ACIAD2463 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 2499b09e159f3f3daf2c4ca5b425808b.TrEMBL.fasta
           25 sequences; 7,513 total letters



Query= ACIAD2463

Length=286
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A0A2N6VB35 Indole-3-glycerol phosphate synthase [Acinetobacter ...   494    0.0   
  N9DAF0 Indole-3-glycerol phosphate synthase [Acinetobacter ursi...   489    2e-178
  N9S9Y6 Indole-3-glycerol phosphate synthase [Acinetobacter ursi...   488    3e-178
  A0A009Z854 Indole-3-glycerol phosphate synthase [Acinetobacter ...   488    3e-178
  A0A2L1VEG4 Indole-3-glycerol phosphate synthase [Acinetobacter ...   471    2e-171
  A0A010JR32 Indole-3-glycerol phosphate synthase [Acinetobacter ...   470    5e-171
  A0A062ND54 Indole-3-glycerol phosphate synthase [Acinetobacter ...   469    9e-171
  A0A014FET2 Indole-3-glycerol phosphate synthase [Acinetobacter ...   469    9e-171
  A0A2T5Q7M3 Indole-3-glycerol phosphate synthase [Acinetobacter ...   469    9e-171
  A0A0E2GC65 Indole-3-glycerol phosphate synthase [Acinetobacter ...   469    9e-171
  A0A014F8N7 Indole-3-glycerol phosphate synthase [Acinetobacter ...   469    9e-171
  A0A013T8M9 Indole-3-glycerol phosphate synthase [Acinetobacter ...   469    1e-170
  A0A013V2F4 Indole-3-glycerol phosphate synthase [Acinetobacter ...   469    1e-170
  A0A009RVZ9 Indole-3-glycerol phosphate synthase [Acinetobacter ...   469    1e-170
  K0ICW5 Indole-3-glycerol phosphate synthase [Pseudomonas putida]     254    1e-86 
  R9S786 Indole-3-glycerol phosphate synthase [Burkholderia thail...   212    4e-70 
  C0KGJ9 Indole-3-glycerol phosphate synthase [Chlorogloeopsis sp...   209    1e-68 
  C6KEL4 Indole-3-glycerol phosphate synthase [Methylophilus meth...   179    4e-58 
  A3F3I6 Indole-3-glycerol phosphate synthase [Bacillus subtilis ...   179    2e-57 
  Q5MI55 Indole-3-glycerol phosphate synthase [Leptospira biflexa...   158    3e-49 
  Q2XN38 Indole-3-glycerol phosphate synthase / N-(5'-phosphoribo...   160    3e-48 
  V9GZS6 Indole-3-glycerol phosphate synthase / N-(5'-phosphoribo...   160    3e-48 
  V9GZT3 Indole-3-glycerol phosphate synthase / N-(5'-phosphoribo...   156    6e-47 
  Q2XN48 Indole-3-glycerol phosphate synthase / N-(5'-phosphoribo...   155    1e-46 
  B4YQR5 Indole-3-glycerol phosphate synthase / N-(5'-phosphoribo...   149    2e-44 


> A0A2N6VB35 Indole-3-glycerol phosphate synthase [Acinetobacter 
ursingii]
Length=268

 Score =  494 bits (1273),  Expect = 0.0
 Identities = 247/268 (92%), Positives = 261/268 (97%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MIQIQNTILGKIVDRKHEELADRLKQR+LKDVE+W K+A PVRGFAQSLR KRPGVIAEI
Sbjct  1    MIQIQNTILGKIVDRKHEELADRLKQRSLKDVEEWTKQATPVRGFAQSLRRKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKGVIRADFNPAEIA QYEQAGAACLSVLTDVDFFQGADENIAIAR+HC+LPALR
Sbjct  61   KKASPSKGVIRADFNPAEIAAQYEQAGAACLSVLTDVDFFQGADENIAIAREHCNLPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNV+EARALQADCILLIVACLSDQQLEEMSKTAFEY+LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVIEARALQADCILLIVACLSDQQLEEMSKTAFEYNLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSE+CLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATP D+ +MQ+HDIH
Sbjct  181  LKLSEKCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPADIAMMQDHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            +FLVGESFMKQPRPDQAFT LFGVPKLV
Sbjct  241  AFLVGESFMKQPRPDQAFTALFGVPKLV  268


