ACIAD2463 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 539fd3702f0839fc179c1903dcee62f1.SwissProt.fasta
           22 sequences; 6,054 total letters



Query= ACIAD2463

Length=286
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P00911 Indole-3-glycerol phosphate synthase [Acinetobacter bayl...   526    0.0   
  B7I441 Indole-3-glycerol phosphate synthase [Acinetobacter baum...   468    2e-170
  A3M785 Indole-3-glycerol phosphate synthase [Acinetobacter baum...   468    2e-170
  B0VBS1 Indole-3-glycerol phosphate synthase [Acinetobacter baum...   468    2e-170
  B2HVE7 Indole-3-glycerol phosphate synthase [Acinetobacter baum...   467    6e-170
  B0VUS0 Indole-3-glycerol phosphate synthase [Acinetobacter baum...   467    6e-170
  B4SLE8 Indole-3-glycerol phosphate synthase [Stenotrophomonas m...   278    6e-96 
  C1DHY7 Indole-3-glycerol phosphate synthase [Azotobacter vinela...   273    6e-94 
  A4VHK1 Indole-3-glycerol phosphate synthase [Pseudomonas stutze...   274    6e-94 
  A4XZC5 Indole-3-glycerol phosphate synthase [Pseudomonas mendoc...   272    2e-93 
  B2FKL1 Indole-3-glycerol phosphate synthase [Stenotrophomonas m...   271    3e-93 
  Q3K5V4 Indole-3-glycerol phosphate synthase [Pseudomonas fluore...   271    5e-93 
  A6UZF2 Indole-3-glycerol phosphate synthase [Pseudomonas aerugi...   271    7e-93 
  P20577 Indole-3-glycerol phosphate synthase [Pseudomonas aerugi...   270    3e-92 
  P20578 Indole-3-glycerol phosphate synthase [Pseudomonas putida]     267    2e-91 
  Q02584 Indole-3-glycerol phosphate synthase [Rhodobacter capsul...   226    1e-75 
  P94327 Indole-3-glycerol phosphate synthase [Bradyrhizobium dia...   221    3e-73 
  P26938 Indole-3-glycerol phosphate synthase [Azospirillum brasi...   220    3e-73 
  Q9ZFA7 Indole-3-glycerol phosphate synthase [Rhodobacter sphaer...   219    7e-73 
  Q9XBM3 Indole-3-glycerol phosphate synthase [Zymomonas mobilis ...   219    1e-72 
  P49572 Indole-3-glycerol phosphate synthase, chloroplastic [Ara...   196    4e-62 
  P03964 Indole-3-glycerol phosphate synthase [Bacillus subtilis ...   175    5e-56 


> P00911 Indole-3-glycerol phosphate synthase [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=268

 Score =  526 bits (1354),  Expect = 0.0
 Identities = 268/268 (100%), Positives = 268/268 (100%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI
Sbjct  1    MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR
Sbjct  61   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA
Sbjct  121  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFTELFGVPKLV
Sbjct  241  SFLVGESFMKQPRPDQAFTELFGVPKLV  268


> B7I441 Indole-3-glycerol phosphate synthase [Acinetobacter baumannii 
(strain AB0057)]
Length=268

 Score =  468 bits (1204),  Expect = 2e-170
 Identities = 236/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALQHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNT++RLKKLL  SRLL+TESGIATP DV++MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTTIRLKKLLPASRLLITESGIATPDDVRMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> A3M785 Indole-3-glycerol phosphate synthase [Acinetobacter baumannii 
(strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 
/ 5377)]
Length=268

 Score =  468 bits (1204),  Expect = 2e-170
 Identities = 236/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALQHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNT++RLKKLL  SRLL+TESGIATP DV++MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTTIRLKKLLPASRLLITESGIATPDDVRMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> B0VBS1 Indole-3-glycerol phosphate synthase [Acinetobacter baumannii 
(strain AYE)]
Length=268

 Score =  468 bits (1204),  Expect = 2e-170
 Identities = 236/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALQHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNT++RLKKLL  SRLL+TESGIATP DV++MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTTIRLKKLLPASRLLITESGIATPDDVRMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> B2HVE7 Indole-3-glycerol phosphate synthase [Acinetobacter baumannii 
(strain ACICU)]
Length=268

