ACIAD2367 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: ae0348cc2666cf9581941c9725c1e18a.SwissProt.fasta
           17 sequences; 4,799 total letters



Query= ACIAD2367

Length=261
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P0A149 Uncharacterized protein PP_0002 [Pseudomonas putida (str...   303    6e-106
  P0A150 Uncharacterized protein in gidB 3'region [Pseudomonas pu...   303    6e-106
  P37522 Sporulation initiation inhibitor protein Soj [Bacillus s...   250    2e-85 
  Q9K5N0 Sporulation initiation inhibitor protein Soj [Bacillus h...   249    3e-85 
  P0CAV7 Chromosome partitioning protein ParA [Caulobacter vibrio...   243    2e-82 
  B8GW31 Chromosome partitioning protein ParA [Caulobacter vibrio...   243    2e-82 
  O83296 Protein Soj homolog [Treponema pallidum (strain Nichols)]     223    6e-75 
  Q72H90 Chromosome-partitioning ATPase Soj [Thermus thermophilus...   213    3e-71 
  P9WLT0 Uncharacterized protein MT1749 [Mycobacterium tuberculos...   207    5e-68 
  P9WLT1 Uncharacterized protein Rv1708 [Mycobacterium tuberculos...   207    5e-68 
  Q60283 Uncharacterized protein MJECL24 [Methanocaldococcus jann...   141    3e-43 
  Q1DEM0 Cell division protein PomZ [Myxococcus xanthus (strain D...   130    2e-38 
  Q46263 Virulence plasmid ParA family protein pGP5-D [Chlamydoph...  98.2    2e-27 
  P07673 Protein IncC [Escherichia coli]                              98.2    5e-27 
  Q01464 Septum site-determining protein MinD [Bacillus subtilis ...  83.2    3e-22 
  Q52312 Protein IncC [Escherichia coli]                              79.3    2e-20 
  Q46441 Virulence plasmid ParA family protein pGP5-D [Chlamydia ...  73.9    5e-19 


> P0A149 Uncharacterized protein PP_0002 [Pseudomonas putida (strain 
ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)]
Length=263

 Score =  303 bits (775),  Expect = 6e-106
 Identities = 148/254 (58%), Positives = 201/254 (79%), Gaps = 1/254 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MA++ AIANQKGGVGKTTT +NLAASLA  K+RVLL+D+D QGNATMGSG+ K++L +SV
Sbjct  1    MAKVFAIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGNATMGSGVDKHELEHSV  60

Query  61   TDVLLGEVPIETAITKAEVG-YKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFD  119
             D+L+GE  +  A+  +E G +++L +NRDL   E+ + +   +E  L+ ALA +RDN+D
Sbjct  61   YDLLIGECDLAQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQVKESRLRNALAPIRDNYD  120

Query  120  YIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIG  179
            YI+IDC PSLS++T+NAL A DGV+IPMQCEYYALEGL+DL   I RI   LNP+L+I G
Sbjct  121  YILIDCPPSLSMLTLNALVASDGVIIPMQCEYYALEGLSDLVDNIKRIAARLNPELKIEG  180

Query  180  VLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAV  239
            +LRTMYD R +L  DVSA+L++ FG +LYDTVIPRN+RLAEAP+ G+P + ++K S+GA+
Sbjct  181  LLRTMYDPRLSLNNDVSAQLKEHFGPQLYDTVIPRNIRLAEAPSFGMPALAYDKQSRGAL  240

Query  240  AYLNLAAEMLKKSK  253
            AYL LA E++++ +
Sbjct  241  AYLALAGELVRRQR  254


> P0A150 Uncharacterized protein in gidB 3'region [Pseudomonas 
putida]
Length=263

 Score =  303 bits (775),  Expect = 6e-106
 Identities = 148/254 (58%), Positives = 201/254 (79%), Gaps = 1/254 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MA++ AIANQKGGVGKTTT +NLAASLA  K+RVLL+D+D QGNATMGSG+ K++L +SV
Sbjct  1    MAKVFAIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGNATMGSGVDKHELEHSV  60

Query  61   TDVLLGEVPIETAITKAEVG-YKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFD  119
             D+L+GE  +  A+  +E G +++L +NRDL   E+ + +   +E  L+ ALA +RDN+D
Sbjct  61   YDLLIGECDLAQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQVKESRLRNALAPIRDNYD  120

Query  120  YIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIG  179
            YI+IDC PSLS++T+NAL A DGV+IPMQCEYYALEGL+DL   I RI   LNP+L+I G
Sbjct  121  YILIDCPPSLSMLTLNALVASDGVIIPMQCEYYALEGLSDLVDNIKRIAARLNPELKIEG  180

Query  180  VLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAV  239
            +LRTMYD R +L  DVSA+L++ FG +LYDTVIPRN+RLAEAP+ G+P + ++K S+GA+
Sbjct  181  LLRTMYDPRLSLNNDVSAQLKEHFGPQLYDTVIPRNIRLAEAPSFGMPALAYDKQSRGAL  240

Query  240  AYLNLAAEMLKKSK  253
            AYL LA E++++ +
Sbjct  241  AYLALAGELVRRQR  254


> P37522 Sporulation initiation inhibitor protein Soj [Bacillus 
subtilis (strain 168)]
Length=253

 Score =  250 bits (638),  Expect = 2e-85
 Identities = 135/249 (54%), Positives = 172/249 (69%), Gaps = 1/249 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            M +IIAI NQKGGVGKTTT+VNL A LA + KRVLLVD+D QGNAT G GI+K D+   V
Sbjct  1    MGKIIAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGLGIEKADVEQCV  60

Query  61   TDVLLGEVPIETAITKAEV-GYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFD  119
             D+L+ +  +   I    V    V+ +   LAG E+ +     RE  LK+AL  V+ N+D
Sbjct  61   YDILVDDADVIDIIKATTVENLDVIPATIQLAGAEIELVPTISREVRLKRALEAVKQNYD  120

Query  120  YIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIG  179
            YIIIDC PSL L+T+NAL A D V+IP+QCEYYALEGL+ L  T+  +Q+ LN DL I G
Sbjct  121  YIIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLMIEG  180

Query  180  VLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAV  239
            VL TM DAR  L   V  E++++F  K+Y TVIPRNVRL+EAP+HG PII ++  S+GA 
Sbjct  181  VLLTMLDARTNLGIQVIEEVKKYFRDKVYKTVIPRNVRLSEAPSHGKPIILYDPRSRGAE  240

Query  240  AYLNLAAEM  248
             YL+LA E+
Sbjct  241  VYLDLAKEV  249


> Q9K5N0 Sporulation initiation inhibitor protein Soj [Bacillus 
halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 
9153 / C-125)]
Length=253

 Score =  249 bits (637),  Expect = 3e-85
 Identities = 134/250 (54%), Positives = 176/250 (70%), Gaps = 1/250 (0%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            MA++I+IANQKGGVGKTTTAVNL+A LA L +RVLLVD+D QGNAT G GI+K D+   +
Sbjct  1    MAKVISIANQKGGVGKTTTAVNLSACLAHLGQRVLLVDIDPQGNATSGVGIEKGDIDECI  60

Query  61   TDVLLGEVPIETAITKAEV-GYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFD  119
             DVL+ +V  +  I    +    VL S   L+G E+ +     RE  LK+AL QV   +D
Sbjct  61   YDVLVEDVDTQDVIRTTNMENLDVLPSTIQLSGAEIELVSTISREVRLKRALDQVGRKYD  120

Query  120  YIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIG  179
            +I IDC PSL L+T+NAL A D V+IP+QCEYYALEGL+ L  T+  +Q+ LN DL I G
Sbjct  121  FIFIDCPPSLGLLTINALTASDSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLAIEG  180