> N9DAF0 Indole-3-glycerol phosphate synthase [Acinetobacter ursingii 
ANC 3649]
Length=268

 Score =  489 bits (1258),  Expect = 2e-178
 Identities = 245/266 (92%), Positives = 259/266 (97%), Gaps = 0/266 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MIQIQNTILGKIVDRKHEELADRLKQR+LKDVE+W K A PVRGFAQSLRSKRPGVIAEI
Sbjct  1    MIQIQNTILGKIVDRKHEELADRLKQRSLKDVEEWAKLATPVRGFAQSLRSKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKGVIRADFNPAEIA QYEQAGAACLSVLTDVDFFQGADENIAIAR++C+LPALR
Sbjct  61   KKASPSKGVIRADFNPAEIAAQYEQAGAACLSVLTDVDFFQGADENIAIARENCNLPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNV+EARALQADCILLIVACLSDQQLEEMSKTAFEY+LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVIEARALQADCILLIVACLSDQQLEEMSKTAFEYNLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATP D+ +MQ+HDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPADIAMMQQHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPK  283
            +FLVGESFMKQPRPDQAFT LFGVP+
Sbjct  241  AFLVGESFMKQPRPDQAFTALFGVPE  266


> N9S9Y6 Indole-3-glycerol phosphate synthase [Acinetobacter ursingii 
NIPH 706]
Length=268

 Score =  488 bits (1256),  Expect = 3e-178
 Identities = 244/268 (91%), Positives = 260/268 (97%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MIQIQNTILGKIVDRKHEELADRLKQR+LKDVE+W K+A PVRGFAQSLR KRPGVIAEI
Sbjct  1    MIQIQNTILGKIVDRKHEELADRLKQRSLKDVEEWAKQATPVRGFAQSLRRKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKGVIRADF+PAEIA QYEQAGAACLSVLTDVDFFQGADENIAIAR++C+LPALR
Sbjct  61   KKASPSKGVIRADFHPAEIAAQYEQAGAACLSVLTDVDFFQGADENIAIARENCNLPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNV+EARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVIEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTF+VDLNTSLRLKKLLDPSRLLVTESGIATP D+ +MQ+HDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFEVDLNTSLRLKKLLDPSRLLVTESGIATPADIAIMQDHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            +FLVGESFMKQPRPDQAFT LFGVP+ V
Sbjct  241  AFLVGESFMKQPRPDQAFTTLFGVPEQV  268


> A0A009Z854 Indole-3-glycerol phosphate synthase [Acinetobacter 
sp. 479375]
Length=268

 Score =  488 bits (1256),  Expect = 3e-178
 Identities = 244/268 (91%), Positives = 260/268 (97%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MIQIQNTILGKIVDRKHEELADRLKQR+LKDVE+W K+A PVRGFAQSLR KRPGVIAEI
Sbjct  1    MIQIQNTILGKIVDRKHEELADRLKQRSLKDVEEWAKQATPVRGFAQSLRRKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKGVIRADF+PAEIA QYEQAGAACLSVLTDVDFFQGADENIAIAR++C+LPALR
Sbjct  61   KKASPSKGVIRADFHPAEIAAQYEQAGAACLSVLTDVDFFQGADENIAIARENCNLPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNV+EARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVIEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTF+VDLNTSLRLKKLLDPSRLLVTESGIATP D+ +MQ+HDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFEVDLNTSLRLKKLLDPSRLLVTESGIATPADIAMMQDHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            +FLVGESFMKQPRPDQAFT LFGVP+ V
Sbjct  241  AFLVGESFMKQPRPDQAFTTLFGVPEQV  268


> A0A2L1VEG4 Indole-3-glycerol phosphate synthase [Acinetobacter 
nosocomialis]
Length=268

 Score =  471 bits (1211),  Expect = 2e-171
 Identities = 237/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K APPVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAAPPVRGFANALQHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIA+QYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAEQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTS+RLKKLL  SRLL+TESGIATP DV +MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSIRLKKLLPSSRLLITESGIATPDDVSMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> A0A010JR32 Indole-3-glycerol phosphate synthase [Acinetobacter 
sp. 1542444]
Length=268

 Score =  470 bits (1209),  Expect = 5e-171
 Identities = 237/268 (88%), Positives = 252/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L++KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALKNKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFLIDPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+E+ERA
Sbjct  121  KDFLIDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEEMERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTS+RLKKLL  SRLL+TESGIATP DV++MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSIRLKKLLPTSRLLITESGIATPDDVRMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> A0A062ND54 Indole-3-glycerol phosphate synthase [Acinetobacter 
sp. 796380-1375]
Length=268