 Score =  467 bits (1201),  Expect = 6e-170
 Identities = 235/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHEELA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEELAARLKQRNLQDVEELAKAATPVRGFANALQHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIA+QYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAEQYEQAGAACLSVLTDVDFFQGADENIAIARNHCALPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNT++RLKKLL  SRLL+TESGIATP DV++MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTTIRLKKLLPASRLLITESGIATPDDVRMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> B0VUS0 Indole-3-glycerol phosphate synthase [Acinetobacter baumannii 
(strain SDF)]
Length=268

 Score =  467 bits (1201),  Expect = 6e-170
 Identities = 235/268 (88%), Positives = 251/268 (94%), Gaps = 0/268 (0%)

Query  18   MIQIQNTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPGVIAEI  77
            MI IQNTILGKIVDRKHE+LA RLKQRNL+DVE+  K A PVRGFA +L+ KRPGVIAEI
Sbjct  1    MINIQNTILGKIVDRKHEDLAARLKQRNLQDVEELAKAATPVRGFANALQHKRPGVIAEI  60

Query  78   KKASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALR  137
            KKASPSKG+IRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIAR HC+LPALR
Sbjct  61   KKASPSKGIIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARNHCTLPALR  120

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            KDFL+DPYNVVEARAL ADCILLIVACLSDQQLEEMSKTAFE+ LDVLVEVHDE+ELERA
Sbjct  121  KDFLVDPYNVVEARALHADCILLIVACLSDQQLEEMSKTAFEHQLDVLVEVHDEEELERA  180

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIH  257
            LKLSEQCLLGVNNRNLKTFDVDLNT++RLKKLL  SRLL+TESGIATP DV++MQEHDIH
Sbjct  181  LKLSEQCLLGVNNRNLKTFDVDLNTTIRLKKLLPASRLLITESGIATPDDVRMMQEHDIH  240

Query  258  SFLVGESFMKQPRPDQAFTELFGVPKLV  285
            SFLVGESFMKQPRPDQAFT LFG P+ V
Sbjct  241  SFLVGESFMKQPRPDQAFTALFGQPQTV  268


> B4SLE8 Indole-3-glycerol phosphate synthase [Stenotrophomonas 
maltophilia (strain R551-3)]
Length=264

 Score =  278 bits (712),  Expect = 6e-96
 Identities = 151/259 (58%), Positives = 186/259 (72%), Gaps = 5/259 (2%)

Query  25   ILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSK----RPGVIAEIKKA  80
            IL  I+ RK EE+A R  QR L+D++  V  APPVRGF ++L++      P VIAE+KKA
Sbjct  4    ILQTILARKAEEVAQRRAQRPLEDLQVAVASAPPVRGFVRALQAAVANGDPAVIAEVKKA  63

Query  81   SPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDF  140
            SPSKGVIR DF PA+IA  YE  GA+CLSVLTDVDFFQGAD  +  AR  C+LP LRKDF
Sbjct  64   SPSKGVIRPDFRPADIAVSYEFGGASCLSVLTDVDFFQGADAYLQQARDACTLPVLRKDF  123

Query  141  LIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKL  200
            +ID Y V EAR L ADCILLIVA L D QL  +S+ A    +DVLVEVHD  ELERAL++
Sbjct  124  VIDAYQVYEARVLGADCILLIVAALDDTQLATLSELAMSLGMDVLVEVHDIDELERALQV  183

Query  201  SEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFL  260
                ++G+NNRNL+TF+V L T+L ++K +   RLLVTESGI  PQDV LM++  IHSFL
Sbjct  184  PAP-MIGINNRNLRTFEVSLQTTLDMQKAVPRDRLLVTESGILGPQDVALMRDAGIHSFL  242

Query  261  VGESFMKQPRPDQAFTELF  279
            VGE+FM+   P +   +LF
Sbjct  243  VGEAFMRVEEPGEGLRQLF  261


> C1DHY7 Indole-3-glycerol phosphate synthase [Azotobacter vinelandii 
(strain DJ / ATCC BAA-1303)]
Length=266

 Score =  273 bits (699),  Expect = 6e-94
 Identities = 150/260 (58%), Positives = 185/260 (71%), Gaps = 5/260 (2%)

Query  24   TILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLR----SKRPGVIAEIKK  79
            T+L KI+ RK EE+A+R  +  L +VE   + A   RGFA++LR    SK P VIAE+KK
Sbjct  5    TVLEKIIARKLEEVAERSARVPLAEVEALARSASAPRGFAEALRAQVESKEPAVIAEVKK  64

