ACIAD2507 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 66eef9893c469f8448bd2de9e07555d3.SwissProt.fasta
           19 sequences; 7,252 total letters



Query= ACIAD2507

Length=392
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F9I9 PqqA peptide cyclase [Acinetobacter baylyi (strain ATCC ...   789    0.0   
  B5XX58 PqqA peptide cyclase [Klebsiella pneumoniae (strain 342)]     505    0.0   
  P27507 PqqA peptide cyclase [Klebsiella pneumoniae]                  503    1e-180
  A6T9H2 PqqA peptide cyclase [Klebsiella pneumoniae subsp. pneum...   501    5e-180
  B2VL10 PqqA peptide cyclase [Erwinia tasmaniensis (strain DSM 1...   489    5e-175
  Q4K4U8 PqqA peptide cyclase [Pseudomonas fluorescens (strain AT...   486    6e-174
  B7H2Y0 PqqA peptide cyclase [Acinetobacter baumannii (strain AB...   486    7e-174
  B7I6M8 PqqA peptide cyclase [Acinetobacter baumannii (strain AB...   486    7e-174
  B0V494 PqqA peptide cyclase [Acinetobacter baumannii (strain AYE)]   486    7e-174
  P07782 PqqA peptide cyclase [Acinetobacter calcoaceticus]            483    2e-172
  O33506 PqqA peptide cyclase [Rahnella aquatilis]                     482    2e-172
  B0VQD7 PqqA peptide cyclase [Acinetobacter baumannii (strain SDF)]   481    4e-172
  Q01060 PqqA peptide cyclase [Pseudescherichia vulneris]              480    1e-171
  P59748 PqqA peptide cyclase [Kluyvera intermedia]                    441    2e-156
  Q9L3B0 PqqA peptide cyclase [Gluconobacter oxydans (strain 621H)]    328    3e-112
  P59749 PqqA peptide cyclase [Streptomyces rochei]                    313    1e-106
  P71517 PqqA peptide cyclase [Methylorubrum extorquens (strain A...   302    8e-102
  P9WJ79 Putative mycofactocin radical SAM maturase MftC [Mycobac...  82.4    2e-20 
  O31423 Sporulation killing factor maturation protein SkfB [Baci...  70.9    2e-16 


> Q6F9I9 PqqA peptide cyclase [Acinetobacter baylyi (strain ATCC 
33305 / BD413 / ADP1)]
Length=386

 Score =  789 bits (2038),  Expect = 0.0
 Identities = 386/386 (100%), Positives = 386/386 (100%), Gaps = 0/386 (0%)

Query  6    MNIPVSLQSKPPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGS  65
            MNIPVSLQSKPPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGS
Sbjct  1    MNIPVSLQSKPPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGS  60

Query  66   VQLGFSGGEPLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQ  125
            VQLGFSGGEPLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQ
Sbjct  61   VQLGFSGGEPLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQ  120

Query  126  ASDPALSEILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNA  185
            ASDPALSEILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNA
Sbjct  121  ASDPALSEILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNA  180

Query  186  DYVELATCQFYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQ  245
            DYVELATCQFYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQ
Sbjct  181  DYVELATCQFYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQ  240

Query  246  ERPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGT  305
            ERPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGT
Sbjct  241  ERPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGT  300

Query  306  DWMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPD  365
            DWMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPD
Sbjct  301  DWMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPD  360

Query  366  ISDLKLRNPQNSKLFFKRASDADSLL  391
            ISDLKLRNPQNSKLFFKRASDADSLL
Sbjct  361  ISDLKLRNPQNSKLFFKRASDADSLL  386


> B5XX58 PqqA peptide cyclase [Klebsiella pneumoniae (strain 342)]
Length=380

 Score =  505 bits (1301),  Expect = 0.0
 Identities = 241/367 (66%), Positives = 292/367 (80%), Gaps = 0/367 (0%)

Query  16   PPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEP  75
            PPLWLLAELTYRCPLQC YCSNPLD+A  ++EL+T++W +VFRQARAMGSVQLGFSGGEP
Sbjct  10   PPLWLLAELTYRCPLQCPYCSNPLDFARQEKELTTEQWIEVFRQARAMGSVQLGFSGGEP  69

Query  76   LLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEIL  135
            L R+DL ELI+ A +LGFYTNLITSGIGLTE K+  FSEAGLDHIQISFQASD  L+  L
Sbjct  70   LTRKDLPELIRAARDLGFYTNLITSGIGLTESKLDAFSEAGLDHIQISFQASDEVLNAAL  129

Query  136  SGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQF  195
            +G++KAFQQK AMA AVK   YPMVLNFV+HR NI+Q+D+IIEL +EL AD VELATCQF
Sbjct  130  AGNKKAFQQKLAMARAVKARDYPMVLNFVLHRHNIDQLDKIIELCIELEADDVELATCQF  189

Query  196  YGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGW  255
            YGWA LN+  LLPT EQI+ A+  V  YRQ +      T LL V PDYY+ERPK C+GGW
Sbjct  190  YGWAFLNREGLLPTREQIARAEQVVADYRQKMAASGNLTNLLFVTPDYYEERPKGCMGGW  249

Query  256  GQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSC  315
            G IF++V+P+GT LPC SA+ LP+ FP++ +QSL++IW ++F FN +RG DWM EPCRSC
Sbjct  250  GSIFLSVTPEGTALPCHSARQLPVAFPSVLEQSLESIWYDSFGFNRYRGYDWMPEPCRSC  309

Query  316  PDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQ  375
             +K+KD GGCRCQA+MLT +    DPVCSKSP HH+I+EAR +  CS   +S L+ RN  
Sbjct  310  DEKEKDFGGCRCQAFMLTGSADNADPVCSKSPHHHKILEARREAACSDIKVSQLQFRNRT  369