 Score =  469 bits (1207),  Expect = 9e-171
 Identities = 237/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAASPVRGFANALQHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTS+RLKKLL  SRLL+TESGIATP DV++MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSIRLKKLLPSSRLLITESGIATPDDVRMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> A0A014FET2 Indole-3-glycerol phosphate synthase [Acinetobacter 
sp. 25977_2]
Length=268

 Score =  469 bits (1207),  Expect = 9e-171
 Identities = 237/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAASPVRGFANALQHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTS+RLKKLL  SRLL+TESGIATP DV++MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSIRLKKLLPSSRLLITESGIATPDDVRMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> A0A2T5Q7M3 Indole-3-glycerol phosphate synthase [Acinetobacter 
oleivorans]
Length=268

 Score =  469 bits (1207),  Expect = 9e-171
 Identities = 237/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALKHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFLIDPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+E+ERA
Sbjct  121  KDFLIDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEEMERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTS+RLKKLL  SRLL+TESGIATP DV++MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSIRLKKLLPASRLLITESGIATPDDVRMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> A0A0E2GC65 Indole-3-glycerol phosphate synthase [Acinetobacter 
nosocomialis NIPH 386]
Length=268

 Score =  469 bits (1207),  Expect = 9e-171
 Identities = 237/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAASPVRGFANALQHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTS+RLKKLL  SRLL+TESGIATP DV++MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSIRLKKLLPSSRLLITESGIATPDDVRMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> A0A014F8N7 Indole-3-glycerol phosphate synthase [Acinetobacter 
sp. 25977_10]
Length=268

 Score =  469 bits (1207),  Expect = 9e-171
 Identities = 237/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAASPVRGFANALQHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTS+RLKKLL  SRLL+TESGIATP DV++MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSIRLKKLLPSSRLLITESGIATPDDVRMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> A0A013T8M9 Indole-3-glycerol phosphate synthase [Acinetobacter 
sp. 742879]
Length=268

 Score =  469 bits (1206),  Expect = 1e-170
 Identities = 237/268 (88%), Positives = 250/268 (93%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALKHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFLIDPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+E+ERA
Sbjct  121  KDFLIDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEEMERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTS+RLKKLL  SRLL+TESGIATP DV +MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSIRLKKLLPTSRLLITESGIATPDDVHMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> A0A013V2F4 Indole-3-glycerol phosphate synthase [Acinetobacter 
sp. 826659]
Length=268

 Score =  469 bits (1206),  Expect = 1e-170
 Identities = 237/268 (88%), Positives = 250/268 (93%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALKHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFLIDPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+E+ERA
Sbjct  121  KDFLIDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEEMERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTS+RLKKLL  SRLL+TESGIATP DV +MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSIRLKKLLPTSRLLITESGIATPDDVHMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> A0A009RVZ9 Indole-3-glycerol phosphate synthase [Acinetobacter 
sp. 809848]
Length=268

 Score =  469 bits (1206),  Expect = 1e-170
 Identities = 237/268 (88%), Positives = 250/268 (93%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALKHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFLIDPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+E+ERA
Sbjct  121  KDFLIDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEEMERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTS+RLKKLL  SRLL+TESGIATP DV +MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSIRLKKLLPTSRLLITESGIATPDDVHMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> K0ICW5 Indole-3-glycerol phosphate synthase [Pseudomonas putida]
Length=251

 Score =  254 bits (650),  Expect = 1e-86
 Identities = 138/249 (55%), Positives = 176/249 (71%), Gaps = 4/249 (2%)

Query  35   EELADRLKQRNLKDVEQWVKEAPPVRGFAQSL----RSKRPGVIAEIKKASPSKGVIRAD  90
            +E+A+R  + +L ++E   K A   RGFA++L      K+P VIAEIKKASPSKGVIR  
Sbjct  1    QEVAERSARVSLAELEGLAKAADAPRGFAKALIEQAARKQPAVIAEIKKASPSKGVIREH  60

Query  91   FNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDFLIDPYNVVEA  150
            F PAEIA  YE+ GA CLSVLTDVD+FQGADE +  AR   SLP +RKDF++DPY +VEA
Sbjct  61   FVPAEIAVSYEKGGATCLSVLTDVDYFQGADEYLQQARAAVSLPVIRKDFMVDPYQIVEA  120

