ACIAD2367 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: c04e6d06350d5db92d0abfe79c36d32f.TrEMBL.fasta
           23 sequences; 6,108 total letters



Query= ACIAD2367

Length=261
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6F9W8 Chromosome partitioning protein [Acinetobacter baylyi (s...   497    0.0   
  A0A2N6VEA1 Chromosome (Plasmid) partitioning protein ParA [Acin...   475    8e-174
  N9SBV0 AAA_31 domain-containing protein [Acinetobacter ursingii...   475    1e-173
  N9C153 AAA_31 domain-containing protein [Acinetobacter ursingii...   475    1e-173
  A0A009ZMN6 CobQ/CobB/MinD/ParA nucleotide binding domain protei...   475    1e-173
  A0A0M1I5I8 Cobalamin biosynthesis protein CobQ [Acinetobacter s...   475    1e-173
  N9BPL0 AAA_31 domain-containing protein [Acinetobacter soli NIP...   475    1e-173
  A0A1P8EFL2 Cobalamin biosynthesis protein CobQ [Acinetobacter s...   474    2e-173
  A0A241VCC2 Cobalamin biosynthesis protein CobQ [Acinetobacter s...   470    1e-171
  A0A2U3MWN8 Chromosome partitioning protein ParA [Acinetobacter ...   468    9e-171
  A0A1Y3CVR3 Cobalamin biosynthesis protein CobQ [Acinetobacter s...   467    1e-170
  A0A241UXG6 Cobalamin biosynthesis protein CobQ [Acinetobacter s...   467    1e-170
  D0C7S7 Sporulation initiation inhibitor protein Soj [Acinetobac...   467    1e-170
  Q6VPQ6 Soj [Aeromonas hydrophila]                                    281    2e-97 
  Q50202 Cosmid L222 DNA sequence, 27 CDS features [Mycobacterium...   218    1e-72 
  Q9LCY1 Putative partitioning protein [Thermus thermophilus]          208    3e-69 
  O07328 Soj-like [Streptomyces coelicolor (strain ATCC BAA-471 /...   206    2e-68 
  Q9RFM1 ParA [Streptomyces coelicolor (strain ATCC BAA-471 / A3(...   208    1e-67 
  Q848S7 Chromosome partitioning protein [Enterococcus faecium]        169    9e-54 
  Q2TM60 ParA family protein [Desulfovibrio gigas]                     142    1e-43 
  Q6TV39 Putative partition protein/ATPase [Bacillus methanolicus]     130    4e-39 
  O52265 AAA_31 domain-containing protein [Pseudomonas putida]         125    3e-37 
  O87128 AAA family ATPase [Pseudomonas aeruginosa]                    124    7e-37 


> Q6F9W8 Chromosome partitioning protein [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=260

 Score =  497 bits (1280),  Expect = 0.0
 Identities = 260/260 (100%), Positives = 260/260 (100%), Gaps = 0/260 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY
Sbjct  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV
Sbjct  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGTNT  260
            YLNLAAEMLKKSKVKKGTNT
Sbjct  241  YLNLAAEMLKKSKVKKGTNT  260


> A0A2N6VEA1 Chromosome (Plasmid) partitioning protein ParA [Acinetobacter 
ursingii]
Length=260

 Score =  475 bits (1223),  Expect = 8e-174
 Identities = 245/259 (95%), Positives = 256/259 (99%), Gaps = 0/259 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSG+QKNDLLYS+
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGVQKNDLLYSI  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVP+ETAITK+EVGYKVLGSNR+L+GVELAIADQ+GREFILKKAL  VRD FDY
Sbjct  61   TDVLLGEVPVETAITKSEVGYKVLGSNRELSGVELAIADQEGREFILKKALDSVRDAFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDL+IIGV
Sbjct  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLQIIGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGTN  259
            YLNLAAEMLKKSK+KKG++
Sbjct  241  YLNLAAEMLKKSKMKKGSH  259


> N9SBV0 AAA_31 domain-containing protein [Acinetobacter ursingii 
NIPH 706]
Length=260