Query  80   ASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKD  139
            ASPSKGV+R  F PAEIA+ YE+ GA CLSVLTDVDFFQG+D  +  AR  C LP +RKD
Sbjct  65   ASPSKGVLREHFVPAEIAKSYEEGGATCLSVLTDVDFFQGSDAYLQEARAACGLPVIRKD  124

Query  140  FLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALK  199
            FLIDPY VVEARAL ADC+LLIVA L D Q+ E++ TA E  LDVLVEVHD  ELERAL+
Sbjct  125  FLIDPYQVVEARALGADCVLLIVAALGDAQMLELAATAKEVGLDVLVEVHDGTELERALQ  184

Query  200  LSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSF  259
            L E  L+G+NNRNL TF+V L T+L L   +   RL+VTESGI    DV+LM+   +++F
Sbjct  185  L-ETPLIGINNRNLHTFEVSLETTLDLLPKVPRERLVVTESGILNRADVELMEVSGVYAF  243

Query  260  LVGESFMKQPRPDQAFTELF  279
            LVGE+FM+  +P      LF
Sbjct  244  LVGEAFMRAEKPGAELRRLF  263


> A4VHK1 Indole-3-glycerol phosphate synthase [Pseudomonas stutzeri 
(strain A1501)]
Length=278

 Score =  274 bits (700),  Expect = 6e-94
 Identities = 149/260 (57%), Positives = 186/260 (72%), Gaps = 5/260 (2%)

Query  24   TILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFA----QSLRSKRPGVIAEIKK  79
            T+L KI+ RK EE+A+R ++  L ++EQ    A PVRGFA    Q + +K P VIAE+KK
Sbjct  5    TVLEKIIARKLEEVAERSRRIGLAELEQQAAIADPVRGFAAALEQRVNAKEPAVIAEVKK  64

Query  80   ASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKD  139
            ASPSKGVIR  F PAEIA  YE  GAACLSVLTD+DFFQGAD  +  AR  CSLP +RKD
Sbjct  65   ASPSKGVIRDPFLPAEIAAGYEAGGAACLSVLTDIDFFQGADAYLQQARAACSLPVIRKD  124

Query  140  FLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALK  199
            F+IDPY VVEARAL ADCILLIVA L D ++ E++  A  + LDVLVEVHD  ELERAL+
Sbjct  125  FMIDPYQVVEARALGADCILLIVAALDDARMHELAAVAKAHGLDVLVEVHDGDELERALR  184

Query  200  LSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSF  259
            L E  L+G+NNRNL TF+V L T+L L   +   RL++TESGI    DV+LM+ + +++F
Sbjct  185  L-ETPLVGINNRNLHTFEVSLETTLDLLPRVPKDRLVITESGILNRADVELMEINQVYAF  243

Query  260  LVGESFMKQPRPDQAFTELF  279
            LVGE+FM+  +P      LF
Sbjct  244  LVGEAFMRAEQPGVELQRLF  263


> A4XZC5 Indole-3-glycerol phosphate synthase [Pseudomonas mendocina 
(strain ymp)]
Length=279

 Score =  272 bits (696),  Expect = 2e-93
 Identities = 144/260 (55%), Positives = 185/260 (71%), Gaps = 4/260 (2%)

Query  24   TILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRS----KRPGVIAEIKK  79
            T+L KIV RK EE+A R  Q +L ++E   + A   RGFA++L      K+P VIAEIKK
Sbjct  5    TVLEKIVARKFEEVAARRVQVSLAELEAAARAADAPRGFARALLEQAARKQPAVIAEIKK  64

Query  80   ASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKD  139
            ASPSKGV+RADF PA+IA+ YE  GA CLSVLTD+DFFQGADE +  AR  C+LP +RKD
Sbjct  65   ASPSKGVLRADFVPADIARSYEAGGATCLSVLTDIDFFQGADEYLQQARAACALPVIRKD  124

Query  140  FLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALK  199
            F++DPY +VEARAL ADC+LLIV+CL D ++ E++  A +  LDVLVEVHD  ELERAL 
Sbjct  125  FMVDPYQIVEARALGADCVLLIVSCLDDVRMAELAAVAKDVGLDVLVEVHDGNELERALN  184

Query  200  LSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSF  259
              +  L+G+NNRNL TF+V L T+L L   +   RL+VTESGI    DV+LM+  ++++F
Sbjct  185  TLDTPLVGINNRNLHTFEVSLETTLDLLPRIPRERLVVTESGILNRADVELMEISEVYAF  244

