ACIAD2327 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 50049ff3f980c82656f55582634b36e4.TrEMBL.fasta
           11 sequences; 5,718 total letters



Query= ACIAD2327

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FA05 Uncharacterized protein [Acinetobacter baylyi (strain AT...  1056    0.0  
  N9C186 Uncharacterized protein [Acinetobacter ursingii ANC 3649]     842    0.0  
  A0A009YTS8 PepSY-associated TM helix family protein [Acinetobac...   840    0.0  
  N9S2E1 Uncharacterized protein [Acinetobacter ursingii NIPH 706]     840    0.0  
  A0A0M1I2L2 Peptidase [Acinetobacter sp. C15]                         772    0.0  
  N9AH03 Uncharacterized protein [Acinetobacter soli NIPH 2899]        772    0.0  
  A0A1P8EFU9 Peptidase [Acinetobacter soli]                            768    0.0  
  R9AUQ4 Uncharacterized protein [Acinetobacter tandoii DSM 14970...   759    0.0  
  A0A2L0HZC9 Peptidase [Acinetobacter sp. ACNIH2]                      758    0.0  
  A0A0Q5G3W3 Peptidase [Acinetobacter sp. Leaf130]                     750    0.0  
  A0A0B2UF12 Peptidase [Acinetobacter oleivorans]                      748    0.0  


> Q6FA05 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=520

 Score = 1056 bits (2731),  Expect = 0.0
 Identities = 520/520 (100%), Positives = 520/520 (100%), Gaps = 0/520 (0%)

Query  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60
            MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK
Sbjct  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60

Query  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120
            TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG
Sbjct  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120

Query  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180
            DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL
Sbjct  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180

Query  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240
            DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP
Sbjct  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240

Query  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300
            QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA
Sbjct  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300

Query  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360
            THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK
Sbjct  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360

Query  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420
            RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW
Sbjct  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420

Query  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480
            LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF
Sbjct  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480

Query  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKLKLNENVEVNAS  520
            ILFAGFAYFILKNIHPIQIKAKEKLEKKLKLNENVEVNAS
Sbjct  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKLKLNENVEVNAS  520


> N9C186 Uncharacterized protein [Acinetobacter ursingii ANC 3649]
Length=519

 Score =  842 bits (2176),  Expect = 0.0
 Identities = 408/520 (78%), Positives = 458/520 (88%), Gaps = 1/520 (0%)

Query  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60
            MHK++RQSMAWLHSWTGLLLGWLLFAIF+MGTASYYRHEI+LWMQP+LAQY V QE++IK
Sbjct  1    MHKSIRQSMAWLHSWTGLLLGWLLFAIFVMGTASYYRHEINLWMQPKLAQYDVNQETAIK  60

Query  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120
            TAYQYLQ+HA  AK+WYIGVASEQSPVTNIYWQK  GGYESKTLDA TG+ELSLSAT GG
Sbjct  61   TAYQYLQEHAVGAKTWYIGVASEQSPVTNIYWQKADGGYESKTLDATTGKELSLSATQGG  120

Query  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180
            DFFY FHYQLFG PV+IGR+IVC+AAFIMLIALISGIITHKKI TDFFTLRTFKSQRSWL
Sbjct  121  DFFYTFHYQLFGFPVIIGRIIVCIAAFIMLIALISGIITHKKIITDFFTLRTFKSQRSWL  180

Query  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240
            DFHNVSSVIALPFFLMITFTGLAIFFYIYLP+GMKKLYPE+ FQ+FKEIRTNV+E ++PP
Sbjct  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPFGMKKLYPENSFQFFKEIRTNVIENKQPP  240

Query  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300
              MQN+ LE L  KAQ+QWG++ IDSITAD PNT+QA+ITI+Q +DHSITGNKPQITFDA
Sbjct  241  TDMQNLPLEVLLAKAQTQWGNKEIDSITADKPNTNQAQITISQTEDHSITGNKPQITFDA  300

Query  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360
            T GK L+A RN+S+IATLSFGVYGLHMA FAQPLLRLAFFFSGILGC MI+SGLLLWSLK
Sbjct  301  TTGKQLAATRNDSSIATLSFGVYGLHMATFAQPLLRLAFFFSGILGCFMIASGLLLWSLK  360

