ACIAD2507 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 13e3e0726b723a1014b2189f3d3acb70.TrEMBL.fasta
           16 sequences; 5,742 total letters



Query= ACIAD2507

Length=392
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A0A0M1I8R5 PqqA peptide cyclase [Acinetobacter sp. C15]              653    0.0   
  N9BRX5 PqqA peptide cyclase [Acinetobacter soli NIPH 2899]           653    0.0   
  A0A1P8EFB8 PqqA peptide cyclase [Acinetobacter soli]                 652    0.0   
  E0LV24 PqqA peptide cyclase [Pantoea sp. aB]                         514    0.0   
  A0A246NET8 PqqA peptide cyclase [Pantoea sp. VS1]                    514    0.0   
  A0A1I4YD27 PqqA peptide cyclase [Pantoea sp. OV426]                  514    0.0   
  D4P6Z8 PqqA peptide cyclase [Pantoea ananas]                         508    0.0   
  C3VIT8 PqqA peptide cyclase [Rahnella aquatilis]                     489    7e-175
  A0A0K1YUT9 PqqA peptide cyclase [Pseudomonas fluorescens]            483    2e-172
  W5XUQ5 PqqA peptide cyclase [Pseudomonas kilonensis]                 483    2e-172
  Q32X71 PqqA peptide cyclase [Pseudomonas fluorescens]                483    4e-172
  A0A0K1YUW8 PqqA peptide cyclase [Pseudomonas fluorescens]            479    2e-171
  S6CQB6 PqqA peptide cyclase [Serratia marcescens]                    451    2e-160
  O54018 PqqE protein [Paracoccus denitrificans]                       115    9e-34 
  Q43985 Pqq III protein [Acinetobacter calcoaceticus]                90.9    1e-25 
  Q8KKF4 MoaA / nifB / pqqE family [Bacillus licheniformis]           96.7    2e-25 


> A0A0M1I8R5 PqqA peptide cyclase [Acinetobacter sp. C15]
Length=385

 Score =  653 bits (1685),  Expect = 0.0
 Identities = 317/384 (83%), Positives = 341/384 (89%), Gaps = 0/384 (0%)

Query  6    MNIPVSLQSKPPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGS  65
            MNIPV  Q KPPLWLLAELTYRCPLQCAYCSNPLDYAAVK ELST +WK VF QARA+GS
Sbjct  1    MNIPVVPQIKPPLWLLAELTYRCPLQCAYCSNPLDYAAVKNELSTAQWKQVFDQARALGS  60

Query  66   VQLGFSGGEPLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQ  125
            VQLGFSGGEPLLR DL ELI++AH LGFYTNLITSGIGLTE KIA FSEAGLDHIQISFQ
Sbjct  61   VQLGFSGGEPLLRPDLPELIQHAHRLGFYTNLITSGIGLTEDKIAAFSEAGLDHIQISFQ  120

Query  126  ASDPALSEILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNA  185
            ASDP LSE+LSGSRKAF+QKQ +A AVKKHRYPMVLNFVIHRFNIEQIDQ+IELSLEL A
Sbjct  121  ASDPVLSELLSGSRKAFEQKQQIARAVKKHRYPMVLNFVIHRFNIEQIDQMIELSLELGA  180

Query  186  DYVELATCQFYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQ  245
            DYVELATCQFYGWAKLNQAALLPT  QI+Y Q+RV+AYR  IDQ  LKTKL+LVAPD++Q
Sbjct  181  DYVELATCQFYGWAKLNQAALLPTSTQIAYVQSRVKAYRAQIDQQGLKTKLMLVAPDFHQ  240

Query  246  ERPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGT  305
             RPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPL+FP + DQSLKTIWNEAFAFNAFRGT
Sbjct  241  TRPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLDFPNVADQSLKTIWNEAFAFNAFRGT  300

Query  306  DWMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPD  365
            DWMQEPCRSCPDK+KDLGGCRCQAYM+T+NMYATDPVCSKSP HHQI  AR      +P 
Sbjct  301  DWMQEPCRSCPDKEKDLGGCRCQAYMMTQNMYATDPVCSKSPEHHQIEAARADADEQQPT  360

Query  366  ISDLKLRNPQNSKLFFKRASDADS  389
              DL LRN +NSKLFFK  + +D+
Sbjct  361  TQDLVLRNSRNSKLFFKTVNLSDT  384


> N9BRX5 PqqA peptide cyclase [Acinetobacter soli NIPH 2899]
Length=385

 Score =  653 bits (1685),  Expect = 0.0
 Identities = 317/384 (83%), Positives = 341/384 (89%), Gaps = 0/384 (0%)

