWKEQLDFFSKLGYEVVAPDLVGHGASTAPQIGAAYTFYALAEDMRCI  228

Query  83   HTLNLGPVN-LAGHSMGSLITTGVSVTRPDLVKRMAVLNGVYKRTHAAREAVIQRAEALK  141
                    N L GHS G    T ++   PDLV ++ ++NG       A E  +     + 
Sbjct  229  FKRYAKKRNILVGHSYGVSFCTFLAHEYPDLVHKVVMING---GGPTALEPSLCSIFNMP  285

Query  142  QGHLDIETPLQRW-FGQSEIEKIASERVKLWLEN--VNMSGYT----TAYRAFAQGDLVY  194
               L   +P   W F ++   +  ++  +L  E    N+S +      + + + +GD VY
Sbjct  286  TCVLHCLSPCLAWSFLKAGFARQGAKEKQLLREGNAFNVSSFVLRAMMSGQYWPEGDEVY  345

Query  195  ADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIENERHMVNLTAPEKVNQA  254
                +++  P L++ G  D     +   +MA         +IE   HMV L  PE VN  
Sbjct  346  ---HAELTVPILLVHGMHDKFVPLDEDQRMAEILLITFLKIIEEGSHMVMLECPETVNTL  402

Query  255  MQAWLETTP  263
            +  +    P
Sbjct  403  LHEFFLWQP  411


> Q988D4 2-(acetamidomethylene)succinate hydrolase [Mesorhizobium 
japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)]
Length=278

 Score = 60.5 bits (145),  Expect = 4e-14
 Identities = 61/263 (23%), Positives = 108/263 (41%), Gaps = 23/263 (9%)

Query  13   TAHYFEQGEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQSTALAADAQLQ  72
            T +  E+G G  ++  HG+   +  + P +   S  +  I++D  GHG S       +  
Sbjct  23   TLNVREKGSGPLMLFFHGITSNSAVFEPLMIRLSDRFTTIAVDQRGHGLSDKPETGYEAN  82

Query  73   DFVDWAIECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLNGVYKRTHAAREA  132
            D+ D     I TL  G   L GHS+G+  +   +   PDLV+ +  ++        A +A
Sbjct  83   DYADDIAGLIRTLARGHAILVGHSLGARNSVTAAAKYPDLVRSVVAIDFTPYIETEALDA  142

Query  133  VIQRAEALKQGHLDIETPLQRWFGQSEIEKIASERVKLWLENVNMSGY------------  180
            +  R  A  Q   DI+       G+     I ++ +++  E    SGY            
Sbjct  143  LEARVNAGSQLFEDIKAVEAYLAGR--YPNIPADAIRIRAE----SGYQPVDGGLRPLAS  196

Query  181  TTAYRAFAQG---DLVYADGWSDIECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIVIE  237
            + A    A+G   DLV A  + D+  P L++ G      +A    + +        +V+ 
Sbjct  197  SAAMAQTARGLRSDLVPA--YRDVTKPVLIVRGESSKLVSAAALAKTSRLRPDLPVVVVP  254

Query  238  NERHMVNLTAPEKVNQAMQAWLE  260
               H VN  +PE   +A+  +++
Sbjct  255  GADHYVNEVSPEITLKAITNFID  277


> Q5QZC0 Pimeloyl-[acyl-carrier protein] methyl ester esterase 
[Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)]
Length=255

 Score = 59.7 bits (143),  Expect = 5e-14
 Identities = 30/101 (30%), Positives = 53/101 (52%), Gaps = 5/101 (5%)

Query  20   GEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQST-ALAADAQLQDFVDWA  78
            G G P+V++HG GM +  W P +   S+H+ +  +D+PG G S  +   D  L+ F++  
Sbjct  9    GTGTPIVVLHGWGMNSNIWQPVVPALSEHFQLYCVDLPGFGDSVWSSENDVSLESFIEQI  68

Query  79   IECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVL  119
            +  +        +L G S+G LI T +++T  D V  +  +
Sbjct  69   MPALPP----RFHLLGWSLGGLIATQIALTHSDRVMSLTTV  105


> O31168 Non-heme chloroperoxidase [Kitasatospora aureofaciens]
Length=278

 Score = 58.5 bits (140),  Expect = 2e-13
 Identities = 70/263 (27%), Positives = 104/263 (40%), Gaps = 21/263 (8%)

Query  15   HYFEQGEGEPLVLIHGVGMQAEAWYPQ-IEYFSKHYHVISLDMPGHGQSTALAADAQLQD  73
            +Y + G G+P+VLIHG  +   +W  Q        Y VI+ D  G GQS+          
Sbjct  17   YYEDHGAGQPVVLIHGFPLSGHSWERQSAALLDAGYRVITYDRRGFGQSSQPTTGYDYDT  76

Query  74   FVDWAIECIHTLNLGPVNLAGHSMG----SLITTGVSVTRPDLVKRMAVLNGVYKRTH--  127
            F       + TL+L    L G SMG    +   +     R   V  +A L     +T   
Sbjct  77   FAADLNTVLETLDLQDAVLVGFSMGTGEVARYVSSYGTARIAKVAFLASLEPFLLKTDDN  136