Query  376  NSKLFFK  382
             S+L +K
Sbjct  370  RSQLIYK  376


> P27507 PqqA peptide cyclase [Klebsiella pneumoniae]
Length=380

 Score =  503 bits (1295),  Expect = 1e-180
 Identities = 240/367 (65%), Positives = 291/367 (79%), Gaps = 0/367 (0%)

Query  16   PPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEP  75
            PPLWLLAELTYRCPLQC YCSNPLD+A   +EL+T++W +VFRQARAMGSVQLGFSGGEP
Sbjct  10   PPLWLLAELTYRCPLQCPYCSNPLDFARQDKELTTEQWIEVFRQARAMGSVQLGFSGGEP  69

Query  76   LLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEIL  135
            L R+DL ELI+ A +LGFYTNLITSGIGLTE K+  FSEAGLDHIQISFQASD  L+  L
Sbjct  70   LTRKDLPELIRAARDLGFYTNLITSGIGLTESKLDAFSEAGLDHIQISFQASDEVLNAAL  129

Query  136  SGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQF  195
            +G++KAFQQK AMA AVK   YPMVLNFV+HR NI+Q+D+IIEL +EL AD VELATCQF
Sbjct  130  AGNKKAFQQKLAMAKAVKARDYPMVLNFVLHRHNIDQLDKIIELCIELEADDVELATCQF  189

Query  196  YGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGW  255
            YGWA LN+  LLPT EQI+ A+  V  YRQ +      T LL V PDYY+ERPK C+GGW
Sbjct  190  YGWAFLNREGLLPTREQIARAEQVVADYRQKMAASGNLTNLLFVTPDYYEERPKGCMGGW  249

Query  256  GQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSC  315
            G IF++V+P+GT LPC SA+ LP+ FP++ +QSL++IW ++F FN +RG DWM EPCRSC
Sbjct  250  GSIFLSVTPEGTALPCHSARQLPVAFPSVLEQSLESIWYDSFGFNRYRGYDWMPEPCRSC  309

Query  316  PDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQ  375
             +K+KD GGCRCQA+MLT +    DPVCSKSP HH+I+EAR +  CS   +S L+ RN  
Sbjct  310  DEKEKDFGGCRCQAFMLTGSADNADPVCSKSPHHHKILEARREAACSDIKVSQLQFRNRT  369

Query  376  NSKLFFK  382
             S+L ++
Sbjct  370  RSQLIYQ  376


> A6T9H2 PqqA peptide cyclase [Klebsiella pneumoniae subsp. pneumoniae 
(strain ATCC 700721 / MGH 78578)]
Length=380

 Score =  501 bits (1291),  Expect = 5e-180
 Identities = 239/367 (65%), Positives = 290/367 (79%), Gaps = 0/367 (0%)

Query  16   PPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEP  75
            PPLWLLAELTYRCPLQC YCSNPLD+A   +EL+T++W +VFRQARAMGSVQLGFSGGEP
Sbjct  10   PPLWLLAELTYRCPLQCPYCSNPLDFARQDKELTTEQWIEVFRQARAMGSVQLGFSGGEP  69

Query  76   LLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEIL  135
            L R+DL ELI+ A +LGFYTNLITSGIGLTE K+  FSEAGLDHIQISFQASD  L+  L
Sbjct  70   LTRKDLPELIRAARDLGFYTNLITSGIGLTESKLDAFSEAGLDHIQISFQASDEVLNAAL  129

Query  136  SGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQF  195
            +G++KAFQQK  MA AVK   YPMVLNFV+HR NI+Q+D+IIEL +EL AD VELATCQF
Sbjct  130  AGNKKAFQQKLTMAKAVKARDYPMVLNFVLHRHNIDQLDKIIELCIELEADDVELATCQF  189

Query  196  YGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGW  255
            YGWA LN+  LLPT EQI+ A+  V  YRQ +      T LL V PDYY+ERPK C+GGW
Sbjct  190  YGWAFLNREGLLPTREQIARAEQVVADYRQKMAASGNLTNLLFVTPDYYEERPKGCMGGW  249

Query  256  GQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSC  315
            G IF++V+P+GT LPC SA+ LP+ FP++ +QSL++IW ++F FN +RG DWM EPCRSC
Sbjct  250  GSIFLSVTPEGTALPCHSARQLPVAFPSVLEQSLESIWYDSFGFNRYRGYDWMPEPCRSC  309

Query  316  PDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQ  375
             +K+KD GGCRCQA+MLT +    DPVCSKSP HH+I+EAR +  CS   +S L+ RN  
Sbjct  310  DEKEKDFGGCRCQAFMLTGSADNADPVCSKSPHHHKILEARREAACSDIKVSQLQFRNRT  369

Query  376  NSKLFFK  382
             S+L ++
Sbjct  370  RSQLIYQ  376


> B2VL10 PqqA peptide cyclase [Erwinia tasmaniensis (strain DSM 
17950 / CIP 109463 / Et1/99)]
Length=382

 Score =  489 bits (1258),  Expect = 5e-175
 Identities = 233/370 (63%), Positives = 285/370 (77%), Gaps = 0/370 (0%)

Query  9    PVSLQSKPPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQL  68
            P     KPPLWLLAELTYRCPLQC YCSNPLD+A  ++ELST +W +VF+QARAMG+VQ+
Sbjct  3    PSESNVKPPLWLLAELTYRCPLQCPYCSNPLDFAQQEKELSTAQWIEVFKQARAMGAVQI  62

Query  69   GFSGGEPLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASD  128
            GFSGGEPL+R+DL ELI+ A ELGFYTNLITSGIGLT++KI  F+EAGLDHIQISFQASD
Sbjct  63   GFSGGEPLVRKDLPELIRSARELGFYTNLITSGIGLTQKKIDAFAEAGLDHIQISFQASD  122