Query  6    MNIPVSLQSKPPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGS  65
            MNIPV  Q KPPLWLLAELTYRCPLQCAYCSNPLDYAAVK ELST +WK VF QARA+GS
Sbjct  1    MNIPVVPQIKPPLWLLAELTYRCPLQCAYCSNPLDYAAVKNELSTAQWKQVFDQARALGS  60

Query  66   VQLGFSGGEPLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQ  125
            VQLGFSGGEPLLR DL ELI++AH LGFYTNLITSGIGLTE KIA FSEAGLDHIQISFQ
Sbjct  61   VQLGFSGGEPLLRPDLPELIQHAHRLGFYTNLITSGIGLTEDKIAAFSEAGLDHIQISFQ  120

Query  126  ASDPALSEILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNA  185
            ASDP LSE+LSGSRKAF+QKQ +A AVKKHRYPMVLNFVIHRFNIEQIDQ+IELSLEL A
Sbjct  121  ASDPVLSELLSGSRKAFEQKQQIARAVKKHRYPMVLNFVIHRFNIEQIDQMIELSLELGA  180

Query  186  DYVELATCQFYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQ  245
            DYVELATCQFYGWAKLNQAALLPT  QI+Y Q+RV+AYR  IDQ  LKTKL+LVAPD++Q
Sbjct  181  DYVELATCQFYGWAKLNQAALLPTSTQIAYVQSRVKAYRAQIDQQGLKTKLMLVAPDFHQ  240

Query  246  ERPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGT  305
             RPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPL+FP + DQSLKTIWNEAFAFNAFRGT
Sbjct  241  TRPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLDFPNVADQSLKTIWNEAFAFNAFRGT  300

Query  306  DWMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPD  365
            DWMQEPCRSCPDK+KDLGGCRCQAYM+T+NMYATDPVCSKSP HHQI  AR      +P 
Sbjct  301  DWMQEPCRSCPDKEKDLGGCRCQAYMMTQNMYATDPVCSKSPEHHQIEAARADADEQQPT  360

Query  366  ISDLKLRNPQNSKLFFKRASDADS  389
              DL LRN +NSKLFFK  + +D+
Sbjct  361  TQDLVLRNSRNSKLFFKTVNLSDT  384


> A0A1P8EFB8 PqqA peptide cyclase [Acinetobacter soli]
Length=385

 Score =  652 bits (1681),  Expect = 0.0
 Identities = 316/384 (82%), Positives = 342/384 (89%), Gaps = 0/384 (0%)

Query  6    MNIPVSLQSKPPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGS  65
            MNIPV  Q KPPLWLLAELTYRCPLQCAYCSNPLDYAAVK ELST +WK VF QARA+GS
Sbjct  1    MNIPVVPQIKPPLWLLAELTYRCPLQCAYCSNPLDYAAVKNELSTAQWKQVFDQARALGS  60

Query  66   VQLGFSGGEPLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQ  125
            VQLGFSGGEPLLR DL ELI++AH+LGFYTNLITSGIGLTE KIA FSEAGLDHIQISFQ
Sbjct  61   VQLGFSGGEPLLRPDLPELIQHAHQLGFYTNLITSGIGLTEDKIAAFSEAGLDHIQISFQ  120

Query  126  ASDPALSEILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNA  185
            ASDP LSE+LSGSRKAF+QKQ +A AVKKHRYPMVLNFVIHRFNIEQIDQ+IELSLEL A
Sbjct  121  ASDPVLSELLSGSRKAFEQKQQIARAVKKHRYPMVLNFVIHRFNIEQIDQMIELSLELGA  180

Query  186  DYVELATCQFYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQ  245
            DYVELATCQFYGWAKLNQAALLPT  QI+Y Q+RV+AYR  IDQ  LKTKL+LVAPD++Q
Sbjct  181  DYVELATCQFYGWAKLNQAALLPTSTQIAYVQSRVKAYRAQIDQQGLKTKLMLVAPDFHQ  240

Query  246  ERPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGT  305
             RPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPL+FP + DQSLKTIWNEAFAFNAFRGT
Sbjct  241  TRPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLDFPNVADQSLKTIWNEAFAFNAFRGT  300

Query  306  DWMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPD  365
            DWMQEPCRSCPDK+KDLGGCRCQAYM+T+NMYATDPVCSKSP H+QI  AR      +P 
Sbjct  301  DWMQEPCRSCPDKEKDLGGCRCQAYMMTQNMYATDPVCSKSPEHYQIEAARADADEQQPT  360

Query  366  ISDLKLRNPQNSKLFFKRASDADS  389
              DL LRN +NSKLFFK  + +D+
Sbjct  361  TQDLVLRNSRNSKLFFKTVNLSDT  384


> E0LV24 PqqA peptide cyclase [Pantoea sp. aB]
Length=380

 Score =  514 bits (1325),  Expect = 0.0
 Identities = 246/367 (67%), Positives = 294/367 (80%), Gaps = 0/367 (0%)

