ACIAD2370 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 077121096718ce5a0777d84b47fa87a7.TrEMBL.fasta
           14 sequences; 4,729 total letters



Query= ACIAD2370

Length=341
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F9W5 APH domain-containing protein [Acinetobacter baylyi (str...   691    0.0  
  A0A1P8EFK8 Phosphotransferase [Acinetobacter soli]                   548    0.0  
  N9AFY4 APH domain-containing protein [Acinetobacter soli NIPH 2...   548    0.0  
  A0A0M1I4K1 Phosphotransferase [Acinetobacter sp. C15]                547    0.0  
  A0A1I6T072 APH domain-containing protein [Acinetobacter bohemicus]   540    0.0  
  A0A1Y3DFK4 Phosphotransferase [Acinetobacter sp. ANC 4973]           538    0.0  
  N8QBT1 APH domain-containing protein [Acinetobacter bohemicus A...   538    0.0  
  A0A241WM47 Phosphotransferase [Acinetobacter sp. ANC 4654]           538    0.0  
  A0A1Y3CKV3 Phosphotransferase [Acinetobacter sp. ANC 4470]           537    0.0  
  A0A1H3I9A4 APH domain-containing protein [Acinetobacter kyonggi...   536    0.0  
  A0A1C4GUU4 APH domain-containing protein [Acinetobacter albensis]    535    0.0  
  A0A241VC72 Phosphotransferase [Acinetobacter sp. ANC 4218]           533    0.0  
  Q5RLL0 OrfT [Pseudomonas fluorescens]                                206    2e-66
  Q9X4N9 Aminoglycoside phosphotransferase [Pseudomonas aeruginosa]    184    7e-58


> Q6F9W5 APH domain-containing protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=340

 Score =  691 bits (1783),  Expect = 0.0
 Identities = 339/340 (99%), Positives = 340/340 (100%), Gaps = 0/340 (0%)

Query  1    LQMNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDC  60
            +QMNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDC
Sbjct  1    MQMNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDC  60

Query  61   VPFVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQL  120
            VPFVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQL
Sbjct  61   VPFVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQL  120

Query  121  IHLQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALN  180
            IHLQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALN
Sbjct  121  IHLQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALN  180

Query  181  QPQVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITW  240
            QPQVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITW
Sbjct  181  QPQVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITW  240

Query  241  FEMFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVM  300
            FEMFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVM
Sbjct  241  FEMFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVM  300

Query  301  WYLLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEVVKK  340
            WYLLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEVVKK
Sbjct  301  WYLLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEVVKK  340


> A0A1P8EFK8 Phosphotransferase [Acinetobacter soli]
Length=338

 Score =  548 bits (1412),  Expect = 0.0
 Identities = 270/336 (80%), Positives = 292/336 (87%), Gaps = 0/336 (0%)

Query  3    MNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  62
            MNTQREQLIHIWLTS+LNS +F+IQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP
Sbjct  1    MNTQREQLIHIWLTSILNSSDFRIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  60

Query  63   FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIH  122
            FV IDEFFDRHGVRVPHI+AKDL QGFLLLEDFGDVLLSTLLN QTV+ YYLQ+F QLIH
Sbjct  61   FVQIDEFFDRHGVRVPHIVAKDLAQGFLLLEDFGDVLLSTLLNEQTVDAYYLQSFKQLIH  120

Query  123  LQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALNQP  182
            LQSI  QDQFP Y++EKLMAEMHLLTEWMLP+L+IQP S EQ +IQQTF+LLA  AL QP
Sbjct  121  LQSIPPQDQFPVYSYEKLMAEMHLLTEWMLPALEIQPDSDEQQLIQQTFDLLAKNALAQP  180

Query  183  QVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITWFE  242
            QVIVHRDFHSRNLMK+  EE LGVIDFQDAVIGADTYDLISITRDAYVQW   +V  WFE
Sbjct  181  QVIVHRDFHSRNLMKLGNEETLGVIDFQDAVIGADTYDLISITRDAYVQWDPSRVYQWFE  240