 Score =  475 bits (1222),  Expect = 1e-173
 Identities = 245/259 (95%), Positives = 256/259 (99%), Gaps = 0/259 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSG+QKNDLLYS+
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGVQKNDLLYSI  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVP+ETAITK+EVGYKVLGSNR+L+GVELAIADQ+GREFILKKAL  VRD FDY
Sbjct  61   TDVLLGEVPVETAITKSEVGYKVLGSNRELSGVELAIADQEGREFILKKALDSVRDAFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNP+L+IIGV
Sbjct  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPELQIIGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGTN  259
            YLNLAAEMLKKSKVKKG++
Sbjct  241  YLNLAAEMLKKSKVKKGSH  259


> N9C153 AAA_31 domain-containing protein [Acinetobacter ursingii 
ANC 3649]
Length=260

 Score =  475 bits (1222),  Expect = 1e-173
 Identities = 245/259 (95%), Positives = 256/259 (99%), Gaps = 0/259 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSG+QKNDLLYS+
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGVQKNDLLYSI  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVP+ETAITK+EVGYKVLGSNR+L+GVELAIADQ+GREFILKKAL  VRD FDY
Sbjct  61   TDVLLGEVPVETAITKSEVGYKVLGSNRELSGVELAIADQEGREFILKKALDSVRDAFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNP+L+IIGV
Sbjct  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPELQIIGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGTN  259
            YLNLAAEMLKKSKVKKG++
Sbjct  241  YLNLAAEMLKKSKVKKGSH  259


> A0A009ZMN6 CobQ/CobB/MinD/ParA nucleotide binding domain protein 
[Acinetobacter sp. 479375]
Length=260

 Score =  475 bits (1222),  Expect = 1e-173
 Identities = 245/259 (95%), Positives = 256/259 (99%), Gaps = 0/259 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSG+QKNDLLYS+
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGVQKNDLLYSI  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVP+ETAITK+EVGYKVLGSNR+L+GVELAIADQ+GREFILKKAL  VRD FDY
Sbjct  61   TDVLLGEVPVETAITKSEVGYKVLGSNRELSGVELAIADQEGREFILKKALDSVRDAFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNP+L+IIGV
Sbjct  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPELQIIGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGTN  259
            YLNLAAEMLKKSKVKKG++
Sbjct  241  YLNLAAEMLKKSKVKKGSH  259


> A0A0M1I5I8 Cobalamin biosynthesis protein CobQ [Acinetobacter 
sp. C15]
Length=260

 Score =  475 bits (1222),  Expect = 1e-173
 Identities = 247/259 (95%), Positives = 254/259 (98%), Gaps = 0/259 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSG+QKNDLLYSV
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGVQKNDLLYSV  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIA+QDGREFILKKAL  VRD FDY
Sbjct  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIAEQDGREFILKKALDTVRDKFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            I+IDCAPSLSLITVNALAAVD V+IPMQCEYYALEGLADLTQTIDRIQQALNP+L+I GV
Sbjct  121  IVIDCAPSLSLITVNALAAVDSVIIPMQCEYYALEGLADLTQTIDRIQQALNPNLQITGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGTN  259
            YLNLAAEMLKKSKVKKGT+
Sbjct  241  YLNLAAEMLKKSKVKKGTS  259


> N9BPL0 AAA_31 domain-containing protein [Acinetobacter soli NIPH 
2899]
Length=260

 Score =  475 bits (1222),  Expect = 1e-173
 Identities = 247/259 (95%), Positives = 254/259 (98%), Gaps = 0/259 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSG+QKNDLLYSV
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGVQKNDLLYSV  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIA+QDGREFILKKAL  VRD FDY
Sbjct  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIAEQDGREFILKKALDTVRDKFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            I+IDCAPSLSLITVNALAAVD V+IPMQCEYYALEGLADLTQTIDRIQQALNP+L+I GV
Sbjct  121  IVIDCAPSLSLITVNALAAVDSVIIPMQCEYYALEGLADLTQTIDRIQQALNPNLQITGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGTN  259
            YLNLAAEMLKKSKVKKGT+
Sbjct  241  YLNLAAEMLKKSKVKKGTS  259