Query  16   PPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEP  75
            PPLWLLAELTYRCPLQC YCSNPLD+A  ++EL+T++W +VFRQARAMGSVQLGFSGGEP
Sbjct  10   PPLWLLAELTYRCPLQCPYCSNPLDFAQQEKELTTEQWIEVFRQARAMGSVQLGFSGGEP  69

Query  76   LLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEIL  135
            L+R+DL ELIK A +LGFYTNLITSGIGLTE+K+  FSEAGLDHIQISFQASD  L+  L
Sbjct  70   LVRKDLPELIKAARDLGFYTNLITSGIGLTEKKLDAFSEAGLDHIQISFQASDETLNAAL  129

Query  136  SGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQF  195
            +GS+KAFQQK  MA AVK H YPMVLNFV+HR NI+QID+II+L +EL AD VELATCQF
Sbjct  130  AGSKKAFQQKLEMAKAVKAHGYPMVLNFVLHRHNIDQIDKIIDLCIELEADDVELATCQF  189

Query  196  YGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGW  255
            YGWA+LN+  LLPT EQI+ A+A V+ YR+ +      T LL V PDYY+ERPK C+GGW
Sbjct  190  YGWAQLNREGLLPTREQIARAEAVVKTYRERMSTTGNLTNLLFVTPDYYEERPKPCMGGW  249

Query  256  GQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSC  315
            G IF++V+P+GT LPC SA+ LP+EFP++  QSL  IW  +F FN +RG DWM EPCRSC
Sbjct  250  GAIFLSVTPEGTALPCHSARQLPVEFPSVLTQSLDDIWYNSFGFNRYRGFDWMPEPCRSC  309

Query  316  PDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQ  375
             +K+KD GGCRCQA+MLT N   TDPVCSKSP H +I+EAR +  CS   I  L+ RN  
Sbjct  310  DEKEKDFGGCRCQAFMLTGNADNTDPVCSKSPHHGKILEARREADCSDIKIGQLQFRNRS  369

Query  376  NSKLFFK  382
            NS+L +K
Sbjct  370  NSQLIYK  376


> A0A246NET8 PqqA peptide cyclase [Pantoea sp. VS1]
Length=380

 Score =  514 bits (1324),  Expect = 0.0
 Identities = 245/367 (67%), Positives = 296/367 (81%), Gaps = 0/367 (0%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEPL  76
            PLWLLAELTYRCPLQC YCSNPLD++  +QELST++W +VFRQARAMGSVQLGFSGGEPL
Sbjct  11   PLWLLAELTYRCPLQCPYCSNPLDFSRQEQELSTEQWIEVFRQARAMGSVQLGFSGGEPL  70

Query  77   LRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEILS  136
             R+DL ELI+ A +LGFYTNLITSGIGLTE+K+  F++AGLDHIQISFQASD  L+  L+
Sbjct  71   TRKDLPELIRAARDLGFYTNLITSGIGLTEKKLDAFADAGLDHIQISFQASDETLNAALA  130

Query  137  GSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQFY  196
            GS+KAFQQK AMA AVKKH YPMVLNFV+HR NI+QID+II+L +EL AD VELATCQFY
Sbjct  131  GSQKAFQQKLAMAKAVKKHGYPMVLNFVLHRHNIDQIDKIIDLCIELEADDVELATCQFY  190

Query  197  GWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGWG  256
            GWA LN+  LLPT EQI+ A+A V  YR+ +      T LL V PDYY+ERPK C+GGWG
Sbjct  191  GWAHLNRQGLLPTREQIARAEAVVARYRERMGSSGNLTNLLFVTPDYYEERPKPCMGGWG  250

Query  257  QIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSCP  316
             IF++V+P+GT LPC SA+ LP++FP++ +QSL+ IW  +F FN +RG DWM EPCRSC 
Sbjct  251  SIFLSVTPEGTALPCHSARQLPVQFPSVLEQSLEDIWYNSFGFNRYRGFDWMPEPCRSCD  310

Query  317  DKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQN  376
            +K+KD GGCRCQAYMLT +   TDPVCSKSP H +I+EAR +  CS   I+ L+ RN  N
Sbjct  311  EKEKDFGGCRCQAYMLTGDADNTDPVCSKSPHHGKILEARREASCSDIKIAQLQFRNRSN  370

Query  377  SKLFFKR  383
            S+L FK+
Sbjct  371  SELIFKQ  377


> A0A1I4YD27 PqqA peptide cyclase [Pantoea sp. OV426]
Length=380

 Score =  514 bits (1323),  Expect = 0.0
 Identities = 246/367 (67%), Positives = 293/367 (80%), Gaps = 0/367 (0%)