Query  260  LVGESFMKQPRPDQAFTELF  279
            LVGE+FM+   P      LF
Sbjct  245  LVGEAFMRAESPGAELQRLF  264


> B2FKL1 Indole-3-glycerol phosphate synthase [Stenotrophomonas 
maltophilia (strain K279a)]
Length=264

 Score =  271 bits (694),  Expect = 3e-93
 Identities = 147/259 (57%), Positives = 186/259 (72%), Gaps = 5/259 (2%)

Query  25   ILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSK----RPGVIAEIKKA  80
            IL  I+ RK EE+A R  QR L++++  V  APPVRGF ++L++      P VIAE+KKA
Sbjct  4    ILQTILARKAEEVAQRRAQRPLEELQAAVASAPPVRGFVRALQAAVANGDPAVIAEVKKA  63

Query  81   SPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDF  140
            SPSKGVIR DF PA+IA  YE  GA+CLSVLTDVDFFQGAD  +  AR+ C+LP LRKDF
Sbjct  64   SPSKGVIRPDFRPADIAVSYEFGGASCLSVLTDVDFFQGADAYLQQAREACTLPVLRKDF  123

Query  141  LIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKL  200
            +ID Y V EAR L ADCILLIVA L D QL  +S+ A    +DVLVEVHD  ELERAL++
Sbjct  124  VIDAYQVYEARVLGADCILLIVAALDDTQLATLSELALSLGMDVLVEVHDIDELERALQV  183

Query  201  SEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFL  260
                ++G+NNRNL+TF+V L T+L +++ +   RLLVTESGI   QDV LM++  IH+FL
Sbjct  184  PAP-MIGINNRNLRTFEVSLQTTLDMQQAVPRDRLLVTESGILGLQDVALMRDAGIHAFL  242

Query  261  VGESFMKQPRPDQAFTELF  279
            VGE+FM+   P +   +LF
Sbjct  243  VGEAFMRVEEPGEGLRQLF  261


> Q3K5V4 Indole-3-glycerol phosphate synthase [Pseudomonas fluorescens 
(strain Pf0-1)]
Length=278

 Score =  271 bits (694),  Expect = 5e-93
 Identities = 146/267 (55%), Positives = 188/267 (70%), Gaps = 8/267 (3%)

Query  24   TILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSL----RSKRPGVIAEIKK  79
            T+L  I+ RK +E+A+R  + +L ++E   K A   RGFAQ+L    + K+P VIAEIKK
Sbjct  5    TVLENILARKFQEVAERSARVSLSELESLAKAADAPRGFAQALLAQAKKKQPAVIAEIKK  64

Query  80   ASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKD  139
            ASPSKGVIR +F PA+IA+ YE+ GA CLSVLTD+D+FQGAD  +  AR  CSLP +RKD
Sbjct  65   ASPSKGVIRENFVPADIAKSYEKGGATCLSVLTDIDYFQGADAYLQQARVACSLPVIRKD  124

Query  140  FLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALK  199
            F+IDPY +VEARAL ADC+LLIV+ L D ++ E++  A +  LDVLVEVHD  ELERALK
Sbjct  125  FMIDPYQIVEARALGADCVLLIVSALDDVKMAELASVAKDVGLDVLVEVHDGDELERALK  184

Query  200  LSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSF  259
              +  L+GVNNRNL TFDV L T+L L   +   RL++TESGI    DV+LM+  D+++F
Sbjct  185  TLDTPLVGVNNRNLHTFDVSLETTLDLLPRIPRDRLVITESGILNRADVELMEISDVYAF  244

Query  260  LVGESFMKQPRPDQAFTELF----GVP  282
            LVGE+FM+   P      LF    GVP
Sbjct  245  LVGEAFMRAENPGIELQRLFFPERGVP  271


> A6UZF2 Indole-3-glycerol phosphate synthase [Pseudomonas aeruginosa 
(strain PA7)]
Length=278

 Score =  271 bits (693),  Expect = 7e-93
 Identities = 147/260 (57%), Positives = 183/260 (70%), Gaps = 4/260 (2%)

Query  24   TILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSL----RSKRPGVIAEIKK  79
            T+L KI+ RK EE+A+R  + NL +VE+  + A   RGFA +L    R K P VIAEIKK
Sbjct  5    TVLQKILARKAEEVAERRARVNLAEVERLARSADAPRGFANALLERARRKEPAVIAEIKK  64