Query  180  VLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAV  239
            VL TM DAR  L   V  E++++F +K++DT+IPRNVRL EAP+HG PII ++  S+GA 
Sbjct  181  VLLTMLDARTNLGIQVIDEVKKYFREKVFDTIIPRNVRLGEAPSHGEPIIRYDAKSRGAE  240

Query  240  AYLNLAAEML  249
             YL+LA E++
Sbjct  241  VYLDLAKEVV  250


> P0CAV7 Chromosome partitioning protein ParA [Caulobacter vibrioides 
(strain ATCC 19089 / CB15)]
Length=267

 Score =  243 bits (619),  Expect = 2e-82
 Identities = 119/254 (47%), Positives = 177/254 (70%), Gaps = 3/254 (1%)

Query  3    QIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTD  62
            +++AIANQKGGVGKTTTA+NL  +LA   +RVLL+D D QGN + G GI +     ++ D
Sbjct  7    RVLAIANQKGGVGKTTTAINLGTALAACGERVLLIDADPQGNCSTGLGIGRTQRRTTLYD  66

Query  63   VLLGEVPIETAITKAEV-GYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDN--FD  119
            VL+GE P+  A  K E+ G  V+ ++ DL+GVE+ +     R + L+ AL  +R N  + 
Sbjct  67   VLMGEAPVVDAAVKTELPGLDVIPADADLSGVEIELGQTARRSYRLRDALEAIRANGPYT  126

Query  120  YIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIG  179
            Y++IDC PSL+++TVNA+ A D V +P+QCE++ALEGL  L +TI+R++ +LNP L I G
Sbjct  127  YVLIDCPPSLNVLTVNAMTAADAVFVPLQCEFFALEGLTQLMRTIERVRGSLNPRLEIQG  186

Query  180  VLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAV  239
            V+ TMYD RN+L+  V+ ++   FG K+YD VIPRNVR++EAP+ G P++ ++    G+ 
Sbjct  187  VVLTMYDRRNSLSEQVAKDVRAHFGDKVYDAVIPRNVRVSEAPSFGKPVLLYDLKCAGSQ  246

Query  240  AYLNLAAEMLKKSK  253
            AYL LA E++ + +
Sbjct  247  AYLKLAREVISRER  260


> B8GW31 Chromosome partitioning protein ParA [Caulobacter vibrioides 
(strain NA1000 / CB15N)]
Length=267

 Score =  243 bits (619),  Expect = 2e-82
 Identities = 119/254 (47%), Positives = 177/254 (70%), Gaps = 3/254 (1%)

Query  3    QIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTD  62
            +++AIANQKGGVGKTTTA+NL  +LA   +RVLL+D D QGN + G GI +     ++ D
Sbjct  7    RVLAIANQKGGVGKTTTAINLGTALAACGERVLLIDADPQGNCSTGLGIGRTQRRTTLYD  66

Query  63   VLLGEVPIETAITKAEV-GYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDN--FD  119
            VL+GE P+  A  K E+ G  V+ ++ DL+GVE+ +     R + L+ AL  +R N  + 
Sbjct  67   VLMGEAPVVDAAVKTELPGLDVIPADADLSGVEIELGQTARRSYRLRDALEAIRANGPYT  126

Query  120  YIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIG  179
            Y++IDC PSL+++TVNA+ A D V +P+QCE++ALEGL  L +TI+R++ +LNP L I G
Sbjct  127  YVLIDCPPSLNVLTVNAMTAADAVFVPLQCEFFALEGLTQLMRTIERVRGSLNPRLEIQG  186

Query  180  VLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAV  239
            V+ TMYD RN+L+  V+ ++   FG K+YD VIPRNVR++EAP+ G P++ ++    G+ 
Sbjct  187  VVLTMYDRRNSLSEQVAKDVRAHFGDKVYDAVIPRNVRVSEAPSFGKPVLLYDLKCAGSQ  246