Query  16   PPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEP  75
            PPLWLLAELTYRCPLQC YCSNPLD+A  ++EL+T +W +VFRQARAMGSVQLGFSGGEP
Sbjct  10   PPLWLLAELTYRCPLQCPYCSNPLDFAQQEKELTTGQWIEVFRQARAMGSVQLGFSGGEP  69

Query  76   LLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEIL  135
            L+R+DL ELIK A +LGFYTNLITSGIGLTE+K+  FSEAGLDHIQISFQASD  L+  L
Sbjct  70   LVRKDLPELIKAARDLGFYTNLITSGIGLTEKKLDAFSEAGLDHIQISFQASDETLNAAL  129

Query  136  SGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQF  195
            +GS+KAFQQK  MA AVK H YPMVLNFV+HR NI+QID+II+L +EL AD VELATCQF
Sbjct  130  AGSKKAFQQKLEMAKAVKAHGYPMVLNFVLHRHNIDQIDKIIDLCIELEADDVELATCQF  189

Query  196  YGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGW  255
            YGWA+LN+  LLPT EQI+ A+A V+ YR+ +      T LL V PDYY+ERPK C+GGW
Sbjct  190  YGWAQLNREGLLPTREQIARAEAVVKTYRERMSTTGNLTNLLFVTPDYYEERPKPCMGGW  249

Query  256  GQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSC  315
            G IF++V+P+GT LPC SA+ LP+EFP++  QSL  IW  +F FN +RG DWM EPCRSC
Sbjct  250  GAIFLSVTPEGTALPCHSARQLPVEFPSVLTQSLDDIWYNSFGFNRYRGFDWMPEPCRSC  309

Query  316  PDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQ  375
             +K+KD GGCRCQAYMLT N   TDPVCSKSP H +I++AR +  CS   I  L+ RN  
Sbjct  310  DEKEKDFGGCRCQAYMLTGNADNTDPVCSKSPHHGKILDARREADCSDIKIGQLQFRNRS  369

Query  376  NSKLFFK  382
            NS+L +K
Sbjct  370  NSQLIYK  376


> D4P6Z8 PqqA peptide cyclase [Pantoea ananas]
Length=433

 Score =  508 bits (1309),  Expect = 0.0
 Identities = 242/367 (66%), Positives = 290/367 (79%), Gaps = 0/367 (0%)

Query  16   PPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEP  75
            PPLWLLAELTYRCPLQC YCSNPLD+A  ++ELST++W DVFRQARAMGSVQLGFSGGEP
Sbjct  63   PPLWLLAELTYRCPLQCPYCSNPLDFAQQEKELSTEQWIDVFRQARAMGSVQLGFSGGEP  122

Query  76   LLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEIL  135
            L R+DL +LIK A +LGFYTNLITSGIGLTE+K+  FS+AGLDHIQISFQASD  L+  L
Sbjct  123  LTRKDLPDLIKAARDLGFYTNLITSGIGLTEKKLEAFSDAGLDHIQISFQASDETLNAAL  182

Query  136  SGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQF  195
            +GS+KAFQQK  MA AVK H YPMVLNFV+HR NI+QID+II+L +EL AD VELATCQF
Sbjct  183  AGSKKAFQQKLEMARAVKAHGYPMVLNFVLHRHNIDQIDKIIDLCIELEADDVELATCQF  242

Query  196  YGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGW  255
            YGWA+LN+  LLPT EQI+ A+  V  YR  +      T LL V PDYY+ERPK C+GGW
Sbjct  243  YGWAQLNREGLLPTREQIARAEGIVNQYRARMSDSGSLTNLLFVTPDYYEERPKPCMGGW  302

Query  256  GQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSC  315
            G IF++V+PDGT LPC SA+ LP+ FP++ +QSL+ IW  +F FN +RG DWM EPCRSC
Sbjct  303  GAIFLSVTPDGTALPCHSARQLPVAFPSVLEQSLEDIWYHSFGFNRYRGYDWMPEPCRSC  362

Query  316  PDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQ  375
             +K+KD GGCRCQA+MLT +    DPVCSKSP H +I++AR +  CS   I  L+ RN  
Sbjct  363  DEKEKDFGGCRCQAFMLTGDADNADPVCSKSPHHGKILDARREADCSDIKIGQLQFRNRS  422

Query  376  NSKLFFK  382
            NS+L +K
Sbjct  423  NSQLIYK  429


> C3VIT8 PqqA peptide cyclase [Rahnella aquatilis]
Length=396

 Score =  489 bits (1258),  Expect = 7e-175
 Identities = 234/368 (64%), Positives = 286/368 (78%), Gaps = 0/368 (0%)