Query  129  PALSEILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYV  188
              L+  L+GS+KAFQQK  MA AVK H YPMVLNFV+HR NI+Q+D+IIEL +EL AD V
Sbjct  123  ETLNAALAGSQKAFQQKLEMARAVKAHGYPMVLNFVLHRHNIDQLDRIIELCIELEADDV  182

Query  189  ELATCQFYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERP  248
            ELATCQFYGWA+LN+  LLPT +Q+  A+A V  YR+ +        LL V PDYY+ERP
Sbjct  183  ELATCQFYGWAQLNREGLLPTRDQLVRAEAVVHRYREKMAASGNLANLLFVTPDYYEERP  242

Query  249  KKCIGGWGQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWM  308
            K C+GGWG IF++V+P+G  LPC SA+ LP+ FP++ + SL+ IW  +F FN +RG DWM
Sbjct  243  KGCMGGWGAIFLSVTPEGMALPCHSARQLPIRFPSVLEHSLQDIWFNSFGFNRYRGFDWM  302

Query  309  QEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISD  368
             EPCRSC +K+KD GGCRCQA+MLT N    DPVCSKS  H  I+ AR Q  C+   ++ 
Sbjct  303  PEPCRSCDEKEKDFGGCRCQAFMLTGNADNADPVCSKSEHHGTILAAREQANCTNIQVNQ  362

Query  369  LKLRNPQNSK  378
            L+ RN  NS+
Sbjct  363  LRFRNRANSE  372


> Q4K4U8 PqqA peptide cyclase [Pseudomonas fluorescens (strain 
ATCC BAA-477 / NRRL B-23932 / Pf-5)]
Length=389

 Score =  486 bits (1252),  Expect = 6e-174
 Identities = 228/366 (62%), Positives = 283/366 (77%), Gaps = 0/366 (0%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEPL  76
            PLWLLAELTYRCPLQC YCSNPLD+A   +ELST++W  VFR+AR MG+ QLGFSGGEPL
Sbjct  23   PLWLLAELTYRCPLQCPYCSNPLDFAEQGKELSTEQWIKVFREAREMGAAQLGFSGGEPL  82

Query  77   LRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEILS  136
            +RQDL+ELI  A +LGFYTNLITSGIGLTEQKI++F +AGLDHIQISFQASD  ++ +L+
Sbjct  83   VRQDLAELIGEARKLGFYTNLITSGIGLTEQKISDFKKAGLDHIQISFQASDEQVNNLLA  142

Query  137  GSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQFY  196
            GS+KAF QK  MA AVK H YPMVLNFV HR NI++ID+IIEL + L AD+VELATCQFY
Sbjct  143  GSKKAFAQKLEMARAVKAHGYPMVLNFVTHRHNIDKIDRIIELCIALEADFVELATCQFY  202

Query  197  GWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGWG  256
            GWA+LN+  LLPT EQ+  A+     YR  ++      KL+ V PDYY+ERPK C+ GWG
Sbjct  203  GWAQLNRVGLLPTKEQLVRAERITNEYRARLEAQGHLCKLIFVTPDYYEERPKACMNGWG  262

Query  257  QIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSCP  316
             IF+TV+PDGT LPC  A+ +P++FP ++D S++ IW ++F FN FRG DWM EPCRSC 
Sbjct  263  SIFLTVTPDGTALPCHGARQMPVQFPNVRDHSMQHIWYDSFGFNRFRGYDWMPEPCRSCD  322

Query  317  DKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQN  376
            +K+KD GGCRCQA+MLT +    DPVCSKSP H  I++AR +++ +   I  L  RN +N
Sbjct  323  EKEKDFGGCRCQAFMLTGDASNADPVCSKSPHHGMILQAREESETATHTIEQLAFRNERN  382

Query  377  SKLFFK  382
            S+L  K
Sbjct  383  SRLIAK  388


 Score = 18.5 bits (36),  Expect = 6.3
 Identities = 8/17 (47%), Positives = 10/17 (59%), Gaps = 0/17 (0%)

Query  263  SPDGTVLPCQSAKDLPL  279
            SP+  VLP +    LPL
Sbjct  8    SPEAAVLPGKPEVGLPL  24


> B7H2Y0 PqqA peptide cyclase [Acinetobacter baumannii (strain 
AB307-0294)]
Length=384

 Score =  486 bits (1251),  Expect = 7e-174
 Identities = 231/364 (63%), Positives = 276/364 (76%), Gaps = 1/364 (0%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEPL  76
            PLWLLAELTYRCPLQC YCSNPLDYA  K EL+T EW DVF QAR MG+VQLGFSGGEPL
Sbjct  8    PLWLLAELTYRCPLQCPYCSNPLDYAQHKNELTTQEWFDVFDQARQMGAVQLGFSGGEPL  67

Query  77   LRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEILS  136
            +RQDL +L+ +AH+LGFYTNLITSG+GLTEQ+I+   +AGLDHIQISFQASDP +++ L+
Sbjct  68   VRQDLEQLVAHAHQLGFYTNLITSGMGLTEQRISHLKQAGLDHIQISFQASDPVVNDALA  127

Query  137  GSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQFY  196
            GS+ AF+QK  M   VKK+ YPMVLNFVIHR NI+QID+IIEL LELNAD VELA CQFY
Sbjct  128  GSKHAFEQKYEMCRLVKKYDYPMVLNFVIHRHNIDQIDKIIELCLELNADTVELAICQFY  187

Query  197  GWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGWG  256
            GWA LN+  LLPT EQ+  A+     YR+ +   +   KL+ V PDYY+ERPK C+ GWG
Sbjct  188  GWAFLNRQGLLPTQEQLIRAERITNEYREKLKAQNHPCKLIFVVPDYYEERPKACMNGWG  247