Query  128  ----AAREAVIQRAEALKQGHLDIETPLQRWF---GQSEIEKIASERVKLWLENVNMSGY  180
                A +E       A+K       T     F    ++   +I+ E V+         G+
Sbjct  137  PDGAAPKEFFDGIVAAVKADRYAFYTGFFNDFYNLDENLGTRISEEAVRNSWNTAASGGF  196

Query  181  TTAYRAFAQGDLVYADGWSD---IECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIV-I  236
               + A A     Y D  +D   I+ PAL+L GT D     E T ++ H+A      V +
Sbjct  197  ---FAAAAAPTTWYTDFRADIPRIDVPALILHGTGDRTLPIENTARVFHKALPSAEYVEV  253

Query  237  ENERHMVNLTAPEKVNQAMQAWL  259
            E   H +  T  E+VN A+ A+L
Sbjct  254  EGAPHGLLWTHAEEVNTALLAFL  276


> P29715 Non-haem bromoperoxidase BPO-A2 [Kitasatospora aureofaciens]
Length=278

 Score = 58.2 bits (139),  Expect = 2e-13
 Identities = 70/263 (27%), Positives = 104/263 (40%), Gaps = 21/263 (8%)

Query  15   HYFEQGEGEPLVLIHGVGMQAEAWYPQ-IEYFSKHYHVISLDMPGHGQSTALAADAQLQD  73
            +Y + G G+P+VLIHG  +   +W  Q        Y VI+ D  G GQS+          
Sbjct  17   YYEDHGTGQPVVLIHGFPLSGHSWERQSAALLDAGYRVITYDRRGFGQSSQPTTGYDYDT  76

Query  74   FVDWAIECIHTLNLGPVNLAGHSMG----SLITTGVSVTRPDLVKRMAVLNGVYKRTH--  127
            F       + TL+L    L G SMG    +   +     R   V  +A L     +T   
Sbjct  77   FAADLNTVLETLDLQDAVLVGFSMGTGEVARYVSSYGTARIAKVAFLASLEPFLLKTDDN  136

Query  128  ----AAREAVIQRAEALKQGHLDIETPLQRWF---GQSEIEKIASERVKLWLENVNMSGY  180
                A +E       A+K       T     F    ++   +I+ E V+         G+
Sbjct  137  PDGAAPQEFFDGIVAAVKADRYAFYTGFFNDFYNLDENLGTRISEEAVRNSWNTAASGGF  196

Query  181  TTAYRAFAQGDLVYADGWSD---IECPALVLTGTDDPNSTAEMTIQMAHQAKHGTAIV-I  236
               + A A     Y D  +D   I+ PAL+L GT D     E T ++ H+A      V +
Sbjct  197  ---FAAAAAPTTWYTDFRADIPRIDVPALILHGTGDRTLPIENTARVFHKALPSAEYVEV  253

Query  237  ENERHMVNLTAPEKVNQAMQAWL  259
            E   H +  T  E+VN A+ A+L
Sbjct  254  EGAPHGLLWTHAEEVNTALLAFL  276


> P27747 Dihydrolipoyllysine-residue acetyltransferase component 
of acetoin cleaving system [Cupriavidus necator (strain ATCC 
17699 / H16 / DSM 428 / Stanier 337)]
Length=374

 Score = 58.2 bits (139),  Expect = 3e-13
 Identities = 29/103 (28%), Positives = 51/103 (50%), Gaps = 0/103 (0%)

Query  20   GEGEPLVLIHGVGMQAEAWYPQIEYFSKHYHVISLDMPGHGQSTALAADAQLQDFVDWAI  79
            G  E ++ IHG G   + W   ++  +  Y V++LD+PGHGQS+   A   L     +  
Sbjct  133  GGAETVLFIHGFGGDLDNWLFNLDPLADAYTVVALDLPGHGQSSPRLAGTTLAQMAGFVA  192

Query  80   ECIHTLNLGPVNLAGHSMGSLITTGVSVTRPDLVKRMAVLNGV  122
              +    +   ++ GHSMG  +   ++V  P  V  +A+++ V
Sbjct  193  RFMDETGIEAAHVVGHSMGGGVAAQLAVDAPQRVLSVALVSPV  235


 Score = 16.9 bits (32),  Expect = 6.5
 Identities = 6/12 (50%), Positives = 9/12 (75%), Gaps = 0/12 (0%)

Query  64  ALAADAQLQDFV  75
           A  +DAQ+ D+V
Sbjct  86  AEVSDAQIDDYV  97



Lambda      K        H        a         alpha
   0.319    0.132    0.400    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 732394


  Database: 1ad091e7b532a2fa5074b989cfe27eaf.SwissProt.fasta
    Posted date:  Oct 1, 2020  6:21 AM
  Number of letters in database: 3,873
  Number of sequences in database:  13



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40