Query  15   KPPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGE  74
            KPPLWLLAELTYRCPLQC YCSNPLD+A   +EL+T +W  VF +AR MG+VQ+GFSGGE
Sbjct  28   KPPLWLLAELTYRCPLQCPYCSNPLDFAKQDKELTTAQWIKVFEEAREMGAVQIGFSGGE  87

Query  75   PLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEI  134
            PL+R+DL ELI+ A +LGFYTNLITSGIGLTE+KI  F+EAGLDHIQISFQASD  L+  
Sbjct  88   PLVRKDLPELIRAARDLGFYTNLITSGIGLTEKKIDAFAEAGLDHIQISFQASDETLNAA  147

Query  135  LSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQ  194
            L+G+ KAF+QK  MA AVK H YPMVLNFV+HR NI+QID+II+LS+EL AD VELATCQ
Sbjct  148  LAGNAKAFRQKLEMAKAVKAHGYPMVLNFVLHRHNIDQIDKIIDLSIELEADDVELATCQ  207

Query  195  FYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGG  254
            FYGWA+LN+  LLPT EQI+ A+  V  YR+ +        LL V PDYY+ERPK C+GG
Sbjct  208  FYGWAQLNREGLLPTREQIARAENVVHQYREKMAGTGNLANLLFVTPDYYEERPKGCMGG  267

Query  255  WGQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRS  314
            WG IF++V+P+G  LPC SA+ LP+EFP++ + +L+ IW ++F FN +RG DWM EPCRS
Sbjct  268  WGAIFLSVTPEGMALPCHSARQLPVEFPSVLENTLQEIWYDSFGFNKYRGFDWMPEPCRS  327

Query  315  CPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNP  374
            C +K+KD GGCRCQA+MLT N    DPVCSKS  H +IV AR Q  C+   I+ L+ RN 
Sbjct  328  CSEKEKDFGGCRCQAFMLTGNADNADPVCSKSEHHGKIVAAREQANCTNIQINQLQFRNR  387

Query  375  QNSKLFFK  382
             NS+L FK
Sbjct  388  ANSQLIFK  395


> A0A0K1YUT9 PqqA peptide cyclase [Pseudomonas fluorescens]
Length=393

 Score =  483 bits (1242),  Expect = 2e-172
 Identities = 227/366 (62%), Positives = 281/366 (77%), Gaps = 0/366 (0%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEPL  76
            PLWLLAELTYRCPLQC YCSNPLD+A   +ELST++W  VFR+AR MG+ QLGFSGGEPL
Sbjct  27   PLWLLAELTYRCPLQCPYCSNPLDFAEQGKELSTEQWIKVFREAREMGAAQLGFSGGEPL  86

Query  77   LRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEILS  136
            +RQDL+ELI  A +LGFYTNLITSGIGLTEQKI++F +AGLDHIQISFQASD  ++ +L+
Sbjct  87   VRQDLAELIAEARKLGFYTNLITSGIGLTEQKISDFKKAGLDHIQISFQASDEQVNNLLA  146

Query  137  GSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQFY  196
            GS+KAF QK  MA AVK H YPMVLNFV HR NI++ID+IIEL + L AD+VELATCQFY
Sbjct  147  GSKKAFAQKLEMARAVKAHGYPMVLNFVTHRHNIDKIDRIIELCIALEADFVELATCQFY  206

Query  197  GWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGWG  256
            GWA+LN+  LLPT EQ+  A+     YR  ++      KL+ V PDYY+ERPK C+ GWG
Sbjct  207  GWAQLNRVGLLPTQEQLVRAERITNEYRAKLEAEGHPCKLIFVTPDYYEERPKACMNGWG  266

Query  257  QIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSCP  316
             IF+TV+PDGT LPC  A+ +P++FP ++D S++ IW ++F FN FRG DWM EPCRSC 
Sbjct  267  SIFLTVTPDGTALPCHGARQMPVQFPNVRDHSMQHIWYDSFGFNRFRGYDWMPEPCRSCD  326

Query  317  DKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQN  376
            +K+KD GGCRCQA+MLT +    DPVCSKS  H  I++AR + + +   I  L  RN +N
Sbjct  327  EKEKDFGGCRCQAFMLTGDASNADPVCSKSEQHGIILQAREEAEHATQTIEQLAFRNERN  386

Query  377  SKLFFK  382
            S+L  K
Sbjct  387  SRLIAK  392


> W5XUQ5 PqqA peptide cyclase [Pseudomonas kilonensis]
Length=419

 Score =  483 bits (1244),  Expect = 2e-172
 Identities = 233/388 (60%), Positives = 288/388 (74%), Gaps = 6/388 (2%)