Query  243  MFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWY  302
             FY LLP   K  R FE FKRDAD+MAIQRHIKILGIFVRLF RDGKS YLKDLPRVMWY
Sbjct  241  TFYTLLPAQVKVARSFETFKRDADWMAIQRHIKILGIFVRLFVRDGKSGYLKDLPRVMWY  300

Query  303  LLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEVV  338
            LL+ES+PY EL  F  ++  QV+PKFE+ YG +E V
Sbjct  301  LLEESQPYPELAEFRRYMMEQVLPKFEETYGTFESV  336


> N9AFY4 APH domain-containing protein [Acinetobacter soli NIPH 
2899]
Length=338

 Score =  548 bits (1412),  Expect = 0.0
 Identities = 270/336 (80%), Positives = 292/336 (87%), Gaps = 0/336 (0%)

Query  3    MNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  62
            MNTQREQLIHIWLTS+LNS +F+IQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP
Sbjct  1    MNTQREQLIHIWLTSILNSSDFRIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  60

Query  63   FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIH  122
            FV IDEFFDRHGVRVPHI+AKDL QGFLLLEDFGDVLLSTLLN QTV+ YYLQ+F QLIH
Sbjct  61   FVQIDEFFDRHGVRVPHIVAKDLAQGFLLLEDFGDVLLSTLLNEQTVDAYYLQSFKQLIH  120

Query  123  LQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALNQP  182
            LQSI  QDQFP Y++EKLMAEMHLLTEWMLP+L+IQP S EQ +IQQTF+LLA  AL QP
Sbjct  121  LQSIPPQDQFPVYSYEKLMAEMHLLTEWMLPALEIQPDSDEQQLIQQTFDLLAKNALAQP  180

Query  183  QVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITWFE  242
            QVIVHRDFHSRNLMK+  EE LGVIDFQDAVIGADTYDLISITRDAYVQW   +V  WFE
Sbjct  181  QVIVHRDFHSRNLMKLGNEETLGVIDFQDAVIGADTYDLISITRDAYVQWDPSRVYQWFE  240

Query  243  MFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWY  302
             FY LLP   K  R FE FKRDAD+MAIQRHIKILGIFVRLF RDGKS YLKDLPRVMWY
Sbjct  241  TFYTLLPAQVKVARSFETFKRDADWMAIQRHIKILGIFVRLFVRDGKSGYLKDLPRVMWY  300

Query  303  LLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEVV  338
            LL+ES+PY EL  F  ++  QV+PKFE+ YG +E V
Sbjct  301  LLEESQPYPELAEFRRYMMEQVLPKFEETYGTFESV  336


> A0A0M1I4K1 Phosphotransferase [Acinetobacter sp. C15]
Length=338

 Score =  547 bits (1409),  Expect = 0.0
 Identities = 269/336 (80%), Positives = 291/336 (87%), Gaps = 0/336 (0%)

Query  3    MNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  62
            MNTQREQLIHIWLTS+LNS +F+IQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP
Sbjct  1    MNTQREQLIHIWLTSILNSSDFRIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  60

Query  63   FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIH  122
            FV IDEFFDRHGVRVPHI+AKDL QGFLLLEDFGDVLLSTLLN QTV+ YYLQ+F QLIH
Sbjct  61   FVQIDEFFDRHGVRVPHIVAKDLAQGFLLLEDFGDVLLSTLLNEQTVDAYYLQSFKQLIH  120

Query  123  LQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALNQP  182
            LQSI  QDQFP Y++EKLMAEMHLLTEWMLP+L+IQP S EQ +IQQTF+ LA  AL QP
Sbjct  121  LQSIPSQDQFPVYSYEKLMAEMHLLTEWMLPALEIQPDSDEQQLIQQTFDSLAKNALAQP  180

