ACIAD2370 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: d3e6351e8bae34dc6cf9657a977a3daa.SwissProt.fasta
           5 sequences; 1,684 total letters



Query= ACIAD2370

Length=341
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q9K188 N-acetylmuramate/N-acetylglucosamine kinase [Neisseria m...   197    2e-63
  Q88QT3 N-acetylmuramate/N-acetylglucosamine kinase [Pseudomonas...   197    4e-63
  Q9I5U1 N-acetylmuramate/N-acetylglucosamine kinase [Pseudomonas...   182    1e-57
  Q9A2M2 N-acetylmuramate/N-acetylglucosamine kinase [Caulobacter...  91.3    1e-24
  Q00582 GTP-binding protein GTR1 [Saccharomyces cerevisiae (stra...  37.7    9e-07


> Q9K188 N-acetylmuramate/N-acetylglucosamine kinase [Neisseria 
meningitidis serogroup B (strain MC58)]
Length=334

 Score =  197 bits (501),  Expect = 2e-63
 Identities = 115/317 (36%), Positives = 180/317 (57%), Gaps = 11/317 (3%)

Query  6    QREQLIHIWLTSVLNSDEFKIQFLAGDASFRRYARVEYKNNTYML-MDAPPEKEDCVPFV  64
            QR+  +  WL +V    +F + F A DA FRRY R  + + + ++ MDAPP+K    P++
Sbjct  2    QRQIKLKNWLQTVYPERDFDLTFAAADADFRRYFRATFSDGSSVVCMDAPPDKMSVAPYL  61

Query  65   HIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDV-LLSTLLNAQTVNHY---YLQAFAQL  120
             + + FD   V VP +L  D   GF++L D G+   L+ +L  Q    +    L+A  +L
Sbjct  62   KVQKLFDM--VNVPQVLHADTDLGFVVLNDLGNTTFLTAMLQEQGETAHKALLLEAIGEL  119

Query  121  IHLQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPS-LDIQPSSAEQDIIQQTFELLANTAL  179
            + LQ    +   P Y  E ++ E++L  EW +   L  + +  ++ + QQT + L    L
Sbjct  120  VELQKASREGVLPEYDRETMLREINLFPEWFVAKELGRELTFKQRQLWQQTVDTLLPPLL  179

Query  180  NQPQVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGEDQVIT  239
             QP+V VHRDF  RNLM  +G    GV+DFQDA+ G  +YDL+S+ RDA+++W E+ V+ 
Sbjct  180  AQPKVYVHRDFIVRNLMLTRGRP--GVLDFQDALYGPISYDLVSLLRDAFIEWEEEFVLD  237

Query  240  WFEMFYDLLPDTSKHHRD-FEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPR  298
                +++          + F++F R  ++M +QRH+K+ GIF RL+ RDGK  Y  ++PR
Sbjct  238  LVIRYWEKARAAGLPVPEAFDEFYRWFEWMGVQRHLKVAGIFARLYYRDGKDKYRPEIPR  297

Query  299  VMWYLLQESRPYAELKP  315
             + YL + SR YAEL P
Sbjct  298  FLNYLRRVSRRYAELAP  314


> Q88QT3 N-acetylmuramate/N-acetylglucosamine kinase [Pseudomonas 
putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)]
Length=339

 Score =  197 bits (500),  Expect = 4e-63
 Identities = 120/327 (37%), Positives = 174/327 (53%), Gaps = 16/327 (5%)

Query  7    REQLIHIWLTSVLNSDEFK-----------IQFLAGDASFRRYARVEYKNNTYMLMDAPP  55
            R Q + +WL   LN D F+           +   + DASFRRY R +   +++++MDAPP
Sbjct  7    RLQQLTVWLDEQLN-DLFRDNAWGEVPAGSLTAASSDASFRRYFRWQGAGHSFVIMDAPP  65

Query  56   EKEDCVPFVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNHYYLQ  115
             +E+C PFV ID       V VP I A+DL +GFLLL D G      ++NA   +  +  
Sbjct  66   PQENCRPFVAIDHLLASADVHVPLIHAQDLERGFLLLGDLGTQTYLDIINADNADGLFAD  125