Query  1    VDLLAMNIP--VSLQSKP----PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWK  54
            V  +  N+P    L  KP    PLWLLAELTYRCPLQC YCSNPLD+A   +ELST++W 
Sbjct  31   VHSIGSNLPETAGLPPKPEVGLPLWLLAELTYRCPLQCPYCSNPLDFAEQGKELSTEQWF  90

Query  55   DVFRQARAMGSVQLGFSGGEPLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSE  114
             VFR+AR MG+ QLGFSGGEPL+RQDL+ELI  A +LGFYTNLITSGIGLTEQKI++F +
Sbjct  91   KVFREAREMGAAQLGFSGGEPLVRQDLAELIGEARKLGFYTNLITSGIGLTEQKISDFKK  150

Query  115  AGLDHIQISFQASDPALSEILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQID  174
            AGLDHIQISFQASD  ++ +L+GS+KAF QK  MA AVK H YPMVLNFV HR NI++ID
Sbjct  151  AGLDHIQISFQASDEQVNNLLAGSKKAFAQKLEMARAVKAHGYPMVLNFVTHRHNIDKID  210

Query  175  QIIELSLELNADYVELATCQFYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKT  234
            +IIEL + L AD+VELATCQFYGWA+LN+  LLPT EQ+  A+     YR  ++      
Sbjct  211  RIIELCIALEADFVELATCQFYGWAQLNRVGLLPTKEQLVRAERVTNEYRARLEAEGHPC  270

Query  235  KLLLVAPDYYQERPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWN  294
            KL+ V PDYY+ERPK C+ GWG IF+TV+PDGT LPC  A+ +P++FP ++D S++ IW 
Sbjct  271  KLIFVTPDYYEERPKACMNGWGSIFLTVTPDGTALPCHGARQMPVQFPNVRDHSMQHIWY  330

Query  295  EAFAFNAFRGTDWMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVE  354
            ++F FN FRG DWM EPCRSC +K+KD GGCRCQA+MLT +    DPVCSKS  H  I++
Sbjct  331  DSFGFNRFRGYDWMPEPCRSCDEKEKDFGGCRCQAFMLTGDASNADPVCSKSEHHGMILQ  390

Query  355  ARLQTQCSKPDISDLKLRNPQNSKLFFK  382
            AR   + +   I  L  RN +NS+L  K
Sbjct  391  AREDAEHATQTIEQLAFRNERNSRLIAK  418


> Q32X71 PqqA peptide cyclase [Pseudomonas fluorescens]
Length=425

 Score =  483 bits (1243),  Expect = 4e-172
 Identities = 233/384 (61%), Positives = 289/384 (75%), Gaps = 8/384 (2%)

Query  7    NIPVS----LQSKP----PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFR  58
            N+P S    L +KP    PLWLLAELTYRCPLQC YCSNPLD+A   +EL+T++W  VFR
Sbjct  41   NLPESASGKLPAKPEIGLPLWLLAELTYRCPLQCPYCSNPLDFAEQGKELTTEQWIKVFR  100

Query  59   QARAMGSVQLGFSGGEPLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLD  118
            +AR MG+ QLGFSGGEPL+RQDL+ELI  A +LGFYTNLITSGIGLTEQKI++F +AGLD
Sbjct  101  EAREMGAAQLGFSGGEPLVRQDLAELIAEARKLGFYTNLITSGIGLTEQKISDFKKAGLD  160

Query  119  HIQISFQASDPALSEILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIE  178
            HIQISFQASD  ++ +L+GS+KAF QK  MA AVK H YPMVLNFV HR NI++ID+IIE
Sbjct  161  HIQISFQASDEQVNNLLAGSKKAFAQKLEMARAVKAHGYPMVLNFVTHRHNIDKIDRIIE  220

Query  179  LSLELNADYVELATCQFYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLL  238
            L + L AD+VELATCQFYGWA+LN+  LLPT EQ+  A+     YR  ++      KL+ 
Sbjct  221  LCIALEADFVELATCQFYGWAQLNRVGLLPTKEQLVRAERITNEYRAKLEAEGHPCKLIF  280

Query  239  VAPDYYQERPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFA  298
            V PDYY+ERPK C+ GWG IF+TV+PDGT LPC  A+ LP++FP ++D S++ IW ++F 
Sbjct  281  VTPDYYEERPKACMNGWGSIFLTVTPDGTALPCHGARQLPVQFPNVRDHSMQHIWYDSFG  340