Query  257  QIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSCP  316
            +IF TV+PDG  LPC +A+ LP+ FP +++QSL  IW E+  FN FRG  WM E CRSCP
Sbjct  248  KIFFTVAPDGMALPCHAARQLPISFPNVREQSLSRIWYESTGFNHFRGDAWMPEGCRSCP  307

Query  317  DKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQN  376
            DKD+D GGCRCQAYMLT N    DPVC KSP H  I +AR +++     +  L  RN +N
Sbjct  308  DKDRDFGGCRCQAYMLTGNASNADPVCGKSPYHQFIEQARAESEIDS-SLEKLVFRNSRN  366

Query  377  SKLF  380
            SK F
Sbjct  367  SKQF  370


> B7I6M8 PqqA peptide cyclase [Acinetobacter baumannii (strain 
AB0057)]
Length=384

 Score =  486 bits (1251),  Expect = 7e-174
 Identities = 231/364 (63%), Positives = 276/364 (76%), Gaps = 1/364 (0%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEPL  76
            PLWLLAELTYRCPLQC YCSNPLDYA  K EL+T EW DVF QAR MG+VQLGFSGGEPL
Sbjct  8    PLWLLAELTYRCPLQCPYCSNPLDYAQHKNELTTQEWFDVFDQARQMGAVQLGFSGGEPL  67

Query  77   LRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEILS  136
            +RQDL +L+ +AH+LGFYTNLITSG+GLTEQ+I+   +AGLDHIQISFQASDP +++ L+
Sbjct  68   VRQDLEQLVAHAHQLGFYTNLITSGMGLTEQRISHLKQAGLDHIQISFQASDPVVNDALA  127

Query  137  GSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQFY  196
            GS+ AF+QK  M   VKK+ YPMVLNFVIHR NI+QID+IIEL LELNAD VELA CQFY
Sbjct  128  GSKHAFEQKYEMCRLVKKYDYPMVLNFVIHRHNIDQIDKIIELCLELNADTVELAICQFY  187

Query  197  GWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGWG  256
            GWA LN+  LLPT EQ+  A+     YR+ +   +   KL+ V PDYY+ERPK C+ GWG
Sbjct  188  GWAFLNRQGLLPTQEQLIRAERITNEYREKLKAQNHPCKLIFVVPDYYEERPKACMNGWG  247

Query  257  QIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSCP  316
            +IF TV+PDG  LPC +A+ LP+ FP +++QSL  IW E+  FN FRG  WM E CRSCP
Sbjct  248  KIFFTVAPDGMALPCHAARQLPISFPNVREQSLSRIWYESTGFNHFRGDAWMPEGCRSCP  307

Query  317  DKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQN  376
            DKD+D GGCRCQAYMLT N    DPVC KSP H  I +AR +++     +  L  RN +N
Sbjct  308  DKDRDFGGCRCQAYMLTGNASNADPVCGKSPYHQFIEQARAESEIDS-SLEKLVFRNSRN  366

Query  377  SKLF  380
            SK F
Sbjct  367  SKQF  370


> B0V494 PqqA peptide cyclase [Acinetobacter baumannii (strain 
AYE)]
Length=384

 Score =  486 bits (1251),  Expect = 7e-174
 Identities = 231/364 (63%), Positives = 276/364 (76%), Gaps = 1/364 (0%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEPL  76
            PLWLLAELTYRCPLQC YCSNPLDYA  K EL+T EW DVF QAR MG+VQLGFSGGEPL
Sbjct  8    PLWLLAELTYRCPLQCPYCSNPLDYAQHKNELTTQEWFDVFDQARQMGAVQLGFSGGEPL  67

Query  77   LRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEILS  136
            +RQDL +L+ +AH+LGFYTNLITSG+GLTEQ+I+   +AGLDHIQISFQASDP +++ L+
Sbjct  68   VRQDLEQLVAHAHQLGFYTNLITSGMGLTEQRISHLKQAGLDHIQISFQASDPVVNDALA  127

Query  137  GSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQFY  196
            GS+ AF+QK  M   VKK+ YPMVLNFVIHR NI+QID+IIEL LELNAD VELA CQFY
Sbjct  128  GSKHAFEQKYEMCRLVKKYDYPMVLNFVIHRHNIDQIDKIIELCLELNADTVELAICQFY  187

Query  197  GWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGWG  256
            GWA LN+  LLPT EQ+  A+     YR+ +   +   KL+ V PDYY+ERPK C+ GWG
Sbjct  188  GWAFLNRQGLLPTQEQLIRAERITNEYREKLKAQNHPCKLIFVVPDYYEERPKACMNGWG  247

Query  257  QIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSCP  316
            +IF TV+PDG  LPC +A+ LP+ FP +++QSL  IW E+  FN FRG  WM E CRSCP
Sbjct  248  KIFFTVAPDGMALPCHAARQLPISFPNVREQSLSRIWYESTGFNHFRGDAWMPEGCRSCP  307

Query  317  DKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQN  376
            DKD+D GGCRCQAYMLT N    DPVC KSP H  I +AR +++     +  L  RN +N
Sbjct  308  DKDRDFGGCRCQAYMLTGNASNADPVCGKSPYHQFIEQARAESEIDS-SLEKLVFRNSRN  366

Query  377  SKLF  380
            SK F
Sbjct  367  SKQF  370


> P07782 PqqA peptide cyclase [Acinetobacter calcoaceticus]
Length=384

 Score =  483 bits (1242),  Expect = 2e-172
 Identities = 227/362 (63%), Positives = 276/362 (76%), Gaps = 1/362 (0%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEPL  76
            PLWLLAELTYRCPLQC YCSNPLDYA  K EL+T EW DVF QAR MG+VQLGFSGGEPL
Sbjct  8    PLWLLAELTYRCPLQCPYCSNPLDYAQHKNELTTQEWFDVFDQARQMGAVQLGFSGGEPL  67