Query  151  RALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKLSEQCLLGVNN  210
            RAL ADC+LLIV+ L D ++ E++ TA +  LDVLVEVHD  ELERALK  +  L+GVNN
Sbjct  121  RALSADCVLLIVSALDDVKMAELAATAKDVGLDVLVEVHDGDELERALKTLDTPLVGVNN  180

Query  211  RNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFLVGESFMKQPR  270
            RNL TF+V L T+L L   +   RL +TESGI    DV+LM  ++++SFLVGE+FM+  +
Sbjct  181  RNLHTFEVSLETTLDLLPRIPRDRLAITESGILNRADVELMAINEVYSFLVGEAFMRAEQ  240

Query  271  PDQAFTELF  279
            P      LF
Sbjct  241  PGLERHRLF  249


> R9S786 Indole-3-glycerol phosphate synthase [Burkholderia thailandensis]
Length=261

 Score =  212 bits (540),  Expect = 4e-70
 Identities = 123/261 (47%), Positives = 164/261 (63%), Gaps = 10/261 (4%)

Query  25   ILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPP--VRGFAQSLRSKRP----GVIAEIK  78
            IL +I+  K EE+A  ++      VE   +EA    +R F  +LRSK       VIAEIK
Sbjct  4    ILERIIAVKREEVAAAMRST---PVEALKREASTCDLRDFVGALRSKHATGDAAVIAEIK  60

Query  79   KASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRK  138
            KASPSKGV+R  F PA+IA  Y   GAACLSVLTD  FFQG    +  AR  C+LP LRK
Sbjct  61   KASPSKGVLREHFAPADIALSYALHGAACLSVLTDEQFFQGGVRYLKEARSACTLPVLRK  120

Query  139  DFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERAL  198
            DF+ID Y ++EARA+ AD ILLI A L   Q++++   A    L VLVEVHD  E+E+AL
Sbjct  121  DFIIDAYQIIEARAMGADAILLITAALDTSQMQDLEAYAHSLGLAVLVEVHDSHEMEQAL  180

Query  199  KLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHS  258
             L    LLG+NNRNL+TF+  + T+L +  ++   R++VTESGI +   V+ M+  ++++
Sbjct  181  TLKTP-LLGINNRNLRTFETTIQTTLDMLDMIPQDRIVVTESGILSRTSVETMRAANVNT  239

Query  259  FLVGESFMKQPRPDQAFTELF  279
            FLVGE+FM+   P      LF
Sbjct  240  FLVGEAFMRAEHPGAELARLF  260


> C0KGJ9 Indole-3-glycerol phosphate synthase [Chlorogloeopsis 
sp. Cgs-089]
Length=275

 Score =  209 bits (531),  Expect = 1e-68
 Identities = 118/271 (44%), Positives = 168/271 (62%), Gaps = 7/271 (3%)

Query  15   VIQMIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSK--RPG  72
            +I  +     IL +IV  K +E+A   ++  L  ++Q +  AP VR F  +L+    +P 
Sbjct  1    MINQVATSRHILEEIVWHKKQEVAQMQQELPLASLQQQLSAAPAVRNFLTALQQNPSQPS  60

Query  73   VIAEIKKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCS  132
            +IAE+KKASPS+G+IRADF P  IAQ YE+ GAACLSVLTD  FFQG+ +N+   R   +
Sbjct  61   LIAEVKKASPSRGIIRADFEPVAIAQAYERGGAACLSVLTDQKFFQGSFDNLRAIRPQVA  120

Query  133  LPALRKDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQ  192
            LP L K+F+ID Y +  ARA  AD +LLI A LSDQ+L+   +   +  ++ LVEVH   
Sbjct  121  LPLLCKEFIIDSYQIYFARAAGADAVLLIAAILSDQELQNFLRLIHDLGMNALVEVHTLT  180

Query  193  ELERALKLSEQCLLGVNNRNLKTFDVDLNTSLRL-----KKLLDPSRLLVTESGIATPQD  247
            EL+R L+L +  L+G+NNRNL+ F VDL  + +L     + L      +V+ESG+ TP D
Sbjct  181  ELDRVLQLDDLRLVGINNRNLEDFTVDLGITQQLLAQRQQYLQSLDITVVSESGLYTPAD  240