Query  240  AYLNLAAEMLKKSK  253
            AYL LA E++ + +
Sbjct  247  AYLKLAREVISRER  260


> O83296 Protein Soj homolog [Treponema pallidum (strain Nichols)]
Length=253

 Score =  223 bits (568),  Expect = 6e-75
 Identities = 113/252 (45%), Positives = 166/252 (66%), Gaps = 4/252 (2%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSV  60
            M + +   NQKGGVGKTT+A+NL A LA+  K+ LLVD D QGN + G G+ +   +Y  
Sbjct  1    MGKTLVFVNQKGGVGKTTSAINLGAYLALAGKKTLLVDFDPQGNMSSGLGLARGLTVY--  58

Query  61   TDVLLGEVPIETAITKAEV-GYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFD  119
             D+L G+  I + +    V     + ++ DL+G  + + D+  RE  LKK LA+V+D +D
Sbjct  59   -DLLAGKAHINSVLRTTPVHNLFAIPASIDLSGATVELVDEQDRELYLKKILAEVKDTYD  117

Query  120  YIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIG  179
            +I+IDC PSL ++T+N LAA + V IP+QCEY+ALEGL  L QT+ R+Q  LN  L I G
Sbjct  118  FILIDCPPSLGILTLNGLAAANEVFIPLQCEYFALEGLTLLLQTVKRVQSGLNTALSIGG  177

Query  180  VLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAV  239
            +  TMYD R  L ++V  ++  +FG K+++T+IPRNV+L+EAP+HGLPI  ++    GA 
Sbjct  178  IFFTMYDTRTKLAQEVVKQVTTYFGDKVFNTIIPRNVKLSEAPSHGLPISSYDAQCAGAR  237

Query  240  AYLNLAAEMLKK  251
            +Y  LA E++ +
Sbjct  238  SYEKLAREIVAR  249


> Q72H90 Chromosome-partitioning ATPase Soj [Thermus thermophilus 
(strain HB27 / ATCC BAA-163 / DSM 7039)]
Length=249

 Score =  213 bits (543),  Expect = 3e-71
 Identities = 121/247 (49%), Positives = 167/247 (68%), Gaps = 10/247 (4%)

Query  5    IAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTDVL  64
            IA+ANQKGGVGKTTTA+NLAA LA L KRVLLVD+D QGNAT G G++    +Y +   L
Sbjct  9    IALANQKGGVGKTTTAINLAAYLARLGKRVLLVDLDPQGNATSGLGVRAERGVYHL---L  65

Query  65   LGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDYIIID  124
             GE P+E  +   + G+ +L +  DL G  + +A   G    L++AL    + +D +++D
Sbjct  66   QGE-PLEGLVHPVD-GFHLLPATPDLVGATVELA---GAPTALREALRD--EGYDLVLLD  118

Query  125  CAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGVLRTM  184
              PSLS +T+NALAA +GV++P+Q EYYALEG+A L  T++ ++  LNP LR++G+L TM
Sbjct  119  APPSLSPLTLNALAAAEGVVVPVQAEYYALEGVAGLLATLEEVRAGLNPRLRLLGILVTM  178

Query  185  YDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAVAYLNL  244
            YD R  L + V A+L   FG+K++ TVIPRNVRLAEAP+ G  I     +S GA AY  L
Sbjct  179  YDGRTLLAQQVEAQLRAHFGEKVFWTVIPRNVRLAEAPSFGKTIAQHAPTSPGAHAYRRL  238

Query  245  AAEMLKK  251
            A E++ +
Sbjct  239  AEEVMAR  245


> P9WLT0 Uncharacterized protein MT1749 [Mycobacterium tuberculosis 
(strain CDC 1551 / Oshkosh)]
Length=318

 Score =  207 bits (527),  Expect = 5e-68
 Identities = 112/252 (44%), Positives = 162/252 (64%), Gaps = 2/252 (1%)