Query  80   ASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKD  139
            ASPSKGV+R  F PAEIA+ YE  GAACLSVLTDVDFFQGAD  +  AR  C+LP +RKD
Sbjct  65   ASPSKGVLREHFVPAEIARSYEAGGAACLSVLTDVDFFQGADAYLKEARAACALPVIRKD  124

Query  140  FLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALK  199
            F+IDPY +VEARA+ ADCILLIV+ L D  + E++ TA    LDVLVEVHD  ELERALK
Sbjct  125  FMIDPYQIVEARAIGADCILLIVSALDDMLMGELAATAKSVGLDVLVEVHDGAELERALK  184

Query  200  LSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSF  259
              +  L+G+NNRNL TF+V L T+L L   +   RL+VTESGI    DV+LM+  ++++F
Sbjct  185  TLDTPLVGINNRNLHTFEVSLETTLDLLPEIPRDRLVVTESGILNRADVELMEVSEVYAF  244

Query  260  LVGESFMKQPRPDQAFTELF  279
            LVGE+FM+   P      LF
Sbjct  245  LVGEAFMRADDPGLELKRLF  264


> P20577 Indole-3-glycerol phosphate synthase [Pseudomonas aeruginosa 
(strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 
/ LMG 12228 / 1C / PRS 101 / PAO1)]
Length=278

 Score =  270 bits (689),  Expect = 3e-92
 Identities = 146/260 (56%), Positives = 183/260 (70%), Gaps = 4/260 (2%)

Query  24   TILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSL----RSKRPGVIAEIKK  79
            T+L KI+ RK EE+A+R  + NL +VE+  + A   RGFA +L    + K P VIAEIKK
Sbjct  5    TVLQKILARKAEEVAERRARVNLAEVERLARSADAPRGFANALLERAKRKEPAVIAEIKK  64

Query  80   ASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKD  139
            ASPSKGV+R  F PAEIA+ YE  GAACLSVLTDVDFFQGAD  +  AR  C+LP +RKD
Sbjct  65   ASPSKGVLREHFVPAEIARSYEAGGAACLSVLTDVDFFQGADAYLKEARAACALPVIRKD  124

Query  140  FLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALK  199
            F+IDPY +VEARA+ ADCILLIV+ L D  + E++ TA    LDVLVEVHD  ELERALK
Sbjct  125  FMIDPYQIVEARAIGADCILLIVSALDDVLMAELAATAKSVGLDVLVEVHDGTELERALK  184

Query  200  LSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSF  259
              +  L+G+NNRNL TF+V L T+L L   +   RL+VTESGI    DV+LM+  ++++F
Sbjct  185  TLDTPLVGINNRNLHTFEVSLETTLDLLPEIPRDRLVVTESGILNRADVELMEVSEVYAF  244

Query  260  LVGESFMKQPRPDQAFTELF  279
            LVGE+FM+   P      LF
Sbjct  245  LVGEAFMRADDPGLELKRLF  264


> P20578 Indole-3-glycerol phosphate synthase [Pseudomonas putida]
Length=277

 Score =  267 bits (683),  Expect = 2e-91
 Identities = 143/260 (55%), Positives = 185/260 (71%), Gaps = 4/260 (2%)

Query  24   TILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSL----RSKRPGVIAEIKK  79
            T+L +I+ RK +E+A+R  + +L ++E+  K A   RGFA +L    + K+P VIAEIKK
Sbjct  5    TVLERIIARKFQEVAERSARVSLAELERLAKTADAPRGFANALIEQAKRKQPAVIAEIKK  64

Query  80   ASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKD  139
            ASPSKGVIR  F PAEIA  YE+ GA CLSVLTDVD+FQGADE +  AR   SLP +RKD
Sbjct  65   ASPSKGVIREHFVPAEIAVSYEKGGATCLSVLTDVDYFQGADEYLQQARAAVSLPVIRKD  124

Query  140  FLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALK  199
            F++DPY +VEARAL ADC+LLIV+ L D ++ E++ TA +  LDVLVEVHD  ELERALK
Sbjct  125  FMVDPYQIVEARALGADCVLLIVSALDDVKMAELAATAKDVGLDVLVEVHDGDELERALK  184

Query  200  LSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSF  259
              +  L+GVNNRNL TF+V L T+L L   +   RL +TESGI    DV+LM  ++++SF
Sbjct  185  TLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRDRLAITESGILNRADVELMAINEVYSF  244

Query  260  LVGESFMKQPRPDQAFTELF  279
            LVGE+FM+  +P      LF
Sbjct  245  LVGEAFMRAEQPGLELQRLF  264


> Q02584 Indole-3-glycerol phosphate synthase [Rhodobacter capsulatus 
(strain ATCC BAA-309 / NBRC 16581 / SB1003)]
Length=264