Query  77   LRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEILS  136
            +RQDL +L+ +AH+ GFYTNLITSG+GLTEQ+IA+  +AGLDHIQ+SFQASDP +++ L+
Sbjct  68   VRQDLEQLVAHAHQQGFYTNLITSGMGLTEQRIADLKQAGLDHIQVSFQASDPVVNDALA  127

Query  137  GSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQFY  196
            GS+ AF+QK  M   VKK+ YPMVLNFVIHR NI+QI+QIIEL LELNAD VELA CQFY
Sbjct  128  GSKHAFEQKYEMCRLVKKYDYPMVLNFVIHRHNIDQIEQIIELCLELNADTVELAICQFY  187

Query  197  GWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGWG  256
            GWA LN+  LLPT EQ++ A+     YR+ +   +   KL+ V PDYY+ERPK C+ GWG
Sbjct  188  GWAFLNRQGLLPTQEQLTRAERITNEYREKLKAQNHPCKLIFVVPDYYEERPKACMNGWG  247

Query  257  QIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSCP  316
            +IF TV+PDG  LPC +A+ LP+ FP +++  L  IW ++  FN FRG  WM E CRSCP
Sbjct  248  KIFFTVAPDGMALPCHAARQLPISFPNVREHKLSDIWYKSTGFNHFRGDAWMPEGCRSCP  307

Query  317  DKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQN  376
            DKD+D GGCRCQAYMLT +    DPVC KSP H  I +AR ++Q   P + +L  RN +N
Sbjct  308  DKDRDFGGCRCQAYMLTGDAANADPVCGKSPYHQMIEQARAESQLVAP-LQNLVFRNSRN  366

Query  377  SK  378
            SK
Sbjct  367  SK  368


> O33506 PqqA peptide cyclase [Rahnella aquatilis]
Length=377

 Score =  482 bits (1241),  Expect = 2e-172
 Identities = 231/368 (63%), Positives = 286/368 (78%), Gaps = 0/368 (0%)

Query  15   KPPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGE  74
            KPP WLLAELTYRCP+QC Y SNPLD+A  ++EL+T +W  VF +AR MG+VQ+GFSGGE
Sbjct  9    KPPSWLLAELTYRCPVQCPYWSNPLDFAKQEKELTTAQWIKVFEEAREMGAVQIGFSGGE  68

Query  75   PLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEI  134
            PL+R+DL ELI+ A +LGFYTNLITSGIGLTE+KI  F++AGLDHIQISFQASD  L+  
Sbjct  69   PLVRKDLPELIRGARDLGFYTNLITSGIGLTEKKIDAFAQAGLDHIQISFQASDEELNAA  128

Query  135  LSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQ  194
            L+G+ KAFQQK AMA AVK H YPMVLNFV+HR NI+QID+II+LS+EL+AD VELATCQ
Sbjct  129  LAGNAKAFQQKLAMAKAVKAHGYPMVLNFVLHRHNIDQIDKIIDLSIELDADDVELATCQ  188

Query  195  FYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGG  254
            FYGWA+LN+  LLPT EQI+ A+  V  YR+ +        LL V PDYY+ERPK C+GG
Sbjct  189  FYGWAQLNREGLLPTREQIARAEDVVHQYREKMAGTGNLANLLFVTPDYYEERPKGCMGG  248

Query  255  WGQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRS  314
            WG IF++V+P+G  LPC SA+ LP+EFP++ + +L+ IW ++F FN +RG DWM EPCRS
Sbjct  249  WGAIFLSVTPEGMALPCHSARQLPVEFPSVLENTLQEIWYDSFGFNKYRGFDWMPEPCRS  308

Query  315  CPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNP  374
            C +K+KD GGCRCQA+MLT N    DPVCSKS  H  I+ AR Q  C+   I+ L+ RN 
Sbjct  309  CSEKEKDFGGCRCQAFMLTGNADNADPVCSKSEHHGMILAAREQANCTNIQINQLQFRNR  368

Query  375  QNSKLFFK  382
             NS+L FK
Sbjct  369  ANSQLIFK  376


> B0VQD7 PqqA peptide cyclase [Acinetobacter baumannii (strain 
SDF)]
Length=384

 Score =  481 bits (1239),  Expect = 4e-172
 Identities = 229/364 (63%), Positives = 275/364 (76%), Gaps = 1/364 (0%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEPL  76
            PLWLLAELTYRC LQC YCSNPLDYA  K EL+T EW DVF QAR MG+VQLGFSGGEPL
Sbjct  8    PLWLLAELTYRCLLQCPYCSNPLDYAQHKNELTTQEWFDVFDQARQMGAVQLGFSGGEPL  67

Query  77   LRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEILS  136
            +RQDL +L+ +AH+LGFYTNL+TSG+GLTEQ+I+   +AGLDHIQISFQASDP L++ L+
Sbjct  68   VRQDLEQLVAHAHQLGFYTNLVTSGMGLTEQRISHLKQAGLDHIQISFQASDPVLNDALA  127

Query  137  GSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQFY  196
            GS+ AF+QK  M   VKK+ YPMVLNFVIHR NI+QID+IIEL LELNAD VELA CQFY
Sbjct  128  GSKHAFEQKYEMCRLVKKYDYPMVLNFVIHRHNIDQIDKIIELCLELNADTVELAICQFY  187

Query  197  GWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGWG  256
            GWA LN+  LLPT EQ+  A+     YR+ +   +   KL+ V PDYY+ERPK C+ GWG
Sbjct  188  GWAFLNRQGLLPTQEQLIRAERITNEYREKLKAQNHPCKLIFVVPDYYEERPKACMNGWG  247