> A0A1P8EFL2 Cobalamin biosynthesis protein CobQ [Acinetobacter 
soli]
Length=260

 Score =  474 bits (1221),  Expect = 2e-173
 Identities = 246/259 (95%), Positives = 254/259 (98%), Gaps = 0/259 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSG+QKNDLLYSV
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGVQKNDLLYSV  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIA+QDGREFILKKAL  +RD FDY
Sbjct  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIAEQDGREFILKKALDTIRDKFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            I+IDCAPSLSLITVNALAAVD V+IPMQCEYYALEGLADLTQTIDRIQQALNP+L+I GV
Sbjct  121  IVIDCAPSLSLITVNALAAVDSVIIPMQCEYYALEGLADLTQTIDRIQQALNPNLQITGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGTN  259
            YLNLAAEMLKKSKVKKGT+
Sbjct  241  YLNLAAEMLKKSKVKKGTS  259


> A0A241VCC2 Cobalamin biosynthesis protein CobQ [Acinetobacter 
sp. ANC 4218]
Length=260

 Score =  470 bits (1209),  Expect = 1e-171
 Identities = 241/259 (93%), Positives = 254/259 (98%), Gaps = 0/259 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVPIETAITKAEVGYKVLG+NRDLAGVELAIA+QDGRE+IL++AL ++  +FDY
Sbjct  61   TDVLLGEVPIETAITKAEVGYKVLGANRDLAGVELAIAEQDGREYILREALQEIESSFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            II+DCAPSLSLITVNALAAV GVMIPMQCEYYALEGLADLTQTIDRIQQALNPDL+I+GV
Sbjct  121  IIVDCAPSLSLITVNALAAVQGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLQIVGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVS ELEQ+FGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSEELEQYFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGTN  259
            YLNLAAEMLKKSKVKKG+N
Sbjct  241  YLNLAAEMLKKSKVKKGSN  259


> A0A2U3MWN8 Chromosome partitioning protein ParA [Acinetobacter 
sp. KPC-SM-21]
Length=260

 Score =  468 bits (1203),  Expect = 9e-171
 Identities = 239/257 (93%), Positives = 253/257 (98%), Gaps = 0/257 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYS+
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSI  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVPIETAITKA+VGYKVLG+NRDL+GVELAIA+Q+GREFIL+ AL +V  NFDY
Sbjct  61   TDVLLGEVPIETAITKADVGYKVLGANRDLSGVELAIAEQEGREFILRDALKEVEKNFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            II+DCAPSLSLITVNALAAVDGV+IPMQCEYYALEGLADLTQTIDRIQQALNPDL+IIGV
Sbjct  121  IIVDCAPSLSLITVNALAAVDGVIIPMQCEYYALEGLADLTQTIDRIQQALNPDLQIIGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVSAELEQ+FGKKLYDTV+PRNVRLAEAPAHGLPIIYFEKSSKGA+A
Sbjct  181  LRTMYDARNALTRDVSAELEQYFGKKLYDTVVPRNVRLAEAPAHGLPIIYFEKSSKGAIA  240

Query  241  YLNLAAEMLKKSKVKKG  257
            YLNLAAEMLKKSKVKKG
Sbjct  241  YLNLAAEMLKKSKVKKG  257


> A0A1Y3CVR3 Cobalamin biosynthesis protein CobQ [Acinetobacter 
sp. ANC 4169]
Length=260

 Score =  467 bits (1202),  Expect = 1e-170
 Identities = 239/259 (92%), Positives = 254/259 (98%), Gaps = 0/259 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVPIETAITKAEVGYKVLG+NRDLAGVELAIA+QDGRE+IL++AL ++  +FDY
Sbjct  61   TDVLLGEVPIETAITKAEVGYKVLGANRDLAGVELAIAEQDGREYILREALQEIESSFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            II+DCAPSLSLITVNALAAV GV+IPMQCEYYALEGLADLTQTIDRIQQALNPDL+I+GV
Sbjct  121  IIVDCAPSLSLITVNALAAVQGVLIPMQCEYYALEGLADLTQTIDRIQQALNPDLQIVGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVS ELEQ+FGKKLY+TVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSEELEQYFGKKLYETVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGTN  259
            YLNLAAEMLKKSKVKKG+N
Sbjct  241  YLNLAAEMLKKSKVKKGSN  259