 Score =  226 bits (577),  Expect = 1e-75
 Identities = 129/248 (52%), Positives = 162/248 (65%), Gaps = 4/248 (2%)

Query  25   ILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRP---GVIAEIKKAS  81
            IL +I   K EE+A    + +  D+E   +   P RGFA++LR K     G+IAEIKKAS
Sbjct  4    ILDRIKAYKLEEVAAAKARVSFADLEAQARAQAPCRGFAEALRKKSAQGYGLIAEIKKAS  63

Query  82   PSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDFL  141
            PSKG+IR DF+P  +A+ YE  GAACLSVLTD   FQGA + +  AR  C+LPALRKDFL
Sbjct  64   PSKGLIRPDFDPPALARAYEDGGAACLSVLTDTPSFQGAPDYLIAARNACALPALRKDFL  123

Query  142  IDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKLS  201
             DPY V EARA  ADCIL+I+A + D    E+   A  + +DVL+EVHD  EL+RALK  
Sbjct  124  YDPYQVAEARAWGADCILIIMASVEDALAVELEAAATGWGMDVLIEVHDGAELDRALKWL  183

Query  202  EQCLLGVNNRNLKTFDVDLNTSLRLKK-LLDPSRLLVTESGIATPQDVQLMQEHDIHSFL  260
            +  LLGVNNRNLKTF+V L+ + +L   +L   R LV ESGI TP D+  M       FL
Sbjct  184  KSPLLGVNNRNLKTFEVTLDVTRQLAPVILAEGRELVCESGIFTPADMAAMAAVGARRFL  243

Query  261  VGESFMKQ  268
            +GES M+Q
Sbjct  244  IGESLMRQ  251


> P94327 Indole-3-glycerol phosphate synthase [Bradyrhizobium diazoefficiens 
(strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 
110)]
Length=273

 Score =  221 bits (562),  Expect = 3e-73
 Identities = 123/248 (50%), Positives = 163/248 (66%), Gaps = 5/248 (2%)

Query  25   ILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRPG----VIAEIKKA  80
            IL KI   K EE+A   + + L  VE   K     RGF +++++K       +IAE+KKA
Sbjct  4    ILTKIETYKREEIAAAKRAQPLSVVEATAKAQGAPRGFLRAIKAKHTNGDFALIAEVKKA  63

Query  81   SPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDF  140
            SPSKG+IRADF+P ++A+ YE  GAACLSVLTD   FQG  + +  AR   SLP LRKDF
Sbjct  64   SPSKGLIRADFDPPQLAKAYEAGGAACLSVLTDTPSFQGHLDFMVAARAATSLPVLRKDF  123

Query  141  LIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKL  200
            + D Y VVEARA  ADCIL+I+A L D   +++  TA  + +DVL+E+HD  EL+RALKL
Sbjct  124  MFDAYQVVEARAHGADCILIIMAALDDATAKDLEDTAIAFGMDVLIEIHDRAELDRALKL  183

Query  201  SEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFL  260
                ++GVNNRNL+TF+  L TS  L  L+   RL+V ESGI TP D+  ++   + +FL
Sbjct  184  RSP-MIGVNNRNLRTFETTLATSEALAPLIPGDRLMVGESGIFTPADLARLERVGMSTFL  242

Query  261  VGESFMKQ  268
            VGES M+Q
Sbjct  243  VGESLMRQ  250


> P26938 Indole-3-glycerol phosphate synthase [Azospirillum brasilense]
Length=262

 Score =  220 bits (561),  Expect = 3e-73
 Identities = 124/248 (50%), Positives = 157/248 (63%), Gaps = 5/248 (2%)

Query  25   ILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSK----RPGVIAEIKKA  80
            +L +I D K   +  R   R L  VE   + A P  GF ++LR      R G+IAEIKKA
Sbjct  4    VLTRICDDKRALVQARKSARPLSAVEDDARSADPAGGFIRALRRTVDGGRYGLIAEIKKA  63

Query  81   SPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDF  140
            SPSKG+IR DF+P  +A+ Y   GA CLSVLTD  +FQG D+ +  AR    LP LRKDF
Sbjct  64   SPSKGLIRPDFDPPSLARAYRGGGATCLSVLTDEPYFQGCDDYLLSARAAVDLPVLRKDF  123