Query  183  QVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITWFE  242
            QVIVHRDFHSRNLMK+  EE LGVIDFQDAVIGADTYDLISITRDAYVQW   +V  WFE
Sbjct  181  QVIVHRDFHSRNLMKLGNEETLGVIDFQDAVIGADTYDLISITRDAYVQWDPSRVYQWFE  240

Query  243  MFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWY  302
             FY LLP   K  R FE FKRDAD+MAIQRHIKILGIFVRLF RDGKS YLKDLPRVMWY
Sbjct  241  TFYTLLPTQVKVARSFETFKRDADWMAIQRHIKILGIFVRLFVRDGKSGYLKDLPRVMWY  300

Query  303  LLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEVV  338
            LL+ES+PY EL  F  ++  QV+PKFE+ YG +E V
Sbjct  301  LLEESQPYPELAEFRRYMMEQVLPKFEETYGTFESV  336


> A0A1I6T072 APH domain-containing protein [Acinetobacter bohemicus]
Length=337

 Score =  540 bits (1391),  Expect = 0.0
 Identities = 260/335 (78%), Positives = 295/335 (88%), Gaps = 0/335 (0%)

Query  3    MNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  62
            M TQREQ+IH W+TSVL+SD+F+I FL GDASFRRYAR++  N T+MLMDAPPEKEDCVP
Sbjct  1    MKTQREQIIHTWITSVLDSDQFEINFLPGDASFRRYARIKLNNKTFMLMDAPPEKEDCVP  60

Query  63   FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIH  122
            FV ID+FFD HGVRVPHI+AKDL QGFLLLEDFGDVLLSTLLN  TV+ YY Q+F QLI 
Sbjct  61   FVTIDQFFDTHGVRVPHIVAKDLQQGFLLLEDFGDVLLSTLLNDDTVDAYYAQSFKQLIE  120

Query  123  LQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALNQP  182
            LQ+IDG  QFP Y++EKL++EM LLT+WMLPSL I+PS  EQ +I++TF +LAN AL QP
Sbjct  121  LQAIDGVKQFPEYSYEKLLSEMQLLTDWMLPSLHIEPSREEQALIKRTFAILANAALAQP  180

Query  183  QVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITWFE  242
            QVIVHRDFHSRNLMKI+GE ELGVIDFQDAVIGADTYDLISITRDAYVQW  DQV  WF+
Sbjct  181  QVIVHRDFHSRNLMKIEGETELGVIDFQDAVIGADTYDLISITRDAYVQWNADQVYAWFK  240

Query  243  MFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWY  302
            +FYDLLP+T+K  RDFEQFKRDAD MAIQRHIKILGIFVRLFERDGK+ YLKDLPRVMWY
Sbjct  241  VFYDLLPETAKQDRDFEQFKRDADLMAIQRHIKILGIFVRLFERDGKTGYLKDLPRVMWY  300

Query  303  LLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEV  337
            LL+ES+PYAEL+PF++FI  +VMPKFE KYG YEV
Sbjct  301  LLEESKPYAELQPFMQFIHAKVMPKFEAKYGIYEV  335


> A0A1Y3DFK4 Phosphotransferase [Acinetobacter sp. ANC 4973]
Length=337

 Score =  538 bits (1387),  Expect = 0.0
 Identities = 259/335 (77%), Positives = 294/335 (88%), Gaps = 0/335 (0%)

Query  3    MNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  62
            M TQREQ+IH W+TSVL+SD+F+I FL GDASFRRYAR++  N T+MLMDAPPEKEDCVP
Sbjct  1    MKTQREQIIHTWITSVLDSDQFEINFLPGDASFRRYARIKLNNKTFMLMDAPPEKEDCVP  60