Query  2    AQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVT  61
            A++IA+ NQKGGVGKTT+ +NL A+L    +RVLLVDMD QG  + G G+   +L  ++ 
Sbjct  64   AKVIAMCNQKGGVGKTTSTINLGAALGEYGRRVLLVDMDPQGALSAGLGVPHYELDKTIH  123

Query  62   DVLLG-EVPIETAITKAEV-GYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFD  119
            +VL+   V I+  +  + V    ++ SN DL+  E+ + ++ GRE  L +AL  V D +D
Sbjct  124  NVLVEPRVSIDDVLIHSRVKNMDLVPSNIDLSAAEIQLVNEVGREQTLARALYPVLDRYD  183

Query  120  YIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIG  179
            Y++IDC PSL L+TVN LA  DGV+IP +CE+++L GLA LT T+D+++  LNP L I G
Sbjct  184  YVLIDCQPSLGLLTVNGLACTDGVIIPTECEFFSLRGLALLTDTVDKVRDRLNPKLDISG  243

Query  180  VLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAV  239
            +L T YD R   +R+V A + + FG  ++DTVI R VR  E    G PI  +   S GA+
Sbjct  244  ILITRYDPRTVNSREVMARVVERFGDLVFDTVITRTVRFPETSVAGEPITTWAPKSAGAL  303

Query  240  AYLNLAAEMLKK  251
            AY  LA E++ +
Sbjct  304  AYRALARELIDR  315


> P9WLT1 Uncharacterized protein Rv1708 [Mycobacterium tuberculosis 
(strain ATCC 25618 / H37Rv)]
Length=318

 Score =  207 bits (527),  Expect = 5e-68
 Identities = 112/252 (44%), Positives = 162/252 (64%), Gaps = 2/252 (1%)

Query  2    AQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVT  61
            A++IA+ NQKGGVGKTT+ +NL A+L    +RVLLVDMD QG  + G G+   +L  ++ 
Sbjct  64   AKVIAMCNQKGGVGKTTSTINLGAALGEYGRRVLLVDMDPQGALSAGLGVPHYELDKTIH  123

Query  62   DVLLG-EVPIETAITKAEV-GYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFD  119
            +VL+   V I+  +  + V    ++ SN DL+  E+ + ++ GRE  L +AL  V D +D
Sbjct  124  NVLVEPRVSIDDVLIHSRVKNMDLVPSNIDLSAAEIQLVNEVGREQTLARALYPVLDRYD  183

Query  120  YIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIG  179
            Y++IDC PSL L+TVN LA  DGV+IP +CE+++L GLA LT T+D+++  LNP L I G
Sbjct  184  YVLIDCQPSLGLLTVNGLACTDGVIIPTECEFFSLRGLALLTDTVDKVRDRLNPKLDISG  243

Query  180  VLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGAV  239
            +L T YD R   +R+V A + + FG  ++DTVI R VR  E    G PI  +   S GA+
Sbjct  244  ILITRYDPRTVNSREVMARVVERFGDLVFDTVITRTVRFPETSVAGEPITTWAPKSAGAL  303

Query  240  AYLNLAAEMLKK  251
            AY  LA E++ +
Sbjct  304  AYRALARELIDR  315


> Q60283 Uncharacterized protein MJECL24 [Methanocaldococcus jannaschii 
(strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / 
NBRC 100440)]
Length=259

 Score =  141 bits (355),  Expect = 3e-43
 Identities = 84/257 (33%), Positives = 147/257 (57%), Gaps = 7/257 (3%)

Query  4    IIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGS-GIQKNDLLYSVTD  62
            +I+IANQKGGVGKTT A+NL+ +LA      L++D+D Q N + G  G++  D       
Sbjct  3    VISIANQKGGVGKTTIALNLSFTLAEKGYDTLVIDLDPQFNLSFGILGMKLLDYADKNIG  62

Query  63   VLLGE-----VPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDN  117
            +LL +       IE +I K      ++ S+  L+ VE  + +   RE  LK  + Q+++N
Sbjct  63   ILLSKNSVKKKEIEESIIKINDKLDLIPSHLQLSAVEKMLVNAYAREMKLKNIINQIKEN  122