Query  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420
            RQIQNK   FHFGHYLVDRLNVATFVGLPI+M +YL +NR I+L+  MPNYE+YTFF+VW
Sbjct  361  RQIQNKTHAFHFGHYLVDRLNVATFVGLPISMLAYLYSNRFIELQPAMPNYEIYTFFIVW  420

Query  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480
            L++FI+AI T K WLWRSQL IFI L I LP FN+ YLI+   I  +  YW F RVD+ F
Sbjct  421  LASFILAIFTKKHWLWRSQLSIFILLAIALPFFNVIYLIQNHLITDLRSYWLFLRVDIVF  480

Query  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKLKLNENVEVNAS  520
            +LFAG   FI++NIHPIQ K++EKLEKKL L  N EVNAS
Sbjct  481  VLFAGLGLFIVRNIHPIQTKSREKLEKKLAL-ANPEVNAS  519


> A0A009YTS8 PepSY-associated TM helix family protein [Acinetobacter 
sp. 479375]
Length=519

 Score =  840 bits (2169),  Expect = 0.0
 Identities = 406/520 (78%), Positives = 458/520 (88%), Gaps = 1/520 (0%)

Query  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60
            MHK++RQSMAWLHSWTGLLLGWLLFAIF+MGTASYYRHEI+LWMQP+LAQY V QE++IK
Sbjct  1    MHKSIRQSMAWLHSWTGLLLGWLLFAIFVMGTASYYRHEINLWMQPKLAQYDVNQETAIK  60

Query  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120
            TAYQYLQ+HA  AK+WYIGVASEQSPVTNIYWQK  GGYESKTLDA TG+ELSLSAT GG
Sbjct  61   TAYQYLQEHAVGAKTWYIGVASEQSPVTNIYWQKADGGYESKTLDATTGKELSLSATQGG  120

Query  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180
            DFFY FHYQLFG PV+IGR+IVC+AAFIMLIALISGIITHKKI TDFFTLRTFKSQRSWL
Sbjct  121  DFFYTFHYQLFGFPVIIGRIIVCIAAFIMLIALISGIITHKKIITDFFTLRTFKSQRSWL  180

Query  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240
            DFHNVSSVIALPFFLMITFTGLAIFFYIYLP+GMKKLYPE+ FQ+FKEIRTNV+E ++PP
Sbjct  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPFGMKKLYPENSFQFFKEIRTNVIENKQPP  240

Query  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300
              M+N+ LE L  KAQ+QWG++ IDSITAD PNT+QA+ITI+Q +DHSITGNKPQITFDA
Sbjct  241  IDMKNLPLEVLLAKAQTQWGNKEIDSITADKPNTNQAQITISQTEDHSITGNKPQITFDA  300

Query  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360
            T GK L+A RN+S+IATLSFGVYGLHMA FAQPLLRLAFFFSGILGC MI+SGLLLWSLK
Sbjct  301  TTGKQLAATRNDSSIATLSFGVYGLHMATFAQPLLRLAFFFSGILGCFMIASGLLLWSLK  360

Query  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420
            RQIQNK   FHFGHYLVDRLNVATFVGLPI+M +YL +NR ++L+  MPNYE+YTFF+VW
Sbjct  361  RQIQNKTHAFHFGHYLVDRLNVATFVGLPISMLAYLYSNRFVELQPAMPNYEIYTFFIVW  420

Query  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480
            L++FI+AI T K WLWRSQL IFI L I LP FN+ YLI+   I  +  YW F RVD+ F
Sbjct  421  LASFILAIFTKKHWLWRSQLSIFILLAIALPFFNVIYLIQNHLITDLRSYWLFLRVDIVF  480

Query  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKLKLNENVEVNAS  520
            +LFAG   FI++NIHPIQ K++EKLEKKL L  N EVNAS
Sbjct  481  VLFAGLGLFIVRNIHPIQTKSREKLEKKLAL-ANPEVNAS  519


> N9S2E1 Uncharacterized protein [Acinetobacter ursingii NIPH 706]
Length=519

 Score =  840 bits (2169),  Expect = 0.0
 Identities = 406/520 (78%), Positives = 458/520 (88%), Gaps = 1/520 (0%)

Query  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60
            MHK++RQSMAWLHSWTGLLLGWLLFAIF+MGTASYYRHEI+LWMQP+LAQY V QE++IK
Sbjct  1    MHKSIRQSMAWLHSWTGLLLGWLLFAIFVMGTASYYRHEINLWMQPKLAQYDVNQETAIK  60