Query  299  FNAFRGTDWMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQ  358
            FN FRG DWM EPCRSC +K+KD GGCRCQA+MLT +    DPVCSKS  H  I++AR +
Sbjct  341  FNRFRGYDWMPEPCRSCDEKEKDFGGCRCQAFMLTGDASNADPVCSKSEHHGVILKAREE  400

Query  359  TQCSKPDISDLKLRNPQNSKLFFK  382
             + +   I  L  RN +NS+L  K
Sbjct  401  AEHATQTIEQLAFRNERNSRLIAK  424


> A0A0K1YUW8 PqqA peptide cyclase [Pseudomonas fluorescens]
Length=383

 Score =  479 bits (1234),  Expect = 2e-171
 Identities = 226/366 (62%), Positives = 279/366 (76%), Gaps = 0/366 (0%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEPL  76
            PLWLLAELTYRCPLQC YCSNPLD+A   +EL+T++W  VFR+AR MG+ QLGFSGGEPL
Sbjct  17   PLWLLAELTYRCPLQCPYCSNPLDFAEQGKELTTEQWFKVFREAREMGAAQLGFSGGEPL  76

Query  77   LRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEILS  136
            +RQDL+ELI  A +LGFYTNLITSGIGLTEQKI+ F +AGLDHIQISFQASD  ++ +L+
Sbjct  77   VRQDLAELIAEARKLGFYTNLITSGIGLTEQKISAFKKAGLDHIQISFQASDEQVNNLLA  136

Query  137  GSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQFY  196
            GS+KAF QK  MA AVK H YPMVLNFV HR NI++ID+IIEL + L AD+VELATCQFY
Sbjct  137  GSKKAFAQKLEMARAVKAHGYPMVLNFVTHRHNIDKIDRIIELCIALEADFVELATCQFY  196

Query  197  GWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGWG  256
            GWA+LN+  LLPT EQ+  A+     YR  ++      KL+ V PDYY+ERPK C+ GWG
Sbjct  197  GWAQLNRVGLLPTQEQLVRAERITNEYRAKLEAEGHPCKLIFVTPDYYEERPKACMNGWG  256

Query  257  QIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSCP  316
             IF+TV+PDGT LPC  A+ +P++FP ++D S++ IW ++F FN FRG DWM EPCRSC 
Sbjct  257  SIFLTVTPDGTALPCHGARQMPVQFPNVRDHSMQHIWYDSFGFNRFRGYDWMPEPCRSCD  316

Query  317  DKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQN  376
            +K+KD GGCRCQA+MLT +    DPVCSKS  H  I++AR   + +   I  L  RN +N
Sbjct  317  EKEKDFGGCRCQAFMLTGDASNADPVCSKSEQHGIILQAREDAEHATQTIEQLAFRNERN  376

Query  377  SKLFFK  382
            S+L  K
Sbjct  377  SRLIAK  382


> S6CQB6 PqqA peptide cyclase [Serratia marcescens]
Length=375

 Score =  451 bits (1160),  Expect = 2e-160
 Identities = 224/364 (62%), Positives = 273/364 (75%), Gaps = 3/364 (1%)

Query  16   PPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEP  75
            PPLWLLAELTYRCPLQC YCSNPLDY   ++EL+T +W +VF QARAMGSVQLGFSGGEP
Sbjct  11   PPLWLLAELTYRCPLQCPYCSNPLDYWPQEKELTTAQWIEVFGQARAMGSVQLGFSGGEP  70

Query  76   LLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEIL  135
            L+R+DL ELI  A ELGFYTNLITSGIGLTE+K+  F++AGLDHIQISFQASD  L+  L
Sbjct  71   LVRKDLPELIAAARELGFYTNLITSGIGLTEKKLHTFADAGLDHIQISFQASDETLNAAL  130

Query  136  SGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQF  195
            +GS KAF  K AMA AVK   YPMVLNFV+HR NI QID+IIEL++ L+AD VELATCQF
Sbjct  131  AGSAKAFHHKLAMARAVKALGYPMVLNFVLHRHNIGQIDRIIELAIHLDADDVELATCQF  190

Query  196  YGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGW  255
            YGWA LN+  LLPT EQI+ A+A V+ YR+ +        LL V PDYY+ERPK C+GGW
Sbjct  191  YGWAHLNREGLLPTREQIADAEAVVKRYRERMANDGKLANLLFVTPDYYEERPKGCMGGW  250

Query  256  GQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSC  315
            G IF++V+P+G  LPC SA+ LP+ FP++ +  L+ IW  +F FN +RG DWM EPCRSC
Sbjct  251  G-IFMSVTPEGMALPCHSARQLPISFPSVLEHDLQHIWYHSFGFNRYRGYDWMPEPCRSC  309