Query  248  VQLMQEHDIHSFLVGESFMKQPRPDQAFTEL  278
            + L+ E  + + LVGES +KQ   +QA   L
Sbjct  241  LSLVAEAGVRAVLVGESLVKQSDVEQAVRSL  271


> C6KEL4 Indole-3-glycerol phosphate synthase [Methylophilus methylotrophus]
Length=205

 Score =  179 bits (455),  Expect = 4e-58
 Identities = 101/191 (53%), Positives = 128/191 (67%), Gaps = 5/191 (3%)

Query  25   ILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSK----RPGVIAEIKKA  80
            IL KI+  K EE+A    +  L +V+       P R F  ++RSK    +  VIAEIKKA
Sbjct  4    ILNKILATKAEEIATAQAKLPLAEVQALATRQAPARDFVGAIRSKIAAGKAAVIAEIKKA  63

Query  81   SPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDF  140
            SPSKGVIRADF PAEIA  YE  GAACLSVLTD  +FQG+ + +  AR  CSLP LRKDF
Sbjct  64   SPSKGVIRADFKPAEIAASYELGGAACLSVLTDEQYFQGSADYLKQARAVCSLPVLRKDF  123

Query  141  LIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKL  200
            +ID Y V EARA+ ADCILLI A L+  Q++++   A    + VLVEVH+ +EL +A++L
Sbjct  124  MIDEYQVYEARAMGADCILLIAAALTLAQMQQLESVAHSLGMAVLVEVHNGEELAQAIQL  183

Query  201  SEQCLLGVNNR  211
            +   LLG+NNR
Sbjct  184  TTP-LLGINNR  193


> A3F3I6 Indole-3-glycerol phosphate synthase [Bacillus subtilis 
subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)]
Length=250

 Score =  179 bits (454),  Expect = 2e-57
 Identities = 108/258 (42%), Positives = 154/258 (60%), Gaps = 11/258 (4%)

Query  25   ILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRP--GVIAEIKKASP  82
            +L  I+ +K EE+    K   L + + + K     R F ++L S     G+IAE+KKASP
Sbjct  1    MLENIIKQKKEEV----KTLVLPEEQPFEK-----RSFKEALASLNRFIGLIAEVKKASP  51

Query  83   SKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDFLI  142
            SKG+I+ +F P  IA+ YE A A  LSVLTD  FFQG +  ++  ++  S+P LRKDF+I
Sbjct  52   SKGLIKENFVPVRIAKDYETAKADALSVLTDTPFFQGENSYLSDVKRAVSIPVLRKDFII  111

Query  143  DPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKLSE  202
            D   V E+R + AD ILLI   L    L E+   A E ++DVLVEVHD   LE+ LK+  
Sbjct  112  DSLQVEESRRIGADAILLIGEVLDPLHLHELYLEAGEKEMDVLVEVHDATTLEQILKVFT  171

Query  203  QCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFLVG  262
              +LG+NNRNLKTF+  +  + ++  L     LLV+ESGI + + +  ++EH   + L+G
Sbjct  172  PDILGINNRNLKTFETSIMQTEQIASLAPKESLLVSESGIGSLEHLTFVKEHGARAVLIG  231

Query  263  ESFMKQPRPDQAFTELFG  280
            ES M+Q    +A   LFG
Sbjct  232  ESLMRQTSQQKAIHALFG  249


> Q5MI55 Indole-3-glycerol phosphate synthase [Leptospira biflexa 
serovar Patoc]
Length=258

 Score =  158 bits (399),  Expect = 3e-49
 Identities = 102/261 (39%), Positives = 141/261 (54%), Gaps = 9/261 (3%)

Query  23   NTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEIKKASP  82
            N IL KIV+ KH E+ +  + + L D         P+R +  +L++    VIAE KK SP
Sbjct  2    NPILHKIVETKHSEI-ELSRGKTLPD------RKIPIRDWKSNLKTNSVSVIAECKKGSP  54

Query  83   SKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDFLI  142
            S G++R D++P EIA+ YE +GA  +SVLTD  +F G+  ++       SLP +RKDF++
Sbjct  55   SAGILRPDYHPVEIAKLYETSGAGAISVLTDQSYFFGSLNDLESVANQVSLPVIRKDFIL  114