Query  63   FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIH  122
            FV ID+FFD HGVRVPHI+AKDL QGFLLLEDFGDVLLSTLLN  TV+ YY Q+F QLI 
Sbjct  61   FVTIDQFFDTHGVRVPHIVAKDLQQGFLLLEDFGDVLLSTLLNDDTVDAYYAQSFKQLIE  120

Query  123  LQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALNQP  182
            LQ+IDG  QFP Y++EKL++EM LLT+WMLPSL I+PS  EQ +I++TF +LAN AL QP
Sbjct  121  LQAIDGVKQFPEYSYEKLLSEMQLLTDWMLPSLHIEPSKEEQALIKRTFAILANAALAQP  180

Query  183  QVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITWFE  242
            QVIVHRDFHSRNLMKI+GE ELGVIDFQDAVIGADTYDLISITRDAYVQW  DQV  WF+
Sbjct  181  QVIVHRDFHSRNLMKIEGETELGVIDFQDAVIGADTYDLISITRDAYVQWNADQVYAWFK  240

Query  243  MFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWY  302
            +FYDLLP+ +K  RDFEQFKRDAD MAIQRHIKILGIFVRLFERDGK+ YLKDLPRVMWY
Sbjct  241  VFYDLLPEVAKQDRDFEQFKRDADLMAIQRHIKILGIFVRLFERDGKTGYLKDLPRVMWY  300

Query  303  LLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEV  337
            LL+ES+PYAEL+PF++FI  +VMPKFE KYG YEV
Sbjct  301  LLEESKPYAELQPFMQFIHAKVMPKFEAKYGIYEV  335


> N8QBT1 APH domain-containing protein [Acinetobacter bohemicus 
ANC 3994]
Length=337

 Score =  538 bits (1387),  Expect = 0.0
 Identities = 259/335 (77%), Positives = 294/335 (88%), Gaps = 0/335 (0%)

Query  3    MNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  62
            M TQREQ+IH W+TSVL+SD+F+I FL GDASFRRYAR++  N T+MLMDAPPEKEDCVP
Sbjct  1    MKTQREQIIHTWITSVLDSDQFEINFLPGDASFRRYARIKLNNKTFMLMDAPPEKEDCVP  60

Query  63   FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIH  122
            FV ID+FFD HGVRVPHI+AKDL QGFLLLEDFGDVLLSTLLN  TV+ YY Q+F QLI 
Sbjct  61   FVTIDQFFDTHGVRVPHIVAKDLQQGFLLLEDFGDVLLSTLLNDDTVDAYYAQSFKQLIE  120

Query  123  LQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALNQP  182
            LQ+IDG  QFP Y++EKL++EM LLT+WMLPSL I+PS  EQ +I++TF +LAN AL QP
Sbjct  121  LQAIDGVKQFPEYSYEKLLSEMQLLTDWMLPSLHIEPSKEEQALIKRTFAILANAALAQP  180

Query  183  QVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITWFE  242
            QVIVHRDFHSRNLMKI+GE ELGVIDFQDAVIGADTYDLISITRDAYVQW  DQV  WF+
Sbjct  181  QVIVHRDFHSRNLMKIEGETELGVIDFQDAVIGADTYDLISITRDAYVQWNADQVYAWFK  240

Query  243  MFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWY  302
            +FYDLLP+ +K  RDFEQFKRDAD MAIQRHIKILGIFVRLFERDGK+ YLKDLPRVMWY
Sbjct  241  VFYDLLPEAAKQDRDFEQFKRDADLMAIQRHIKILGIFVRLFERDGKTGYLKDLPRVMWY  300

Query  303  LLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEV  337
            LL+ES+PYAEL+PF++FI  +VMPKFE KYG YEV
Sbjct  301  LLEESKPYAELQPFMQFIHAKVMPKFEAKYGIYEV  335


> A0A241WM47 Phosphotransferase [Acinetobacter sp. ANC 4654]
Length=337

 Score =  538 bits (1386),  Expect = 0.0
 Identities = 259/335 (77%), Positives = 294/335 (88%), Gaps = 0/335 (0%)