> A0A241UXG6 Cobalamin biosynthesis protein CobQ [Acinetobacter 
sp. ANC 4204]
Length=260

 Score =  467 bits (1202),  Expect = 1e-170
 Identities = 240/259 (93%), Positives = 254/259 (98%), Gaps = 0/259 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVPIETAITKAEVGYKVLG+NRDLAGVELAIA+Q+GREFIL++AL +V   FDY
Sbjct  61   TDVLLGEVPIETAITKAEVGYKVLGANRDLAGVELAIAEQEGREFILREALKEVEQAFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            II+DCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNP+L+IIGV
Sbjct  121  IIVDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPELKIIGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVS ELEQ+FGKKLYDTVIPRNVRLAEAPAHGLP+IYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSEELEQYFGKKLYDTVIPRNVRLAEAPAHGLPVIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGTN  259
            YL+LAAEM+KKSKVKKG+N
Sbjct  241  YLHLAAEMIKKSKVKKGSN  259


> D0C7S7 Sporulation initiation inhibitor protein Soj [Acinetobacter 
baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / 
JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81)]
Length=260

 Score =  467 bits (1202),  Expect = 1e-170
 Identities = 240/258 (93%), Positives = 254/258 (98%), Gaps = 0/258 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVD+DSQGNATMGSGIQKNDLLYSV
Sbjct  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDIDSQGNATMGSGIQKNDLLYSV  60

Query  61   TDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            TDVLLGEVPIETAI KAEVGYKVLGSNR+L+GVELAIA+Q+GREFILK AL ++RD+FDY
Sbjct  61   TDVLLGEVPIETAIQKAEVGYKVLGSNRELSGVELAIAEQEGREFILKNALNEIRDSFDY  120

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            II+DCAPSLSLITVNALAAVDGV+IPMQCEYYALEGLADLTQTIDRIQ+ALNPDL IIGV
Sbjct  121  IIVDCAPSLSLITVNALAAVDGVIIPMQCEYYALEGLADLTQTIDRIQKALNPDLEIIGV  180

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            LRTMYDARNALTRDVSAELEQ+FGKKLYDTVIPRNVRLAEAPAHGLP+IYFEKSSKGAVA
Sbjct  181  LRTMYDARNALTRDVSAELEQYFGKKLYDTVIPRNVRLAEAPAHGLPVIYFEKSSKGAVA  240

Query  241  YLNLAAEMLKKSKVKKGT  258
            YLNLAAEMLKKSKVKKG+
Sbjct  241  YLNLAAEMLKKSKVKKGS  258


> Q6VPQ6 Soj [Aeromonas hydrophila]
Length=267

 Score =  281 bits (720),  Expect = 2e-97
 Identities = 137/257 (53%), Positives = 191/257 (74%), Gaps = 1/257 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            M ++IAIANQKGGVGKTTT VNLAAS+A  +++VL++D+D QGNATMGSG+ K ++  + 
Sbjct  1    MGKVIAIANQKGGVGKTTTCVNLAASMAATRRKVLVIDLDPQGNATMGSGVDKYEVERTA  60

Query  61   TDVLLGEVPI-ETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFD  119
             ++L+ + PI E  I +   GY ++ +N D+   E+ + +   RE  L+ ALA VRD +D
Sbjct  61   YELLIEDAPIGEVIIPETSGGYHLIAANADVTAAEIRLMEFFAREIRLRNALAAVRDKYD  120

Query  120  YIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIG  179
            Y+ IDC PSL+++TVNA+AA D V++PMQCEYYALEGL  L  TI ++   +NPDL+I G
Sbjct  121  YVFIDCPPSLNMLTVNAMAAADSVLVPMQCEYYALEGLTALVDTISKLAAVVNPDLKIEG  180