Query  118  FDYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQA-LNPDLR  176
            +DYIIID APSL L  +N+L A D ++IP +  Y+++ G+  +  T++ I+++ LNP L+
Sbjct  123  YDYIIIDNAPSLGLFLINSLVASDYIIIPCEPSYFSIAGVQLMLDTVEEIKESNLNPKLK  182

Query  177  IIGVLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSK  236
            ++G +   Y  ++ + +    +L+Q +       VIPR + + +A   G P+  F+ ++ 
Sbjct  183  VLGFIFNKYSKQSKIPQKRLEQLKQLYPNIPVIGVIPRTITVEKAEREGKPVFKFDANNP  242

Query  237  GAVAYLNLAAEMLKKSK  253
             +VA+  LA  +++  K
Sbjct  243  ASVAFSELAEWVIENVK  259


> Q1DEM0 Cell division protein PomZ [Myxococcus xanthus (strain 
DK 1622)]
Length=319

 Score =  130 bits (326),  Expect = 2e-38
 Identities = 74/231 (32%), Positives = 128/231 (55%), Gaps = 1/231 (0%)

Query  9    NQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTDVLLGEV  68
            N KGG GKT+ + + A  LA L   VLL+D+DSQG+AT   G +  D   ++ DVL+ + 
Sbjct  59   NFKGGTGKTSLSTSYAWRLAELGYAVLLIDLDSQGHATKCLGYEGEDFEKTLLDVLVRKT  118

Query  69   PIETAITKAEV-GYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDNFDYIIIDCAP  127
            P+   I K+ +     + SN  ++ V+LA+    GREF L+ AL  V   +D ++ D  P
Sbjct  119  PLAKVIQKSSLPNLDFVPSNLTMSTVDLALMPMAGREFKLRNALKDVEAQYDVVVFDAPP  178

Query  128  SLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRIIGVLRTMYDA  187
            S  L+ +NAL A + + +P+  ++ +  GL  L +T+  +++ LN  L  + ++   ++A
Sbjct  179  SFGLLNLNALMAANDLFVPVLADFLSFHGLKLLFETVQSLEEDLNHVLDHVFIVVNSFNA  238

Query  188  RNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSKGA  238
               L ++    L+  + + L  T+I +  + A+A + G P+   + SSKGA
Sbjct  239  TFKLAKEALEALQTHYPEFLLPTIIRQCTKFAQASSEGRPVFVADPSSKGA  289


> Q46263 Virulence plasmid ParA family protein pGP5-D [Chlamydophila 
psittaci]
Length=259

 Score = 98.2 bits (243),  Expect = 2e-27
 Identities = 74/255 (29%), Positives = 129/255 (51%), Gaps = 19/255 (7%)

Query  5    IAIANQKGGVGKTTTAVNLAASLA-VLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTDV  63
            +A  + KGG GKTT ++N+ ++LA V +K+VLLVD+D Q N T G G+Q  D  +S+ ++
Sbjct  4    LAFCSFKGGTGKTTLSLNIGSNLAQVSRKKVLLVDLDPQANLTTGLGVQIQDD-HSLNEI  62

Query  64   LLGEVPIETAITKAEVGYKVLGSNRDLAGVELAIADQDGREFI-------LKKALAQVRD  116
            L     I  AI K ++       N D+    + + D  G +         L  AL +V+D
Sbjct  63   LRHSNEIRRAIHKTKI------ENLDIIPSSVLVEDFRGLDKDISLSVNHLHLALQKVQD  116

Query  117  NFDYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLR  176
             +D  I+D  PSL +++  A  A D +++ +  E +++ GL    Q I      +  +L 
Sbjct  117  QYDVCILDTPPSLGILSQEAFLASDYLVVCLTPEPFSILGL----QKIKEFCSTIGNNLD  172