Query  3    MNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  62
            M TQREQ+IH W+TSVL+SD+F+I FL GDASFRRYAR++  N T+MLMDAPPEKEDCVP
Sbjct  1    MKTQREQIIHTWITSVLDSDQFEINFLPGDASFRRYARIKLNNKTFMLMDAPPEKEDCVP  60

Query  63   FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIH  122
            FV ID+FFD HGVRVPHI+AKDL QGFLLLEDFGDVLLSTLLN  TV+ YY Q+F QLI 
Sbjct  61   FVTIDQFFDTHGVRVPHIVAKDLQQGFLLLEDFGDVLLSTLLNDDTVDAYYAQSFKQLIE  120

Query  123  LQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALNQP  182
            LQ+IDG  QFP Y++EKL++EM LLT+WMLPSL I+PS  EQ +I++TF +LAN AL QP
Sbjct  121  LQAIDGVKQFPEYSYEKLLSEMQLLTDWMLPSLHIEPSKEEQALIKRTFAILANAALAQP  180

Query  183  QVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITWFE  242
            QVIVHRDFHSRNLMKI+GE ELGVIDFQDAVIGADTYDLISITRDAYVQW  DQV  WF+
Sbjct  181  QVIVHRDFHSRNLMKIEGETELGVIDFQDAVIGADTYDLISITRDAYVQWNADQVYAWFK  240

Query  243  MFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWY  302
            +FYDLLP+ +K  RDFEQFKRDAD MAIQRHIKILGIFVRLFERDGK+ YLKDLPRVMWY
Sbjct  241  VFYDLLPEIAKQDRDFEQFKRDADLMAIQRHIKILGIFVRLFERDGKTGYLKDLPRVMWY  300

Query  303  LLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEV  337
            LL+ES+PYAEL+PF++FI  +VMPKFE KYG YEV
Sbjct  301  LLEESKPYAELQPFMQFIHAKVMPKFEAKYGIYEV  335


> A0A1Y3CKV3 Phosphotransferase [Acinetobacter sp. ANC 4470]
Length=337

 Score =  537 bits (1384),  Expect = 0.0
 Identities = 258/335 (77%), Positives = 295/335 (88%), Gaps = 0/335 (0%)

Query  3    MNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  62
            M TQREQ+IH W+TSVL+SD+F+I FL GDASFRRYAR++  N T+MLMDAPPEKEDCVP
Sbjct  1    MKTQREQIIHTWITSVLDSDQFEINFLPGDASFRRYARIKLNNKTFMLMDAPPEKEDCVP  60

Query  63   FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIH  122
            FV ID+FFD HGVRVPHI+AKDL QGFLLLEDFGDVLLSTLLN  TV+ YY Q+F QLI 
Sbjct  61   FVTIDQFFDTHGVRVPHIVAKDLQQGFLLLEDFGDVLLSTLLNDATVDAYYAQSFKQLIE  120

Query  123  LQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALNQP  182
            LQ+IDG  QFP Y++EKL++EM LLT+WMLPSL I+P+  EQ +I++TF +LAN AL QP
Sbjct  121  LQAIDGVKQFPEYSYEKLLSEMQLLTDWMLPSLHIEPTKEEQALIKRTFAILANAALAQP  180

Query  183  QVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITWFE  242
            QVIVHRDFHSRNLMKI+GE ELGVIDFQDAVIGADTYDLISITRDAYVQW  DQV  WF+
Sbjct  181  QVIVHRDFHSRNLMKIEGETELGVIDFQDAVIGADTYDLISITRDAYVQWNADQVYAWFK  240

Query  243  MFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWY  302
            +FYDLLP+ +K  RDFEQFKRDADF+AIQRHIKILGIFVRLFERDGK+ YLKDLPRVMWY
Sbjct  241  VFYDLLPEAAKQDRDFEQFKRDADFVAIQRHIKILGIFVRLFERDGKTGYLKDLPRVMWY  300