Query  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120
            TAYQYLQ+HA  AK+WYIGVASEQSPVTNIYWQK  GGYESKTLDA TG+ELSLSAT GG
Sbjct  61   TAYQYLQEHAVGAKTWYIGVASEQSPVTNIYWQKADGGYESKTLDATTGKELSLSATQGG  120

Query  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180
            DFFY FHYQLFG PV+IGR+IVC+AAFIMLIALISGIITHKKI TDFFTLRTFKSQRSWL
Sbjct  121  DFFYTFHYQLFGFPVIIGRIIVCIAAFIMLIALISGIITHKKIITDFFTLRTFKSQRSWL  180

Query  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240
            DFHNVSSVIALPFFLMITFTGLAIFFYIYLP+GMKKLYPE+ FQ+FKEIRTNV+E ++PP
Sbjct  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPFGMKKLYPENSFQFFKEIRTNVIENKQPP  240

Query  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300
              M+N+ LE L  KAQ+QWG++ IDSITAD PNT+QA+ITI+Q +DHSITGNKPQITFDA
Sbjct  241  IDMKNLPLEVLLAKAQTQWGNKEIDSITADKPNTNQAQITISQTEDHSITGNKPQITFDA  300

Query  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360
            T GK L+A RN+S+IATLSFGVYGLHMA FAQPLLRLAFFFSGILGC MI+SGLLLWSLK
Sbjct  301  TTGKQLAATRNDSSIATLSFGVYGLHMATFAQPLLRLAFFFSGILGCFMIASGLLLWSLK  360

Query  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420
            RQIQNK   FHFGHYLVDRLNVATFVGLPI+M +YL +NR ++L+  MPNYE+YTFF+VW
Sbjct  361  RQIQNKTHAFHFGHYLVDRLNVATFVGLPISMLAYLYSNRFVELQPAMPNYEIYTFFIVW  420

Query  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480
            L++FI+AI T K WLWRSQL IFI L I LP FN+ YLI+   I  +  YW F RVD+ F
Sbjct  421  LASFILAIFTKKHWLWRSQLSIFILLAIALPFFNVIYLIQNHLITDLRSYWLFLRVDIVF  480

Query  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKLKLNENVEVNAS  520
            +LFAG   FI++NIHPIQ K++EKLEKKL L  N EVNAS
Sbjct  481  VLFAGLGLFIVRNIHPIQTKSREKLEKKLAL-ANPEVNAS  519


> A0A0M1I2L2 Peptidase [Acinetobacter sp. C15]
Length=523

 Score =  772 bits (1993),  Expect = 0.0
 Identities = 363/523 (69%), Positives = 434/523 (83%), Gaps = 3/523 (1%)

Query  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60
            M KN+RQSMAWLHSWTGLLLGWLLFAIF+MG+ SYYRHEI++WMQP+LAQY V QE+++K
Sbjct  1    MQKNIRQSMAWLHSWTGLLLGWLLFAIFLMGSMSYYRHEITMWMQPELAQYNVAQETALK  60

Query  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120
            TAYQYL  HA DAKSWYIGVASE+SPV N+YWQK  GG+E KTL+  TGQEL LSAT GG
Sbjct  61   TAYQYLDVHAHDAKSWYIGVASEKSPVNNVYWQKADGGFERKTLNPATGQELQLSATKGG  120

Query  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180
            DFFY FH+QLFG+P ++GR+IVC+AAFIMLIAL+SGIITHKKIFTDFFTLRTFKSQRSWL
Sbjct  121  DFFYEFHFQLFGVPYLVGRIIVCIAAFIMLIALVSGIITHKKIFTDFFTLRTFKSQRSWL  180

Query  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240
            DFHNVSSV+ALPFFL ITFTGLAIFFYIYLPWGM+KLYP+DPFQYFKEIR    E    P
Sbjct  181  DFHNVSSVLALPFFLTITFTGLAIFFYIYLPWGMQKLYPDDPFQYFKEIRAKATEQTVVP  240

Query  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300
               Q++ + TL      +WG+   DS++A NPNT  ++IT TQ++D +IT N+P +T +A
Sbjct  241  STRQDLPINTLLATVHKEWGNTTFDSVSAQNPNTTHSQITFTQSKDETITQNRPTLTLNA  300