Query  177  IIGVLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSSK  236
            I+G++ + +D RN+        +E  +  K+  + I R+V ++ +      +I    +S+
Sbjct  173  ILGIVFSFWDERNSTNSTYMDIIETIYEGKILSSKIRRDVTVSRSLLKESSVINAYPNSR  232

Query  237  GAVAYLNLAAEMLKK  251
             A   LNL  E+  K
Sbjct  233  AAKDILNLTKEIENK  247


> P07673 Protein IncC [Escherichia coli]
Length=364

 Score = 98.2 bits (243),  Expect = 5e-27
 Identities = 77/238 (32%), Positives = 115/238 (48%), Gaps = 12/238 (5%)

Query  5    IAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTDVL  64
            +  ANQKGGVGKT+T V+LA        RV ++D+D QGNA   S   K+         L
Sbjct  109  LVTANQKGGVGKTSTLVHLAFDFFERGLRVAVIDLDPQGNA---SYTLKDFATGLHASKL  165

Query  65   LGEVP----IETAITKAE---VGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVRDN  117
             G VP     ETA    +       ++ SN  LA  E    D D RE       A     
Sbjct  166  FGAVPAGGWTETAPAAGDGQAARLALIESNPVLANAERLSLD-DARELFGANIKALANQG  224

Query  118  FDYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRI  177
            FD  +ID AP+L +    AL A D V+ P++ E Y+++G+  +  TI  ++Q  N  L+ 
Sbjct  225  FDVCLIDTAPTLGVGLAAALFAADYVLSPIELEAYSIQGIKKMVTTIANVRQK-NAKLQF  283

Query  178  IGVLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSS  235
            +G++ +  DARN       AEL   + K +    +     +A+A A G+P+   +K++
Sbjct  284  LGMVPSKVDARNPRHARHQAELLAAYPKMMIPATVGLRSSIADALASGVPVWKIKKTA  341


> Q01464 Septum site-determining protein MinD [Bacillus subtilis 
(strain 168)]
Length=268

 Score = 83.2 bits (204),  Expect = 3e-22
 Identities = 68/257 (26%), Positives = 128/257 (50%), Gaps = 19/257 (7%)

Query  1    MAQIIAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMD-SQGNATMGSGIQKNDLLYS  59
            M + I I + KGGVGKTTT+ NL  +LA+L KRV LVD D    N  +  G++ N ++Y 
Sbjct  1    MGEAIVITSGKGGVGKTTTSANLGTALAILGKRVCLVDTDIGLRNLDVVMGLE-NRIIYD  59

Query  60   VTDVLLGEVPIETAITK----AEVGYKVLGSNRDLAGVELAIADQDGREFILKKALAQVR  115
            + DV+ G   +  A+ K     ++ Y +  +       + A+A +      +K  + +++
Sbjct  60   LVDVVEGRCKMHQALVKDKRFDDLLYLMPAAQ---TSDKTAVAPEQ-----IKNMVQELK  111

Query  116  DNFDYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDL  175
              FDY+IIDC   +     NA++  D  ++    E  A+     +   +++ ++ + P  
Sbjct  112  QEFDYVIIDCPAGIEQGYKNAVSGADKAIVVTTPEISAVRDADRIIGLLEQ-EENIEPPR  170

Query  176  RIIGVLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSS  235
             ++  +R  +  +N  T D+  E+ Q     L   ++  +  + +A  HG PI   +  +
Sbjct  171  LVVNRIRN-HLMKNGDTMDID-EIVQHLSIDLLG-IVADDDEVIKASNHGEPIA-MDPKN  226

Query  236  KGAVAYLNLAAEMLKKS  252
            + ++AY N+A  +L +S
Sbjct  227  RASIAYRNIARRILGES  243


> Q52312 Protein IncC [Escherichia coli]
Length=358

 Score = 79.3 bits (194),  Expect = 2e-20
 Identities = 62/237 (26%), Positives = 112/237 (47%), Gaps = 15/237 (6%)