Query  303  LLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEV  337
            LL+ES+PYAEL+PF++FI  +VMPKFE KYG YEV
Sbjct  301  LLKESKPYAELQPFMQFIHAKVMPKFEAKYGIYEV  335


> A0A1H3I9A4 APH domain-containing protein [Acinetobacter kyonggiensis]
Length=337

 Score =  536 bits (1381),  Expect = 0.0
 Identities = 258/335 (77%), Positives = 293/335 (87%), Gaps = 0/335 (0%)

Query  3    MNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  62
            M TQREQ+IH W+TSVL+SD+F+I FL GDASFRRYAR++  N T+MLMDAPPEKEDCVP
Sbjct  1    MKTQREQIIHTWITSVLDSDQFEINFLPGDASFRRYARIKLNNKTFMLMDAPPEKEDCVP  60

Query  63   FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIH  122
            FV ID+FFD HGVRVPHI+AKDL QGFLLLEDFGDVLLSTLLN   V+ YY Q+F QLI 
Sbjct  61   FVTIDQFFDTHGVRVPHIVAKDLQQGFLLLEDFGDVLLSTLLNDDKVDAYYAQSFKQLIE  120

Query  123  LQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALNQP  182
            LQ+IDG  QFP Y++EKL++EM LLT+WMLPSL I+PS  EQ +I++TF +LAN AL QP
Sbjct  121  LQAIDGVKQFPEYSYEKLLSEMQLLTDWMLPSLHIEPSKEEQALIKRTFAILANAALAQP  180

Query  183  QVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITWFE  242
            QVIVHRDFHSRNLMKI+GE ELGVIDFQDAVIGADTYDLISITRDAYVQW  DQV  WF+
Sbjct  181  QVIVHRDFHSRNLMKIEGETELGVIDFQDAVIGADTYDLISITRDAYVQWNADQVYAWFK  240

Query  243  MFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWY  302
            +FYDLLP+ +K  RDFEQFKRDAD MAIQRHIKILGIFVRLFERDGK+ YLKDLPRVMWY
Sbjct  241  VFYDLLPEVAKQDRDFEQFKRDADLMAIQRHIKILGIFVRLFERDGKTGYLKDLPRVMWY  300

Query  303  LLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEV  337
            LL+ES+PYAEL+PF++FI  +VMPKFE KYG YEV
Sbjct  301  LLEESKPYAELQPFMQFIHAKVMPKFEAKYGIYEV  335


> A0A1C4GUU4 APH domain-containing protein [Acinetobacter albensis]
Length=337

 Score =  535 bits (1377),  Expect = 0.0
 Identities = 254/336 (76%), Positives = 298/336 (89%), Gaps = 0/336 (0%)

Query  3    MNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  62
            MNTQREQLI  W+TSVLNSD+F+I FL GDASFRRYAR++  N T+MLMDAPPEKEDC P
Sbjct  1    MNTQREQLIQTWVTSVLNSDQFEINFLPGDASFRRYARIKLNNKTFMLMDAPPEKEDCGP  60

Query  63   FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIH  122
            FV ID+FFD+HGVRVPHI+AKDLVQGFLLLEDFGD+LLSTLLN  +V+ YY Q+F QLI 
Sbjct  61   FVTIDQFFDQHGVRVPHIVAKDLVQGFLLLEDFGDILLSTLLNNDSVDDYYAQSFKQLIE  120

Query  123  LQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALNQP  182
            LQ+IDG   FP Y++EKL++EM LLTEWMLPSL+IQP+  E+ +I+++F +LAN AL QP
Sbjct  121  LQAIDGTKNFPNYSYEKLISEMELLTEWMLPSLNIQPTQDEEALIKRSFAILANAALAQP  180