Query  180  VLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAV  239
            VLRTM+D RN L  DVS +L+Q FG K+Y T+IPRNVRLAEAP+ G P ++++KSS GA 
Sbjct  181  VLRTMFDHRNRLANDVSDQLKQHFGDKVYRTIIPRNVRLAEAPSFGAPAMHYDKSSVGAK  240

Query  240  AYLNLAAEMLKKSKVKK  256
            AYL LA E+L++ + ++
Sbjct  241  AYLALAGEILRRQEQER  257


> Q50202 Cosmid L222 DNA sequence, 27 CDS features [Mycobacterium 
leprae]
Length=278

 Score =  218 bits (555),  Expect = 1e-72
 Identities = 113/255 (44%), Positives = 173/255 (68%), Gaps = 4/255 (2%)

Query  3    QIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQ-KNDLLYSVT  61
            ++  IANQKGGVGKTTTAVNLAA+LA+   + L++D+D QGNA+   GI  +   ++S  
Sbjct  18   RLFTIANQKGGVGKTTTAVNLAAALALQGLKALVIDLDPQGNASTALGISNRQSRVFSSY  77

Query  62   DVLLGEVPIETAITKAEVGYKV--LGSNRDLAGVELAIADQDGREFILKKALAQVRD-NF  118
            DVL+GEV ++TA+  +    ++  L +  DLAG E+ +     RE  L+ AL ++ D +F
Sbjct  78   DVLIGEVSLQTALRCSPYNERLFCLPAAIDLAGAEIELVSMVARENRLRTALTELNDLDF  137

Query  119  DYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRII  178
            DY+ IDC PSL L+T+NAL A   V+IP+QCEYYALEG++ L   I+ ++  LNP L + 
Sbjct  138  DYVFIDCPPSLGLLTINALVAAPEVIIPIQCEYYALEGVSQLMCNIEMVKAHLNPQLEVT  197

Query  179  GVLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGA  238
             V+ TMYD R  L   V+ E+ ++FG K+  TVIPR+V+++EAP + + II ++  S+GA
Sbjct  198  TVILTMYDGRTKLADQVAEEVRRYFGTKVLQTVIPRSVKVSEAPGYSMTIIDYDPGSRGA  257

Query  239  VAYLNLAAEMLKKSK  253
            ++YL+ + E+ ++ +
Sbjct  258  MSYLDASRELAERDQ  272


> Q9LCY1 Putative partitioning protein [Thermus thermophilus]
Length=248

 Score =  208 bits (530),  Expect = 3e-69
 Identities = 117/247 (47%), Positives = 163/247 (66%), Gaps = 11/247 (4%)

Query  5    IAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTDVL  64
            IA+ANQKGGVGKTTTA+NLAA LA L KRVLLVD+D QGNAT G G++    +Y +   L
Sbjct  9    IALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLDPQGNATSGLGVRAERGVYHL---L  65

Query  65   LGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDYIIID  124
             GE P+E  +   + G+ +L +  DL G  + +A       +L+       + +D +++D
Sbjct  66   QGE-PLEGLVHPVD-GFHLLPATPDLVGATVELAGAPRPAEVLRD------EGYDLVLLD  117

Query  125  CAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGVLRTM  184
              PSLS +T+NALAA +GV++P+Q EYYALEG+A L   ++ ++  LNP LR++G+L TM
Sbjct  118  APPSLSPLTLNALAAAEGVVVPVQAEYYALEGVAGLLAHLEEVRAGLNPSLRLLGILVTM  177

Query  185  YDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVAYLNL  244
            YD R  L + V A+L   FG+K++ TVIPRNVRLAEAP+ G  I     +S GA AY  L
Sbjct  178  YDGRTLLAQQVEAQLRAHFGEKVFWTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRL  237

Query  245  AAEMLKK  251
            A E++ +
Sbjct  238  AEEVMAR  244


> O07328 Soj-like [Streptomyces coelicolor (strain ATCC BAA-471 
/ A3(2) / M145)]
Length=255

 Score =  206 bits (525),  Expect = 2e-68
 Identities = 111/249 (45%), Positives = 156/249 (63%), Gaps = 2/249 (1%)