Query  143  DPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKLSE  202
            DP  + EA A  A  ILLIV  LS   L+ + + A    L VLVE H+E E+  AL    
Sbjct  115  DPIQIDEAYAYGASAILLIVRILSPSLLKSLHEHANRLGLAVLVETHNELEVNLALDAGA  174

Query  203  QCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFLVG  262
               +G+N R+L TF +  N    +   LDPS + V ESGI + +D Q  +   I S LVG
Sbjct  175  N-TIGINTRDLDTFQIHKNLIEEIAPKLDPSIIRVAESGIESYEDWQKYRGM-IDSMLVG  232

Query  263  ESFMKQPRPDQAFTELFGVPK  283
              FMK       F  L    K
Sbjct  233  TFFMKSKNIQHDFFSLLNGSK  253


> Q2XN38 Indole-3-glycerol phosphate synthase / N-(5'-phosphoribosyl)anthranilate 
isomerase [Escherichia coli]
Length=452

 Score =  160 bits (404),  Expect = 3e-48
 Identities = 98/243 (40%), Positives = 145/243 (60%), Gaps = 5/243 (2%)

Query  24   TILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEIKKASPS  83
            T+L KIV  K   +  R +Q+ L   +  V+  P  R F  +L+  R   I E KKASPS
Sbjct  3    TVLAKIVADKAIWVETRKQQQPLASFQNEVQ--PSTRHFYDALQGARTAFILECKKASPS  60

Query  84   KGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDFLID  143
            KGVIR DF+PA IA  Y+   +A +SVLTD  +FQG+ + + I  Q    P L KDF+ID
Sbjct  61   KGVIRDDFDPARIAAIYKHYASA-ISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIID  119

Query  144  PYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKLSEQ  203
            PY +  AR  QAD  LL+++ L D+Q  +++  A   ++ VL EV +E+ELERA+ L  +
Sbjct  120  PYQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAK  179

Query  204  CLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFLVGE  263
             ++G+NNR+L+   +DLN +  L   L  +  +++ESGI T   V+ +  H  + FL+G 
Sbjct  180  -VVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVREL-SHFANGFLIGS  237

Query  264  SFM  266
            + M
Sbjct  238  ALM  240


> V9GZS6 Indole-3-glycerol phosphate synthase / N-(5'-phosphoribosyl)anthranilate 
isomerase [Escherichia coli]
Length=452

 Score =  160 bits (404),  Expect = 3e-48
 Identities = 98/243 (40%), Positives = 145/243 (60%), Gaps = 5/243 (2%)

Query  24   TILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEIKKASPS  83
            T+L KIV  K   +  R +Q+ L   +  V+  P  R F  +L+  R   I E KKASPS
Sbjct  3    TVLAKIVADKAIWVETRKQQQPLASFQNEVQ--PSTRHFYDALQGARTAFILECKKASPS  60

Query  84   KGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDFLID  143
            KGVIR DF+PA IA  Y+   +A +SVLTD  +FQG+ + + I  Q    P L KDF+ID
Sbjct  61   KGVIRDDFDPARIAAIYKHYASA-ISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIID  119

Query  144  PYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKLSEQ  203
            PY +  AR  QAD  LL+++ L D+Q  +++  A   ++ VL EV +E+ELERA+ L  +
Sbjct  120  PYQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAK  179

Query  204  CLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFLVGE  263
             ++G+NNR+L+   +DLN +  L   L  +  +++ESGI T   V+ +  H  + FL+G 
Sbjct  180  -VVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVREL-SHFANGFLIGS  237

Query  264  SFM  266
            + M
Sbjct  238  ALM  240


> V9GZT3 Indole-3-glycerol phosphate synthase / N-(5'-phosphoribosyl)anthranilate 
isomerase [Escherichia coli]
Length=452

 Score =  156 bits (395),  Expect = 6e-47
 Identities = 97/243 (40%), Positives = 143/243 (59%), Gaps = 5/243 (2%)

Query  24   TILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEIKKASPS  83
            T+L KIV  K   +  R +Q+ L   +  V+  P  R F  +L+  R   I E KKASPS
Sbjct  3    TVLAKIVADKAIWVEARKQQQPLASFQNEVQ--PSTRHFYDALQGARTAFILECKKASPS  60

Query  84   KGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDFLID  143
            KGVIR DF+PA IA  Y+   +A +SVLTD  +FQG+ + + I  Q    P L KDF+ID
Sbjct  61   KGVIRDDFDPARIAAIYKHYASA-ISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIID  119