Query  141  LIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKL  200
            ++DPY + E+RAL ADCIL+I+A LSD Q  E+   A  + LDVLVEVH+ +EL+RAL L
Sbjct  124  MVDPYQIAESRALGADCILIIMAALSDAQAVEIEDAAIAWGLDVLVEVHNREELDRALAL  183

Query  201  SEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFL  260
                LLGVNNRNLKT  VD+ T+  L   +   R+LV ESG+ +P D+  M       FL
Sbjct  184  KTP-LLGVNNRNLKTLAVDIATTEELAAHVPADRMLVAESGLYSPADLSRMAAVGARCFL  242

Query  261  VGESFMKQ  268
            VGES M+Q
Sbjct  243  VGESLMRQ  250


> Q9ZFA7 Indole-3-glycerol phosphate synthase [Rhodobacter sphaeroides 
(strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)]
Length=270

 Score =  219 bits (559),  Expect = 7e-73
 Identities = 125/263 (48%), Positives = 168/263 (64%), Gaps = 4/263 (2%)

Query  23   NTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRP---GVIAEIKK  79
            +TIL +I   K EE+A R  +R L  VE   + AP  RGFA++L +      G+IAEIKK
Sbjct  2    STILDRIKAYKLEEIAARKAERPLVAVEDAARAAPAPRGFARALSTAAATGYGLIAEIKK  61

Query  80   ASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKD  139
            ASPSKG+IR DF+   +A+ YE  GA CLSVLTD   FQGAD+ +  AR+   LP LRKD
Sbjct  62   ASPSKGLIREDFDVPALARAYETGGATCLSVLTDGPSFQGADDFLRQAREAVKLPCLRKD  121

Query  140  FLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALK  199
            FL D Y V EARAL ADCIL+I+A ++D Q  E+   A  + +DVLVEVH  +EL RA  
Sbjct  122  FLYDTYQVAEARALGADCILIIMASVTDSQALELEAAASHWGMDVLVEVHSREELARAEH  181

Query  200  LSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSF  259
            L  + L+G+NNRNL TF+V L+ +  L + +   RL+V+ESG+ TP+D+  +  +    F
Sbjct  182  LKSR-LIGINNRNLDTFEVSLDVTRDLARRVPEDRLIVSESGLHTPEDLADLARYGARCF  240

Query  260  LVGESFMKQPRPDQAFTELFGVP  282
            L+GES M+Q   + A   +   P
Sbjct  241  LIGESLMRQADVEAATRAILADP  263


> Q9XBM3 Indole-3-glycerol phosphate synthase [Zymomonas mobilis 
subsp. pomaceae (strain ATCC 29192 / JCM 10191 / NBRC 13757 
/ NCIMB 11200 / NRRL B-4491)]
Length=264

 Score =  219 bits (557),  Expect = 1e-72
 Identities = 122/263 (46%), Positives = 163/263 (62%), Gaps = 5/263 (2%)

Query  23   NTILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRP----GVIAEIK  78
            + IL +I   K   +AD+ K  +  D+    K     RGF  +L  KR      +IAEIK
Sbjct  2    SNILTEICATKARHVADKKKHISETDLYNLTKNQTAPRGFRAALDKKRAEGKFSLIAEIK  61

Query  79   KASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRK  138
            KASPSKG+IR DF P   A+ Y++ GAACLSVLTD  +FQG ++ +  AR   +LP LRK
Sbjct  62   KASPSKGLIRPDFEPILHARSYQEGGAACLSVLTDQPYFQGHEDYLIAARNEVTLPVLRK  121

Query  139  DFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERAL  198
            DF+IDP+ V EARA+ AD IL+IVA L D Q++E+   A EY +D L+EVH  QE+ERAL
Sbjct  122  DFMIDPWQVTEARAIGADAILIIVAALEDNQMQEIEAAALEYGMDALIEVHSTQEMERAL  181

Query  199  KLSEQCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHS  258
            +L  + L+GVNNR+L+ F V  + +  L K        V ESGI T  D+  M +H+I  
Sbjct  182  RLKSR-LIGVNNRDLRDFSVSFDRTYELIKQAPKECTFVAESGIQTHDDLVAMNQHNIGC  240

Query  259  FLVGESFMKQPRPDQAFTELFGV  281
            FLVGE+ M+Q    QA  +L G+
Sbjct  241  FLVGETLMRQKDVKQATRDLLGL  263


> P49572 Indole-3-glycerol phosphate synthase, chloroplastic [Arabidopsis 
thaliana]
Length=402