Query  257  QIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSCP  316
            +IF TV+PDG  LPC +A+ LP+ FP +++QSL  IW E+  FN FRG  WM E CRSCP
Sbjct  248  KIFFTVAPDGMALPCHAARQLPISFPNVREQSLSRIWYESTGFNRFRGDAWMPEGCRSCP  307

Query  317  DKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQN  376
            DKD+D GGCRCQAYMLT +    DPVC KSP H  I +AR +++     +  L  RN +N
Sbjct  308  DKDRDFGGCRCQAYMLTGDASNADPVCGKSPYHQFIEQARAESEIDS-SLEKLVFRNSRN  366

Query  377  SKLF  380
            SK F
Sbjct  367  SKQF  370


> Q01060 PqqA peptide cyclase [Pseudescherichia vulneris]
Length=377

 Score =  480 bits (1235),  Expect = 1e-171
 Identities = 231/367 (63%), Positives = 285/367 (78%), Gaps = 0/367 (0%)

Query  16   PPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEP  75
            PPLWLLAELTYRCPLQC YCSNPLD+AA ++ELST++W +VFRQARAMGSVQLGFS GEP
Sbjct  10   PPLWLLAELTYRCPLQCPYCSNPLDFAAQEKELSTEQWIEVFRQARAMGSVQLGFSAGEP  69

Query  76   LLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEIL  135
            L+R+DL ELI  A +LGFYTNLITSGIGLTE+K+  F++AGLDHIQISFQASD  L+  L
Sbjct  70   LVRKDLPELIAAARDLGFYTNLITSGIGLTEKKLQTFADAGLDHIQISFQASDETLNAAL  129

Query  136  SGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQF  195
            +GS KAFQQK  MA AVK   YPMVLNFV+HR NI+QID+IIEL+++L+AD VELATCQF
Sbjct  130  AGSAKAFQQKLTMAKAVKALGYPMVLNFVLHRHNIDQIDRIIELAIQLDADDVELATCQF  189

Query  196  YGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGW  255
            YGWA LN+  LLPT EQI+ A++ VQ YR+ +        LL V PDYY+ERPK C+GGW
Sbjct  190  YGWAHLNREGLLPTREQIAKAESVVQRYRERMAVDGKLANLLFVTPDYYEERPKGCMGGW  249

Query  256  GQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSC  315
            G IF++V+P+G  LPC SA+ LP++FP++ +  L+ IW  +F FN +RG  WM EPCRSC
Sbjct  250  GAIFMSVTPEGMALPCHSARQLPVKFPSVLEHDLEHIWYHSFGFNRYRGNAWMPEPCRSC  309

Query  316  PDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQ  375
            P+K+KD GG  CQA+MLT +    DPVC+KSP H  I+ AR     ++  I  L+ RN  
Sbjct  310  PEKEKDFGGSCCQAFMLTGDADNADPVCAKSPHHGTILAAREAANRTQLGIDQLRFRNQA  369

Query  376  NSKLFFK  382
            NS+LF+K
Sbjct  370  NSRLFYK  376


> P59748 PqqA peptide cyclase [Kluyvera intermedia]
Length=374

 Score =  441 bits (1135),  Expect = 2e-156
 Identities = 221/366 (60%), Positives = 269/366 (73%), Gaps = 0/366 (0%)

Query  16   PPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEP  75
            PPLWLLAELTYRCPLQC YCSNPLD++  K+EL+T++W +VFRQARAMGSVQLGFSGGEP
Sbjct  9    PPLWLLAELTYRCPLQCPYCSNPLDFSQQKKELTTEQWIEVFRQARAMGSVQLGFSGGEP  68

Query  76   LLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEIL  135
            L R+DL ELI+ A +LGFYTNLITSGIGLT +K+  F++AGLDHIQISFQASD  L+  L
Sbjct  69   LTRKDLPELIRAARDLGFYTNLITSGIGLTAKKLDAFADAGLDHIQISFQASDETLNAAL  128

Query  136  SGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQF  195
            +GS+KAFQQK  MA AVK H YPMVLNFV+HR NI+QID+II+L +EL+AD VELATCQF
Sbjct  129  AGSKKAFQQKLEMAKAVKAHGYPMVLNFVLHRHNIDQIDKIIDLCIELDADDVELATCQF  188

Query  196  YGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGW  255
            YGWA+LN+  LLPT EQI+ A+A V  YRQ +      T   +      +   +   G  
Sbjct  189  YGWAQLNREGLLPTREQIANAEAVVADYRQRMGASGNLTNPAVRDAGLLRRAAETLHGRM  248

Query  256  GQIFITVSPDGTVLPCQSAKDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCRSC  315
            G        D T LPC SA+ LP+ FP++ +++L  IW  +F FN +RG DWM EPCRSC
Sbjct  249  GIDLPQRHADCTALPCHSARQLPVAFPSVLERTLDDIWYNSFGFNRYRGFDWMPEPCRSC  308

Query  316  PDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKPDISDLKLRNPQ  375
             +K KD GGCRCQA+MLT +   TDPVCSKSP H +I+EAR +  CS   I  L+ RN  
Sbjct  309  DEKAKDFGGCRCQAFMLTGDADNTDPVCSKSPHHGKILEARREANCSDIKIQQLQFRNRS  368

Query  376  NSKLFF  381
            NS+L F
Sbjct  369  NSELIF  374


> Q9L3B0 PqqA peptide cyclase [Gluconobacter oxydans (strain 621H)]
Length=358

 Score =  328 bits (840),  Expect = 3e-112
 Identities = 168/343 (49%), Positives = 218/343 (64%), Gaps = 10/343 (3%)