Query  5    IAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTDVL  64
            + +ANQKGGVGKTTT VNLAASLA+   RVL+VD+D QGNA+   GI  +  + S+ DVL
Sbjct  1    MVVANQKGGVGKTTTTVNLAASLALHGARVLVVDLDPQGNASTALGIDHHADVPSIYDVL  60

Query  65   LGEVPIETAITKAE--VGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDYII  122
            +   P+   +       G     +  DLAG E+ +     RE  L++A+       DYI+
Sbjct  61   VESRPLSEVVQPVPDVEGLFCAPATIDLAGAEIELVSLVARESRLQRAITAYEQPLDYIL  120

Query  123  IDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGVLR  182
            IDC PSL L+TVNAL A   V+IP+QCEYYALEGL  L + +D ++  LNP L +  +L 
Sbjct  121  IDCPPSLGLLTVNALVAGQEVLIPIQCEYYALEGLGQLLRNVDLVRGHLNPTLHVSTILL  180

Query  183  TMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVAYL  242
            TMYD R  L   V+ E+   FG+++  T IPR+VR++EAP++G  ++ ++  S GA++YL
Sbjct  181  TMYDGRTRLASQVADEVRSHFGEEVLRTSIPRSVRISEAPSYGQTVLTYDPGSSGALSYL  240

Query  243  NLAAEMLKK  251
              A E+  K
Sbjct  241  EAAREIALK  249


> Q9RFM1 ParA [Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) 
/ M145)]
Length=357

 Score =  208 bits (529),  Expect = 1e-67
 Identities = 111/251 (44%), Positives = 158/251 (63%), Gaps = 2/251 (1%)

Query  3    QIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTD  62
            +++ +ANQKGGVGKTTT VNLAASLA+   RVL+VD+D QGNA+   GI  +  + S+ D
Sbjct  81   RVMVVANQKGGVGKTTTTVNLAASLALHGARVLVVDLDPQGNASTALGIDHHADVPSIYD  140

Query  63   VLLGEVPIETAITKAE--VGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDY  120
            VL+   P+   +       G     +  DLAG E+ +     RE  L++A+       DY
Sbjct  141  VLVESRPLSEVVQPVPDVEGLFCAPATIDLAGAEIELVSLVARESRLQRAITAYEQPLDY  200

Query  121  IIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGV  180
            I+IDC PSL L+TVNAL A   V+IP+QCEYYALEGL  L + +D ++  LNP L +  +
Sbjct  201  ILIDCPPSLGLLTVNALVAGQEVLIPIQCEYYALEGLGQLLRNVDLVRGHLNPTLHVSTI  260

Query  181  LRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVA  240
            L TMYD R  L   V+ E+   FG+++  T IPR+VR++EAP++G  ++ ++  S GA++
Sbjct  261  LLTMYDGRTRLASQVADEVRSHFGEEVLRTSIPRSVRISEAPSYGQTVLTYDPGSSGALS  320

Query  241  YLNLAAEMLKK  251
            YL  A E+  K
Sbjct  321  YLEAAREIALK  331


> Q848S7 Chromosome partitioning protein [Enterococcus faecium]
Length=267

 Score =  169 bits (428),  Expect = 9e-54
 Identities = 104/256 (41%), Positives = 154/256 (60%), Gaps = 7/256 (3%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLA-VLKKRVLLVDMDSQGNATMGSGIQKNDLLY-  58
            MA+I+++ANQKGGV KTTT+VNLAA L  V  K VLLVD+D QGNAT   G   +     
Sbjct  6    MARILSVANQKGGVSKTTTSVNLAACLKFVYGKNVLLVDIDPQGNATDNVGFDIDGTNQP  65

Query  59   SVTDVLLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNF  118
            ++ +VL GE  I  AI   + G  VL ++  L+  E     Q G E  LK+ L  ++DN+
Sbjct  66   TIYEVLKGEADITDAILDYK-GIDVLPADIALSSAEREFT-QVGSEHRLKRVLQPIKDNY  123