 Score =  196 bits (497),  Expect = 4e-62
 Identities = 113/269 (42%), Positives = 171/269 (64%), Gaps = 14/269 (5%)

Query  25   ILGKIVDRKHEELADRLKQRNLKDV-EQWVKEAPPVRGFAQSLRSKR-----PGVIAEIK  78
            IL +I   K  E++ R+K+ N  DV ++ V++APP R F  +LR        PG+IAE+K
Sbjct  129  ILEEITWYKDVEVS-RMKELNPLDVLKKAVEDAPPTRDFVGALRMAHKRTGFPGLIAEVK  187

Query  79   KASPSKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENI-AIARQHCSLPALR  137
            KASPS+G+++ +F+P EIAQ YE+ GAACLSVLTD  +FQG  EN+ AI       P L 
Sbjct  188  KASPSRGILKENFDPVEIAQAYEKGGAACLSVLTDQKYFQGGFENLEAIRSAGVKCPLLC  247

Query  138  KDFLIDPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERA  197
            K+F++DP+ +  AR   AD +LLI A L+D ++  + K   +  L  LVEVHDE+E+ R 
Sbjct  248  KEFVVDPWQIYYARTKGADAVLLIAAVLADLEITFLLKICKKLSLAALVEVHDEREMGRV  307

Query  198  LKLSEQCLLGVNNRNLKTFDVDLNTSLRL------KKLLDPSRLLVTESGIATPQDVQLM  251
            L +    L+G+NNR+L+TF+VD++ + +L      +++ +   ++V ESG+ TP D+  +
Sbjct  308  LGIEGIELVGINNRSLETFEVDISNTKKLLEGEHGRQIRERDMIVVGESGLFTPDDIAYV  367

Query  252  QEHDIHSFLVGESFMKQPRPDQAFTELFG  280
            Q   + + LVGES +KQ  P++    LFG
Sbjct  368  QAAGVKAVLVGESIVKQNDPEKGIAGLFG  396


> P03964 Indole-3-glycerol phosphate synthase [Bacillus subtilis 
(strain 168)]
Length=249

 Score =  175 bits (444),  Expect = 5e-56
 Identities = 108/257 (42%), Positives = 152/257 (59%), Gaps = 12/257 (5%)

Query  25   ILGKIVDRKHEELADRLKQRNLKDVEQWVKEAPPVRGFAQSLRSKRP--GVIAEIKKASP  82
            +L KI+ +K EE+         K +   V++    R F ++L S     G+IAE+KKASP
Sbjct  1    MLEKIIKQKKEEV---------KTLVLPVEQPFEKRSFKEALASPNRFIGLIAEVKKASP  51

Query  83   SKGVIRADFNPAEIAQQYEQAGAACLSVLTDVDFFQGADENIAIARQHCSLPALRKDFLI  142
            SKG+I+ DF P +IA+ YE A A  +SVLTD  FFQG +  ++  ++  S+P LRKDF I
Sbjct  52   SKGLIKEDFVPVQIAKDYEAAKADAISVLTDTPFFQGENSYLSDVKRAVSIPVLRKDF-I  110

Query  143  DPYNVVEARALQADCILLIVACLSDQQLEEMSKTAFEYDLDVLVEVHDEQELERALKLSE  202
            D   V E+R + AD ILLI   L    L E+   A E  +DVLVEVHD   LE+ LK+  
Sbjct  111  DSLQVEESRRIGADAILLIGEVLDPLHLHELYLEAGEKGMDVLVEVHDASTLEQILKVFT  170

Query  203  QCLLGVNNRNLKTFDVDLNTSLRLKKLLDPSRLLVTESGIATPQDVQLMQEHDIHSFLVG  262
              +LGVNNRNLKTF+  +  + ++  L+    LLV+ESGI + + +  + EH   + L+G
Sbjct  171  PDILGVNNRNLKTFETSVKQTEQIASLVPKESLLVSESGIGSLEHLTFVNEHGARAVLIG  230

Query  263  ESFMKQPRPDQAFTELF  279
            ES M+Q    +A   LF
Sbjct  231  ESLMRQTSQRKAIHALF  247



Lambda      K        H        a         alpha
   0.321    0.136    0.384    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1210080


  Database: 539fd3702f0839fc179c1903dcee62f1.SwissProt.fasta
    Posted date:  Sep 19, 2020  11:08 AM
  Number of letters in database: 6,054
  Number of sequences in database:  22



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40