Query  16   PPLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEP  75
            PP+ LLAELT+RCPL C YCSNPL+      EL T  W  V  QA  +G +Q+ FSGGEP
Sbjct  6    PPMSLLAELTHRCPLSCPYCSNPLELERKAAELDTATWTAVLEQAAELGVLQVHFSGGEP  65

Query  76   LLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEIL  135
            + R DL EL+  A  L  Y+NLITSG+ L E K+     AGLDHIQ+SFQ    A +E +
Sbjct  66   MARPDLVELVSVARRLNLYSNLITSGVLLDEPKLEALDRAGLDHIQLSFQDVTEAGAERI  125

Query  136  SGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQF  195
             G + A  +K A A  ++    PM LNFV+HR N+ +I ++  L+ EL A  VE+A  Q+
Sbjct  126  GGLKGAQARKVAAARLIRASGIPMTLNFVVHRENVARIPEMFALARELGAGRVEIAHTQY  185

Query  196  YGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLL--VAPDYYQERPKKCIG  253
            YGW   N+ ALLP+ +Q+  +   V+A R        K  L +  V PDY+ +RPK C+G
Sbjct  186  YGWGLKNREALLPSRDQLEESTRAVEAER-------AKGGLSVDYVTPDYHADRPKPCMG  238

Query  254  GWGQIFITVSPDGTVLPCQSAKDLP-LEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPC  312
            GWGQ F+ V+P G VLPC +A+ +P + FP +QD +L  IWN +  FN FRGTDWM EPC
Sbjct  239  GWGQRFVNVTPSGRVLPCHAAEIIPDVAFPNVQDVTLSEIWNISPLFNMFRGTDWMPEPC  298

Query  313  RSCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEA  355
            RSC  K++D GGCRCQA  LT N   TDPVCS SP H ++ +A
Sbjct  299  RSCERKERDWGGCRCQAMALTGNAANTDPVCSLSPYHDRVEQA  341


> P59749 PqqA peptide cyclase [Streptomyces rochei]
Length=364

 Score =  313 bits (803),  Expect = 1e-106
 Identities = 155/344 (45%), Positives = 224/344 (65%), Gaps = 10/344 (3%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEPL  76
            P  +L ELT+RCPL C YCSNPL+    + EL+ ++W D+  QAR +G VQ+ FSGGEPL
Sbjct  9    PAGMLIELTHRCPLHCPYCSNPLELVRREAELTCEQWTDILTQARELGVVQMHFSGGEPL  68

Query  77   LRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEILS  136
             R DL +L+ +A  LG Y NL+TSG+GLT ++  + +  G+DH+Q+S Q +DPA  + ++
Sbjct  69   ARPDLPDLVGHARRLGAYVNLVTSGVGLTAERAHDLARRGVDHVQLSLQDADPAAGQAIA  128

Query  137  GSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQFY  196
            G+R     K   A AV     P+ +N V+HR NI++  ++++L+++L AD +ELA  Q+Y
Sbjct  129  GAR-VHTAKLEAARAVTAAGLPLTVNIVLHRGNIDRTGRMVDLAVDLGADRIELANTQYY  187

Query  197  GWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCIGGWG  256
            GW   N+AAL+PT  Q++ A+   +A R    ++    +L+ VA DYY +RPK C+ GWG
Sbjct  188  GWGLRNRAALMPTAAQLAAAR---EAVRHARTRYAGGPELVYVAADYYDDRPKPCMDGWG  244

Query  257  QIFITVSPDGTVLPCQSA---KDLPLEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCR  313
               +TV+P G VLPC +A     LP+E      + L  IW  + +FNA+RGT WM+EPCR
Sbjct  245  STQLTVTPAGDVLPCPAAYAITTLPVE--NALRRPLSEIWYASRSFNAYRGTGWMREPCR  302

Query  314  SCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARL  357
            +CP++  D GGCRCQA+ LT +  ATDP C  SP H  +V+A L
Sbjct  303  TCPERHADHGGCRCQAFQLTGDAAATDPACGLSP-HRSLVDAAL  345


> P71517 PqqA peptide cyclase [Methylorubrum extorquens (strain 
ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)]
Length=384

 Score =  302 bits (773),  Expect = 8e-102
 Identities = 156/351 (44%), Positives = 216/351 (62%), Gaps = 8/351 (2%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQELSTDEWKDVFRQARAMGSVQLGFSGGEPL  76
            P+ LLAELT+RCPL+C YCSNPL+      EL T  W  V  +A  +G + +  SGGEP 
Sbjct  17   PVGLLAELTHRCPLRCPYCSNPLELDRRSAELDTQTWLRVLTEAAGLGVLHVHLSGGEPT  76

Query  77   LRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALSEILS  136
             R D+ E+     ELG Y+NLITSG+G    K+    + GLDH+Q+S Q  D A +E + 
Sbjct  77   ARPDIVEITAKCAELGLYSNLITSGVGGALAKLDALYDVGLDHVQLSVQGVDAANAEKIG  136

Query  137  GSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELATCQFY  196
            G + A  QK   A  V +   P+ LN VIHR NI ++   I+L+++L A  +E+A  Q+Y
Sbjct  137  GLKNAQPQKMQFAARVTELGLPLTLNSVIHRGNIHEVPGFIDLAVKLGAKRLEVAHTQYY  196

Query  197  GWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLL--LVAPDYYQERPKKCIGG  254
            GWA +N+AAL+P   Q+  +   V+A R+      LK +L+  LV PDYY + PK C GG
Sbjct  197  GWAYVNRAALMPDKSQVDESIRIVEAARE-----RLKGQLVIDLVVPDYYAKYPKACAGG  251