Query  119  DYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRII  178
            DYIIIDC PSL ++TVNA    D ++IP++  Y++L+GL  L++TI+ +++  N  L + 
Sbjct  124  DYIIIDCPPSLGMLTVNAFTVSDEIIIPVEAAYFSLKGLIKLSETIETVKEYTNDKLEVR  183

Query  179  GVLRTMYDARNALTRDVSA---ELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSS  235
            GVL T Y+ R  +++++++   E+ +  G K++ T I R + + EA A G  +I F K S
Sbjct  184  GVLFTKYNKRYNISKEMTSAATEISRVIGAKIFKTYIRRTITVDEAQAAGSDLINFNKPS  243

Query  236  KGAVAYLNLAAEMLKK  251
                 Y     E LK+
Sbjct  244  TAEDDYKAFTEEYLKE  259


> Q2TM60 ParA family protein [Desulfovibrio gigas]
Length=261

 Score =  142 bits (359),  Expect = 1e-43
 Identities = 84/254 (33%), Positives = 146/254 (57%), Gaps = 7/254 (3%)

Query  2    AQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVT  61
            A+++A+ANQKGGVGKTTTA+ L+++L    KR L VD+D   +A++       ++  +V 
Sbjct  3    ARVLAVANQKGGVGKTTTALTLSSALGNYGKRTLAVDLDPHVSASIHLRCYPEEMEATVF  62

Query  62   DVLLGEVPIETAITKA----EVG--YKVLGSNRDLAGVELAIADQDGREFILKKALAQVR  115
            D+ +   P   A+       E G  ++    ++ L+ +E+ ++ + G+  +LK+AL  V 
Sbjct  63   DLFVHSGPELAAVWSRVRLWEPGKRFEFAPGHKRLSDLEVDLSGRKGKGLLLKRALESVL  122

Query  116  DNFDYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDL  175
            D +DYI++DC P L ++ VNAL A D +++P+Q ++ A+ GL  L +T+  + + L P  
Sbjct  123  DEYDYIVLDCPPHLGVLLVNALVAADLLVVPLQTDFMAVHGLKLLFETVGTLNK-LRPTP  181

Query  176  RIIGVLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSS  235
                VL TM+DAR +  R V   L +  G+ ++ T++  + +  EA A G  +      S
Sbjct  182  LRYKVLPTMFDARASACRRVLQLLREKLGENMFSTIVHMDTKFREASAQGRTVSDAYPES  241

Query  236  KGAVAYLNLAAEML  249
            +GA+ Y  LA E++
Sbjct  242  RGALEYQQLAKEII  255


> Q6TV39 Putative partition protein/ATPase [Bacillus methanolicus]
Length=256

 Score =  130 bits (327),  Expect = 4e-39
 Identities = 85/253 (34%), Positives = 135/253 (53%), Gaps = 9/253 (4%)

Query  4    IIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTDV  63
            IIA++  KGGV KT+   NLA +L   KK VL++D D+QGN  +  GI  + +  ++ DV
Sbjct  3    IIAVSTNKGGVLKTSITTNLAGALCNNKK-VLIIDTDNQGNVLVSFGINPDSVEQTLYDV  61

Query  64   LLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGRE----FILKKALAQVRDNFD  119
            L+  +  + AI        VL SN D++ +E  +     +      +LK A+  +   +D
Sbjct  62   LVEGLDPKEAIINVHPNIDVLPSNDDMSFLEFDVLSNREKYPTPFKMLKNAMGTIEKEYD  121

Query  120  YIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIG  179
            YI+ID  P+L LI  N L+  + V+IP Q E Y++  L  +   I   ++  NP L+I G
Sbjct  122  YILIDSPPNLGLIQGNILSYAESVLIPFQPEGYSMRSLIKILNAIYNFKEQHNPKLKIKG  181

Query  180  VLRTMYDARNALTRDVSAELEQFF---GKKLYDTVIPRNVRLAEAPAH-GLPIIYFEKSS  235
            V+ T+ D R  L  +V  +  +F    G ++++TVIPR+VR A + A+   P    +  +
Sbjct  182  VVATLVDQRTTLHSEVLQQCRRFCAENGIRMFETVIPRSVRFAASVAYERKPATLTDSKN  241