Query  5    IAIANQKGGVGKTTTAVNLAASLAVLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVTDVL  64
            +  A QKGG GKT    +LA        RV ++D+D+QGNA+      ++   Y  + + 
Sbjct  108  LVTAIQKGGQGKTFATCHLAFDFLERGLRVAVIDLDTQGNASFTLSAYQSG--YLASQLF  165

Query  65   LGEVP-IETAITKAEVGYKVLGSNRDLAGVELAIADQDGREF-----ILKKALAQVRDNF  118
             G+   +     K E      G +  L   +  +A+ D  E       L+ ++A + + F
Sbjct  166  TGDTDDLRYWFGKRE------GESLALIAADANLANLDKMELSQAAAALRASVAALGEFF  219

Query  119  DYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQALNPDLRII  178
            D  +ID APSL +    A+   D ++ P++ E Y+L+G+  +   I  +++  NP LR +
Sbjct  220  DVCLIDTAPSLGVAMTAAVLTADYMLSPIEMEAYSLQGMKKMVAVISNLRKQ-NPKLRFL  278

Query  179  GVLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYFEKSS  235
            G++    DAR     +  A L+Q + + +    I     +AEA    +P+   +K++
Sbjct  279  GMVPNKVDARKPRHVNNLATLQQAYPQLILPFSIGARDSIAEALGEQMPVWKIKKTA  335


> Q46441 Virulence plasmid ParA family protein pGP5-D [Chlamydia 
muridarum (strain MoPn / Nigg)]
Length=268

 Score = 73.9 bits (180),  Expect = 5e-19
 Identities = 69/267 (26%), Positives = 123/267 (46%), Gaps = 24/267 (9%)

Query  3    QIIAIANQKGGVGKTTTAVNLAASLA-VLKKRVLLVDMDSQGNATMGSGIQKNDLLYSVT  61
            Q +   + KGG GKTT ++N+  +LA  L KRVLL+D+D Q N + G G         + 
Sbjct  6    QTLVFCSFKGGTGKTTLSLNVGCNLAQFLGKRVLLIDLDPQSNLSSGLGASIEGNHKGLH  65

Query  62   DVLLGEVPIETAITKA-EVGYKVLGSNRDLAGVELAIADQDGREF----ILKKALAQVRD  116
            +V+     +++ I K  + G  +         +  +   +  REF    I    L    D
Sbjct  66   EVMCASNDLKSIICKTKKTGVDI---------IPASFLSEQFREFSTNGIPSSNLRLFLD  116

Query  117  N-----FDYIIIDCAPSLSLITVNALAAVDGVMIPMQCEYYALEGLADLTQTIDRIQQAL  171
                  +D  I+D  PSL  +T  A  A D +++ +  E +++ GL  + + +  I +  
Sbjct  117  EYCSPLYDVCIVDTPPSLGGLTKEAFIAGDKLIVCLIPEPFSILGLQKIREFLISIGKP-  175

Query  172  NPDLRIIGVLRTMYDARNALTRDVSAELEQFFGKKLYDTVIPRNVRLAEAPAHGLPIIYF  231
              +  I+GV  + +D R++  +     +E  +  K++ T I R++ L+ +      +I  
Sbjct  176  -EEEHILGVALSFWDDRSSTNQTYIDIIESIYENKIFSTKIRRDISLSRSLLKEDSVINV  234

Query  232  EKSSKGAVAYLNLAAEM--LKKSKVKK  256
              +S+ A   LNL  E+  L  SK K+
Sbjct  235  YPTSRAATDILNLTHEISALLNSKHKQ  261



Lambda      K        H        a         alpha
   0.321    0.136    0.373    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 879067


  Database: ae0348cc2666cf9581941c9725c1e18a.SwissProt.fasta
    Posted date:  Sep 21, 2020  5:07 AM
  Number of letters in database: 4,799
  Number of sequences in database:  17



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40