Query  255  WGQIFITVSPDGTVLPCQSAKDLP-LEFPTIQDQSLKTIWNEAFAFNAFRGTDWMQEPCR  313
            WG+  + V+P G VLPC +A+ +P LEF  + D +L  IW ++ AF A+RGT WM+EPCR
Sbjct  252  WGRKLMNVTPQGKVLPCHAAETIPGLEFWYVTDHALGEIWTKSPAFAAYRGTSWMKEPCR  311

Query  314  SCPDKDKDLGGCRCQAYMLTKNMYATDPVCSKSPVHHQIVEARLQTQCSKP  364
            SC  ++KD GGCRCQA  LT +   TDP CS SP+H ++ +   +     P
Sbjct  312  SCDRREKDWGGCRCQALALTGDAANTDPACSLSPLHAKMRDLAKEEAAETP  362


> P9WJ79 Putative mycofactocin radical SAM maturase MftC [Mycobacterium 
tuberculosis (strain ATCC 25618 / H37Rv)]
Length=391

 Score = 82.4 bits (202),  Expect = 2e-20
 Identities = 82/340 (24%), Positives = 133/340 (39%), Gaps = 30/340 (9%)

Query  17   PLWLLAELTYRCPLQCAYCSNPLDYAAVKQ--ELSTDEWKDVFRQARAMGSVQLGFSGGE  74
            P+ L  ELTY C L C +C   L  +  +   ELST + KD+  +   M    +   GGE
Sbjct  19   PICLTWELTYACNLACVHC---LSSSGKRDPGELSTRQCKDIIDELERMQVFYVNIGGGE  75

Query  75   PLLRQDLSELIKY--AHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQISFQASDPALS  132
            P +R D  EL+ Y  AH +G      T+G+ +T +     +      +QIS   +   ++
Sbjct  76   PTVRPDFWELVDYATAHHVG--VKFSTNGVRITPEVATRLAATDYVDVQISLDGATAEVN  133

Query  133  EILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSLELNADYVELAT  192
            + + G+       +A+          + ++ VI R N+ Q+D+   L+    A  + +  
Sbjct  134  DAIRGTGSFDMAVRALQNLAAAGFAGVKISVVITRRNVAQLDEFATLASRYGAT-LRITR  192

Query  193  CQFYGWAKLNQAALLPTPEQISYAQARVQAYRQYIDQHHLKTKLLLVAPDYYQERPKKCI  252
             +  G      A L PT +Q      +VQ Y   +     K + +L    ++   P    
Sbjct  193  LRPSGRGTDVWADLHPTADQ------QVQLYDWLVS----KGERVLTGDSFFHLAPLGQS  242

Query  253  G--------GWGQIFITVSPDGTVLPCQSA-KDLPLEFPTIQDQSLKTIWNEAFAFNAFR  303
            G        G G++   + P G V  C  A  D  L    + D   + +W  +  F   R
Sbjct  243  GALAGLNMCGAGRVVCLIDPVGDVYACPFAIHDHFLAGNVLSDGGFQNVWKNSSLFRELR  302

Query  304  GTDWMQEPCRSCPDKDKDLGGCRCQAYMLTKNMYATDPVC  343
                    C SC   D   GGC    +     +   DP C
Sbjct  303  EPQ-SAGACGSCGHYDSCRGGCMAAKFFTGLPLDGPDPEC  341


> O31423 Sporulation killing factor maturation protein SkfB [Bacillus 
subtilis (strain 168)]
Length=410

 Score = 70.9 bits (172),  Expect = 2e-16
 Identities = 67/283 (24%), Positives = 119/283 (42%), Gaps = 28/283 (10%)

Query  6    MNIPVSLQSKPPLWLLAELTYRCPLQCAYCSNPLDYAA----VKQELSTDEWKDVFRQAR  61
            +++  SL S  P+    +LT  C L C++C     YA+      +ELS+++W  V ++  
Sbjct  95   LHVSGSLDSYLPISCTLQLTNACNLSCSFC-----YASSGKPYPEELSSEQWILVMQKLA  149

Query  62   AMGSVQLGFSGGEPLLRQDLSELIKYAHELGFYTNLITSGIGLTEQKIAEFSEAGLDHIQ  121
            A G   +  +GGE  L +   EL+  A  L    N+ ++G+   ++++   S  G   +Q
Sbjct  150  AHGVADITLTGGEAKLIKGFKELVVVASSLFTNVNVFSNGLNWRDEEVELLSHLGNVSVQ  209

Query  122  ISFQASDPALSEILSGSRKAFQQKQAMALAVKKHRYPMVLNFVIHRFNIEQIDQIIELSL  181
            IS    D    + L G +  F++       + +   P+++   I+  N +++  ++E   
Sbjct  210  ISIDGMDNTHDQ-LRGRKGGFKESMNTIKKLSEANIPVIVAMTINESNADEVSDVVEQCA  268

Query  182  ELNADYVELATCQFYGWAKLNQAALLPTPEQISYAQARVQAYR-----QYIDQHHLKTKL  236
               A           G A     AL    E++   Q R   ++       ID  H ++  
Sbjct  269  NAGAFIFRAGKTLSVGRATEGFKALDIDFEEMVQIQLREARHKWGDRLNIIDWEHEESSF  328

Query  237  LLVAPDYYQERPKKCIGGWGQIFITVSPDGTVLPCQSAKDLPL  279
                 D+       C  G+   +I    DG V PCQ  +DLPL
Sbjct  329  ---TTDF-------CTPGYLAWYIRA--DGYVTPCQ-LEDLPL  358



Lambda      K        H        a         alpha
   0.322    0.136    0.416    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2142503


  Database: 66eef9893c469f8448bd2de9e07555d3.SwissProt.fasta
    Posted date:  Sep 19, 2020  2:12 PM
  Number of letters in database: 7,252
  Number of sequences in database:  19



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40