Query  183  QVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITWFE  242
            QVIVHRDFHSRNLMKI+ E +LGVIDFQDAVIGADTYDLISITRDAYVQW  ++V  WF+
Sbjct  181  QVIVHRDFHSRNLMKIESETDLGVIDFQDAVIGADTYDLISITRDAYVQWNAERVYHWFK  240

Query  243  MFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWY  302
            +FYDLLP+ +K  RDFEQFKRDADFMAIQRH+KILGIFVRLFERDGK+SYLKDLPRVMWY
Sbjct  241  VFYDLLPEAAKQDRDFEQFKRDADFMAIQRHLKILGIFVRLFERDGKTSYLKDLPRVMWY  300

Query  303  LLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEVV  338
            LL+ES+PYAE++PF++F+Q +VMPKFE KYG YEVV
Sbjct  301  LLEESKPYAEIQPFMQFLQNKVMPKFEAKYGAYEVV  336


> A0A241VC72 Phosphotransferase [Acinetobacter sp. ANC 4218]
Length=337

 Score =  533 bits (1372),  Expect = 0.0
 Identities = 258/335 (77%), Positives = 293/335 (87%), Gaps = 0/335 (0%)

Query  3    MNTQREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYMLMDAPPEKEDCVP  62
            MNTQREQLI  W+TSVL SD+F+  FLAGDASFRRYAR++  N T+MLMDAPPEKEDC P
Sbjct  1    MNTQREQLIQTWITSVLGSDQFETHFLAGDASFRRYARIKLNNKTFMLMDAPPEKEDCGP  60

Query  63   FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIH  122
            FV IDEFFD +GVRVPHI+AKDL  GFLLLEDFGDVLLSTLLN QTV+ YY Q+F QLI 
Sbjct  61   FVTIDEFFDNNGVRVPHIVAKDLELGFLLLEDFGDVLLSTLLNEQTVDAYYAQSFKQLIQ  120

Query  123  LQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDIIQQTFELLANTALNQP  182
            LQ+IDG + FP Y++EKL++EM LLT+WMLPSL IQP++ E  +I++TF +LAN AL QP
Sbjct  121  LQAIDGTNHFPNYSYEKLISEMELLTDWMLPSLQIQPTAEESALIKRTFAILANAALAQP  180

Query  183  QVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVITWFE  242
            QVIVHRDFHSRNLMKI GE +LGVIDFQDAVIGADTYDLISITRDAYVQW  D+V TWF+
Sbjct  181  QVIVHRDFHSRNLMKIAGETDLGVIDFQDAVIGADTYDLISITRDAYVQWNADRVYTWFK  240

Query  243  MFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWY  302
             FYDLLP+++K  RDFEQFK+DAD MAIQRHIKILGIFVRLFERDGKS YLKDLPRVMWY
Sbjct  241  TFYDLLPESAKQDRDFEQFKKDADMMAIQRHIKILGIFVRLFERDGKSGYLKDLPRVMWY  300

Query  303  LLQESRPYAELKPFVEFIQYQVMPKFEQKYGGYEV  337
            LL+ES+PYAEL+PF++FIQ QVMPKFE KYG YEV
Sbjct  301  LLEESQPYAELQPFMQFIQTQVMPKFEAKYGRYEV  335


> Q5RLL0 OrfT [Pseudomonas fluorescens]
Length=341

 Score =  206 bits (525),  Expect = 2e-66
 Identities = 116/293 (40%), Positives = 164/293 (56%), Gaps = 4/293 (1%)

Query  30   AGDASFRRYARVEYKNNTYMLMDAPPEKEDCVPFVHIDEFFDRHGVRVPHILAKDLVQGF  89
            + DASFRRY R E +  + ++MDAPP +E+C PFV I     + G+ VP I A+DL +GF
Sbjct  40   SSDASFRRYFRWEGEGRSLIVMDAPPPQENCKPFVDIAFLLAKSGINVPKIYAEDLERGF  99