Query  316  PDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQ  375
             +K++D GGCRCQA+MLT +    DP  ++   H  I+ AR     S+  I  L+ RN  
Sbjct  310  SEKEQDYGGCRCQAFMLTGDADNADPAANRH--HGTILAAREAANRSQIGIDQLRFRNQT  367

Query  376  NSKL  379
            NS+L
Sbjct  368  NSRL  371


> O54018 PqqE protein [Paracoccus denitrificans]
Length=150

 Score =  115 bits (288),  Expect = 9e-34
 Identities = 61/132 (46%), Positives = 75/132 (57%), Gaps = 7/132 (5%)

Query  239  VAPDYYQERPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLEFP--TIQDQSLKTIWNEA  296
            V  D+    PK C+GGWG   + V+PDGTVLPC +A+         T     L  IW++ 
Sbjct  9    VPADHLAAFPKSCMGGWGSTGLNVAPDGTVLPCHAAQSHQGAGVRGTCARCRLARIWHDG  68

Query  297  FAFNAFRGTDWMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEAR  356
             AFNAFRGT WM EPC SC  ++ D GGCRCQA  L  +  ATDPVCS+S +H     AR
Sbjct  69   RAFNAFRGTGWMPEPCASCERREIDFGGCRCQAMALAGDARATDPVCSRSGLH-----AR  123

Query  357  LQTQCSKPDISD  368
            L+        SD
Sbjct  124  LRAAAEAEAASD  135


> Q43985 Pqq III protein [Acinetobacter calcoaceticus]
Length=88

 Score = 90.9 bits (224),  Expect = 1e-25
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 1/72 (1%)

Query  307  WMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDI  366
            WM E CRSCPDKD+D GGCRCQAYMLT +    DPVC KSP H  I +AR ++  + P +
Sbjct  2    WMPEGCRSCPDKDRDFGGCRCQAYMLTGDAANADPVCGKSPYHQMIEQARTESHVAAP-L  60

Query  367  SDLKLRNPQNSK  378
              L  RN +NSK
Sbjct  61   QQLVFRNSRNSK  72


> Q8KKF4 MoaA / nifB / pqqE family [Bacillus licheniformis]
Length=385

 Score = 96.7 bits (239),  Expect = 2e-25
 Identities = 88/360 (24%), Positives = 148/360 (41%), Gaps = 31/360 (9%)

Query  15   KPPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGE  74
            K P  ++ ELT  C L+C +C          +EL+  E KD+  Q  AM +  L  +GG+
Sbjct  8    KSPFIVIWELTRACELKCLHCRASAQNKRDPRELTLKEGKDLIDQIHAMDNPLLVLTGGD  67

Query  75   PLLRQDLSELIKYAHELGFYTNLITSGI-GLTEQKIAEFSEAGLDHIQISFQASDPALSE  133
            PL+R D+  +I+YA + G   ++  S    +T + I    E GL     S       + +
Sbjct  68   PLMRDDVFAIIEYAVQKGVRVSMTPSATPNVTREAIQSAKEIGLSRWAFSLDGPTREIHD  127

Query  134  ILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELN----ADYVE  189
               G+  +F         + +   P+ +N VI  +NI+ +D++ +L  ELN    + +  
Sbjct  128  HFRGTDGSFDLTMKAIRYIHECHLPLQINTVISAYNIDYLDEMAKLIEELNCVLWSVFFL  187

Query  190  LATCQFYGWAKLNQA---------ALLPTPEQISYAQARVQAYRQYIDQHHLKT----KL  236
            + T +  G   ++           + L             Q YR+ + Q  ++      +
Sbjct  188  VPTGRANGXDMISPVDHEKVFLWLSRLAKEAPFDIKTTAAQHYRRVVIQQKMREAKDPNM  247

Query  237  LLVAPDYYQERPKKCIGGWGQI---------FITVSPDGTVLPCQSAKDLPLEFPTIQDQ  287
             +      Q+     IGG G+          F+ +S  G V P      LP +   I++Q
Sbjct  248  KIRYEHALQKGKMDAIGGLGRAPKGVNDGNGFMFISHIGDVYPSGL---LPFKAGNIREQ  304

Query  288  SLKTIWNEAFAFNAFRGTDWMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSP  347
             L  I+ E+  F   R  D  +  C  C  +    GG R +AY LT +   +DP C   P
Sbjct  305  PLAEIYRESPIFKDLRNPDGFKGKCGVCEFRHV-CGGSRSRAYALTGDYLESDPSCIYIP  363



Lambda      K        H        a         alpha
   0.322    0.136    0.416    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1700594


  Database: 13e3e0726b723a1014b2189f3d3acb70.TrEMBL.fasta
    Posted date:  Sep 24, 2020  3:46 AM
  Number of letters in database: 5,742
  Number of sequences in database:  16



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40