Query  236  KGAVAYLNLAAEM  248
                AY NL  E+
Sbjct  242  SLVKAYFNLLQEV  254


> O52265 AAA_31 domain-containing protein [Pseudomonas putida]
Length=277

 Score =  125 bits (315),  Expect = 3e-37
 Identities = 83/268 (31%), Positives = 138/268 (51%), Gaps = 22/268 (8%)

Query  3    QIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTD  62
            ++ A+ANQKGGVGKTTT + LA  LA   KRV++VD+D  G+ T   G   + L +S  D
Sbjct  2    RVWAVANQKGGVGKTTTTIALAGLLAEAGKRVVVVDLDPHGSMTSYFGHNPDALEHSCYD  61

Query  63   VLLGE---------------------VPIETAITKAEVGYKVLGSNRDLAGVELAIADQD  101
            + L                       +P +  +  ++    +L S+  LA +E     Q+
Sbjct  62   LFLHNPDALEHSCYDLFLHKGAVPDGLPGQLLLPTSDERISLLPSSTALAVLERQSPGQN  121

Query  102  GREFILKKALAQVRDNFDYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLT  161
            G   ++ K+LAQ+  +FDY +ID  P L ++ VNALAA   ++IP+Q E+ A++GL  + 
Sbjct  122  GLGLVIAKSLAQLWQDFDYAVIDSPPLLGVLMVNALAASQQLVIPVQTEFLAVKGLERMV  181

Query  162  QTIDRIQQALNPDLRIIGVLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEA  221
             T+  I ++    L    ++ T++D R   +      L   +G++++   IP + RL +A
Sbjct  182  GTLAMINRSRKQALP-YQIVPTLFDRRTQASLGTLKLLRDTYGQQVWQGYIPVDTRLRDA  240

Query  222  PAHGLPIIYFEKSSKGAVAYLNLAAEML  249
               G+    F+  S+G +AY  L   +L
Sbjct  241  SRKGVTPSQFDSKSRGLIAYRALLKHLL  268


> O87128 AAA family ATPase [Pseudomonas aeruginosa]
Length=262

 Score =  124 bits (312),  Expect = 7e-37
 Identities = 82/253 (32%), Positives = 138/253 (55%), Gaps = 7/253 (3%)

Query  3    QIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTD  62
            ++ A+ANQKGGVGKTT+++ LA  LA   KRV++VD+D  G+ T   G   + L +S  D
Sbjct  2    KVWAVANQKGGVGKTTSSIALAGLLADAGKRVVVVDLDPHGSMTSYFGYDPDTLEHSAFD  61

Query  63   VLL--GEVP--IETAITKAEVGYKV--LGSNRDLAGVELAIADQDGREFILKKALAQVRD  116
            + L  G VP  +  ++ ++    ++  L S+  LA +E     + G   ++ K+LAQ+  
Sbjct  62   LFLHQGNVPEGLPASLLRSTSNERISLLPSSTALATLERQSPGKSGLGLVVSKSLAQLWQ  121

Query  117  NFDYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLR  176
            +FD+ IID  P L ++ VNALAA   ++IP+Q E+ A++GL  +  T+  I ++    L 
Sbjct  122  DFDHAIIDSPPLLGVLMVNALAASQHLVIPVQTEFLAVKGLERMVNTLAMINRSRKQALP  181

Query  177  IIGVLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSK  236
               ++ T++D R   +      L + +   L+   IP + RL +A   G+     +  S+
Sbjct  182  YT-IVPTLFDRRTQASLSTLRILNENYPDNLWQAFIPIDTRLRDASRAGVTPSQHDGKSR  240

Query  237  GAVAYLNLAAEML  249
            G +AY  L   +L
Sbjct  241  GVIAYRALLKHLL  253



Lambda      K        H        a         alpha
   0.321    0.136    0.373    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1085750


  Database: c04e6d06350d5db92d0abfe79c36d32f.TrEMBL.fasta
    Posted date:  Sep 21, 2020  4:09 AM
  Number of letters in database: 6,108
  Number of sequences in database:  23



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40