Query  116  AFAQLIHLQSIDGQDQFPAYTFEKLMAEMHLLTEWML-PSLDIQPSSAEQDIIQQTFELL  174
            A   L+  Q +      P+Y    L  E+ L  EW +   L +  + A++   Q+  +LL
Sbjct  126  AIDALLKFQRLPMDAPLPSYDDALLRREVELFPEWYVGRELGLTFTDAQKATWQRVSQLL  185

Query  175  ANTALNQPQVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLISITRDAYVQWGE  234
             ++AL QP+V+VHRD+  RNLM  Q     GV+DFQDAV G  TYD+  + +DA+V W +
Sbjct  186  IDSALAQPKVLVHRDYMPRNLM--QSTPNPGVLDFQDAVYGPVTYDITCLFKDAFVSWPQ  243

Query  235  DQVITWFEMFYDLLPDTS-KHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERDGKSSYL  293
             +V  W   ++          H +FE F R +D M +QRH+K++GIF R+  RDGK  YL
Sbjct  244  ARVEGWLGDYWQQAQAAGIPVHAEFEAFHRASDLMGVQRHLKVIGIFARICHRDGKPRYL  303

Query  294  KDLPRVMWYLLQESRPYAELKPFVEFI  320
             D+PR   Y+ +      EL    E I
Sbjct  304  GDVPRFFAYINEVIGRRPELAELGELI  330


> Q9I5U1 N-acetylmuramate/N-acetylglucosamine kinase [Pseudomonas 
aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / 
JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)]
Length=338

 Score =  182 bits (463),  Expect = 1e-57
 Identities = 110/280 (39%), Positives = 151/280 (54%), Gaps = 12/280 (4%)

Query  30   AGDASFRRYARVEYKNNTYMLMDAPPEKEDCVPFVHIDEFFDRHGVRVPHILAKDLVQGF  89
            + DASFRRY R +  + + ++MDAPP +EDC PFV +       GV VP ILA+DL  GF
Sbjct  39   SSDASFRRYFRWQGGDRSLVVMDAPPPQEDCRPFVKVAGLLAGAGVHVPRILAQDLENGF  98

Query  90   LLLEDFGDVLLSTLLNAQTVNHYYLQAFAQLIHLQSIDGQDQFPAYTFEKLMAEMHLLTE  149
            LLL D G      +L+    +  +  A   LI  Q +D     PAY    L  E+ L  +
Sbjct  99   LLLSDLGRQTYLDVLHPGNADELFEPALDALIAFQKVDVAGVLPAYDEAVLRRELQLFPD  158

Query  150  WMLP-SLDIQPSSAEQDIIQQTFELLANTALNQPQVIVHRDFHSRNLMKIQGEEELGVID  208
            W L   L ++         ++  +LL  +AL QP+V VHRD+  RNLM    E   GV+D
Sbjct  159  WYLARHLGVELEGETLARWKRICDLLVRSALEQPRVFVHRDYMPRNLM--LSEPNPGVLD  216

Query  209  FQDAVIGADTYDLISITRDAYVQWGEDQVIT-----WFEMFYDLLPDTSKHHRDFEQFKR  263
            FQDA+ G  TYD+  + +DA+V W E +V       W +  +  +P        FE F R
Sbjct  217  FQDALHGPVTYDVTCLYKDAFVSWPEPRVHAALNRYWKKATWAGIPLPP----SFEDFLR  272

Query  264  DADFMAIQRHIKILGIFVRLFERDGKSSYLKDLPRVMWYL  303
             +D M +QRH+K++GIF R+  RDGK  YL D+PR   YL
Sbjct  273  ASDLMGVQRHLKVIGIFARICHRDGKPRYLGDVPRFFRYL  312


> Q9A2M2 N-acetylmuramate/N-acetylglucosamine kinase [Caulobacter 
vibrioides (strain ATCC 19089 / CB15)]
Length=363