Query  90   LLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIHLQSIDGQDQFPAYTFEKLMAEMHLLTE  149
            LLL D G+     ++N +  +  +  A   L+  Q +      P+Y    L  E+ L  E
Sbjct  100  LLLNDLGNQTYLDVINGENADDLFRDALQALLAFQQLPMVAPLPSYDVALLRRELELFPE  159

Query  150  WMLP-SLDIQPSSAEQDIIQQTFELLANTALNQPQVIVHRDFHSRNLMKIQGEEELGVID  208
            W +   L I+  SA+Q + QQ  ELL ++AL QP+V+VHRD+  RNLM        GV+D
Sbjct  160  WYVKRELGIELDSAQQQLWQQASELLIDSALAQPKVLVHRDYMPRNLM--LSVPNPGVLD  217

Query  209  FQDAVIGADTYDLISITRDAYVQWGEDQVITWFEMFYDLLPDTS-KHHRDFEQFKRDADF  267
            FQDAV G  TYD+  + +DA++ W E +V  W E ++            DFE F R +D 
Sbjct  218  FQDAVYGPVTYDVTCLFKDAFLSWPEARVRGWLESYWQQAGALGIPVQPDFEDFLRASDL  277

Query  268  MAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWYLLQESRPYAELKPFVEFI  320
            M +QRH+K++GIF R+  RDGK  YL D+PR   Y+        EL P  E +
Sbjct  278  MGVQRHLKVIGIFARICHRDGKPRYLGDVPRFFAYIEAVIARRPELAPLDELL  330


> Q9X4N9 Aminoglycoside phosphotransferase [Pseudomonas aeruginosa]
Length=338

 Score =  184 bits (467),  Expect = 7e-58
 Identities = 111/280 (40%), Positives = 151/280 (54%), Gaps = 12/280 (4%)

Query  30   AGDASFRRYARVEYKNNTYMLMDAPPEKEDCVPFVHIDEFFDRHGVRVPHILAKDLVQGF  89
            + DASFRRY R +  + + ++MDAPP +EDC PFV +       GV VP ILA+DL  GF
Sbjct  39   SSDASFRRYFRWQGGDRSLVVMDAPPPQEDCRPFVKVAGLLAGAGVHVPRILAQDLENGF  98

Query  90   LLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIHLQSIDGQDQFPAYTFEKLMAEMHLLTE  149
            LLL D G      +L+    +  +  A   LI  Q +D     PAY    L  E+ L  +
Sbjct  99   LLLSDLGRQTYLDVLHPGNADELFEPALDALIAFQKVDVAGVLPAYDEAVLRRELQLFPD  158

Query  150  WMLP-SLDIQPSSAEQDIIQQTFELLANTALNQPQVIVHRDFHSRNLMKIQGEEELGVID  208
            W L   L ++         Q+  +LL  +AL QP+V VHRD+  RNLM    E   GV+D
Sbjct  159  WYLARHLGVELEGETLARWQRICDLLVRSALEQPRVFVHRDYMPRNLM--LSEPNPGVLD  216

Query  209  FQDAVIGADTYDLISITRDAYVQWGEDQVIT-----WFEMFYDLLPDTSKHHRDFEQFKR  263
            FQDA+ G  TYD+  + +DA+V W E +V       W +  +  +P        FE F R
Sbjct  217  FQDALHGPVTYDVTCLYKDAFVSWPEPRVHAALSRYWKKATWAGIPLPP----SFEDFLR  272

Query  264  DADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWYL  303
             +D M +QRH+K++GIF R+  RDGK  YL D+PR   YL
Sbjct  273  ASDLMGVQRHLKVIGIFARICHRDGKPRYLGDVPRFFRYL  312



Lambda      K        H        a         alpha
   0.326    0.141    0.426    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1205075


  Database: 077121096718ce5a0777d84b47fa87a7.TrEMBL.fasta
    Posted date:  Sep 24, 2020  3:02 AM
  Number of letters in database: 4,729
  Number of sequences in database:  14



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40