Query  144  PYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKLSEQ  203
            PY +  AR  QAD  LL+++ L D Q  +++  A   ++ VL EV +E+E ERA+ L  +
Sbjct  120  PYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEEQERAIALGAK  179

Query  204  CLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFLVGE  263
             ++G+NNR+L+   +DLN +  L   L  +  +++ESGI T   V+ +  H  + FL+G 
Sbjct  180  -VVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVREL-SHFANGFLIGS  237

Query  264  SFM  266
            + M
Sbjct  238  ALM  240


> Q2XN48 Indole-3-glycerol phosphate synthase / N-(5'-phosphoribosyl)anthranilate 
isomerase [Escherichia coli]
Length=452

 Score =  155 bits (393),  Expect = 1e-46
 Identities = 97/243 (40%), Positives = 142/243 (58%), Gaps = 5/243 (2%)

Query  24   TILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEIKKASPS  83
            T+L KIV  K   +  R +Q+ L   +  V+  P  R F  +L+  R   I E KKASPS
Sbjct  3    TVLAKIVADKAIWVEARKQQQPLASFQNEVQ--PSTRHFYDALQGARTAFILECKKASPS  60

Query  84   KGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDFLID  143
            KGVIR DF+PA IA  Y+   +A +SVLTD  +FQG+   + I  Q    P L KDF+ID
Sbjct  61   KGVIRDDFDPARIAAIYKHYASA-ISVLTDEKYFQGSFNFLPIVSQIAPQPILCKDFIID  119

Query  144  PYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKLSEQ  203
            PY +  AR  QAD  LL+++ L D Q  +++  A   ++ VL EV +E+E ERA+ L  +
Sbjct  120  PYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEEQERAIALGAK  179

Query  204  CLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFLVGE  263
             ++G+NNR+L+   +DLN +  L   L  +  +++ESGI T   V+ +  H  + FL+G 
Sbjct  180  -VVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVREL-SHFANGFLIGS  237

Query  264  SFM  266
            + M
Sbjct  238  ALM  240


> B4YQR5 Indole-3-glycerol phosphate synthase / N-(5'-phosphoribosyl)anthranilate 
isomerase [Serratia symbiotica]
Length=453

 Score =  149 bits (377),  Expect = 2e-44
 Identities = 87/248 (35%), Positives = 147/248 (59%), Gaps = 5/248 (2%)

Query  21   IQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEIKKA  80
            ++ T+L  I+  K + +  R  ++ L   +   K     R F  +L+  +P  I E KKA
Sbjct  1    MKETVLENIIADKLQWIVMRQTRQPLASFQY--KIIASNRSFYAALQKTKPAFILECKKA  58

Query  81   SPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDF  140
            SPSKG+IR +F+PA IA  Y+   AA +SVLTD  +FQG+ + +++       P L KD 
Sbjct  59   SPSKGLIRKNFDPASIALAYKDF-AAVISVLTDEKYFQGSVDFLSVVSNTVMQPVLCKDI  117

Query  141  LIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKL  200
            +IDPY +  AR   AD ILL+++ L+++Q  ++S  A + ++ +L EV  E+ELERAL L
Sbjct  118  IIDPYQIYLARLYSADAILLMLSVLNNEQYRQLSDVAHDLNMGILTEVVSEEELERALAL  177

Query  201  SEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFL  260
              Q ++G+NNR+L    +DL+ + +L   + P   +++ESGI     ++ + ++ ++ FL
Sbjct  178  GAQ-VIGINNRDLHDLSIDLDRTRQLAMHIPPGITVISESGINQYSQIRKLNQY-VNGFL  235

Query  261  VGESFMKQ  268
            +G + M +
Sbjct  236  IGSALMME  243


 Score = 18.1 bits (35),  Expect = 6.1
 Identities = 6/15 (40%), Positives = 11/15 (73%), Gaps = 0/15 (0%)

Query  39   DRLKQRNLKDVEQWV  53
            DRL  RN+  ++++V
Sbjct  364  DRLPSRNIYHIDRFV  378



Lambda      K        H        a         alpha
   0.321    0.136    0.384    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1502494


  Database: 2499b09e159f3f3daf2c4ca5b425808b.TrEMBL.fasta
    Posted date:  Sep 19, 2020  11:22 AM
  Number of letters in database: 7,513
  Number of sequences in database:  25



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40