 Score = 91.3 bits (225),  Expect = 1e-24
 Identities = 85/316 (27%), Positives = 126/316 (40%), Gaps = 47/316 (15%)

Query  29   LAGDASFRRYARVEYKNNTYMLMDAPPEKED--CVP------------------------  62
            L GDAS R Y R+     +Y+ MD PP  E   C P                        
Sbjct  28   LGGDASTRAYERLHRGEQSYIFMDQPPSLETAPCPPDASPAERAALGYNALARLAAGRVD  87

Query  63   -FVHIDEFFDRHGVRVPHILAKDLVQGFLLLEDFGDVLLSTLLNAQTVNH-YYLQAFAQL  120
             FV    + +  G+  P +LA D   G  +LED GD L + L+ A T     Y  A   L
Sbjct  88   AFVACAGWLNAQGLSAPKVLAADPAAGLAVLEDLGDDLYARLIEAGTDEAPLYDAAIDGL  147

Query  121  IHLQSI--------DGQDQFPAYTFEKLMAEM--HLLTEWMLPSLDIQPSSAEQDIIQQT  170
            + + +         DG   +P  T++ L  +    +  EW     DI   +A     +  
Sbjct  148  LAIHAAPTPKVLRYDGST-WPLLTYDDLALKTAHDIFVEWQPRFRDISFDAAALAEWEAI  206

Query  171  FELLANTALNQPQVIVHRDFHSRNLMKI---QGEEELGVIDFQDAVIGADTYDLISITRD  227
            +  +         V  HRD+H+ NL+ +    G   +G++DFQDAV+    +DL  +  D
Sbjct  207  WAPIRAKGEADATVFCHRDYHAENLIWLPERDGAARVGMLDFQDAVLAHPAWDLSMLLHD  266

Query  228  AYVQWGEDQVITWFEMFYDLLPDTSKHHRDFEQFKRDADFMAIQRHIKILGIFVRLFERD  287
            A      ++     + +    P+      D   F      +     I+ILGIF RL  RD
Sbjct  267  ARRTVSPEREAACLDRYLAARPEL-----DRTAFLAGYHALGALNIIRILGIFARLVTRD  321

Query  288  GKSSYLKDLPRVMWYL  303
            GK  Y   +PR+  YL
Sbjct  322  GKPRYADFIPRLWVYL  337


> Q00582 GTP-binding protein GTR1 [Saccharomyces cerevisiae (strain 
ATCC 204508 / S288c)]
Length=310

 Score = 37.7 bits (86),  Expect = 9e-07
 Identities = 34/160 (21%), Positives = 67/160 (42%), Gaps = 12/160 (8%)

Query  109  VNHYYLQAFAQL-IHLQSIDGQDQFPAYTFEKLMAEMHLLTEWMLPSLDIQPSSAEQDII  167
            V H +L+    + ++L    GQD F    F K    +  + + ++   D++ +   +DI 
Sbjct  44   VEHSHLRFLGNMTLNLWDCGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTEVLKDI-  102

Query  168  QQTFELLANTALNQ-----PQVIVHRDFHSRNLMKIQGEEELGVIDFQDAVIGADTYDLI  222
                E+ A  AL Q     P   +    H  +L+++   EEL  I  ++    +  +   
Sbjct  103  ----EIFAK-ALKQLRKYSPDAKIFVLLHKMDLVQLDKREELFQIMMKNLSETSSEFGFP  157

Query  223  SITRDAYVQWGEDQVITWFEMFYDLLPDTSKHHRDFEQFK  262
            ++       W E     W ++   L+P+ S H  + ++FK
Sbjct  158  NLIGFPTSIWDESLYKAWSQIVCSLIPNMSNHQSNLKKFK  197



Lambda      K        H        a         alpha
   0.326    0.141    0.426    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 449678


  Database: d3e6351e8bae34dc6cf9657a977a3daa.SwissProt.fasta
    Posted date:  Sep 19, 2020  1:40 PM
  Number of letters in database: 1,684
  Number of sequences in database:  5



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40