Query  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360
              G+V++  RN+SAIATLSFGVYGLHMA FAQPLLRLAFFFSGILGC MI+SGLLLWSLK
Sbjct  301  QTGEVIANTRNDSAIATLSFGVYGLHMATFAQPLLRLAFFFSGILGCFMIASGLLLWSLK  360

Query  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420
            RQ+QNK ++FHFGHYLVDRLNVA+FVGLPIAM SYL ANRL  ++A+  NYE+ +FF VW
Sbjct  361  RQLQNKQQRFHFGHYLVDRLNVASFVGLPIAMLSYLFANRLTDVQASTANYEIISFFTVW  420

Query  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480
            LS+F++A++TP+  LW+SQL +FI   I L CFNL YL+++D++H IS YW F R+DL  
Sbjct  421  LSSFLLALVTPRQLLWKSQLSVFIFCSISLACFNLMYLVQHDYVHHISSYWIFLRIDLML  480

Query  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKL---KLNENVEVNAS  520
            I+FAG A FILKNIHPIQ+ A +KL KK+   K  +N EVNAS
Sbjct  481  IIFAGLALFILKNIHPIQMHAYKKLSKKIHSAKNTKNTEVNAS  523


> N9AH03 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=523

 Score =  772 bits (1993),  Expect = 0.0
 Identities = 363/523 (69%), Positives = 434/523 (83%), Gaps = 3/523 (1%)

Query  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60
            M KN+RQSMAWLHSWTGLLLGWLLFAIF+MG+ SYYRHEI++WMQP+LAQY V QE+++K
Sbjct  1    MQKNIRQSMAWLHSWTGLLLGWLLFAIFLMGSMSYYRHEITMWMQPELAQYNVAQETALK  60

Query  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120
            TAYQYL  HA DAKSWYIGVASE+SPV N+YWQK  GG+E KTL+  TGQEL LSAT GG
Sbjct  61   TAYQYLDVHAHDAKSWYIGVASEKSPVNNVYWQKADGGFERKTLNPATGQELQLSATKGG  120

Query  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180
            DFFY FH+QLFG+P ++GR+IVC+AAFIMLIAL+SGIITHKKIFTDFFTLRTFKSQRSWL
Sbjct  121  DFFYEFHFQLFGVPYLVGRIIVCIAAFIMLIALVSGIITHKKIFTDFFTLRTFKSQRSWL  180

Query  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240
            DFHNVSSV+ALPFFL ITFTGLAIFFYIYLPWGM+KLYP+DPFQYFKEIR    E    P
Sbjct  181  DFHNVSSVLALPFFLTITFTGLAIFFYIYLPWGMQKLYPDDPFQYFKEIRAKATEQTVVP  240

Query  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300
               Q++ + TL      +WG+   DS++A NPNT  ++IT TQ++D +IT N+P +T +A
Sbjct  241  STRQDLPINTLLATVHKEWGNTTFDSVSAQNPNTTHSQITFTQSKDETITQNRPTLTLNA  300

Query  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360
              G+V++  RN+SAIATLSFGVYGLHMA FAQPLLRLAFFFSGILGC MI+SGLLLWSLK
Sbjct  301  QTGEVIANTRNDSAIATLSFGVYGLHMATFAQPLLRLAFFFSGILGCFMIASGLLLWSLK  360

Query  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420
            RQ+QNK ++FHFGHYLVDRLNVA+FVGLPIAM SYL ANRL  ++A+  NYE+ +FF VW
Sbjct  361  RQLQNKQQRFHFGHYLVDRLNVASFVGLPIAMLSYLFANRLTDVQASTANYEIISFFTVW  420

Query  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480
            LS+F++A++TP+  LW+SQL +FI   I L CFNL YL+++D++H IS YW F R+DL  
Sbjct  421  LSSFLLALVTPRQLLWKSQLSVFIFCSISLACFNLMYLVQHDYVHHISSYWIFLRIDLML  480

Query  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKL---KLNENVEVNAS  520
            I+FAG A FILKNIHPIQ+ A +KL KK+   K  +N EVNAS
Sbjct  481  IIFAGLALFILKNIHPIQMHAYKKLSKKIHSAKNTKNTEVNAS  523


> A0A1P8EFU9 Peptidase [Acinetobacter soli]
Length=523

 Score =  768 bits (1983),  Expect = 0.0
 Identities = 362/523 (69%), Positives = 432/523 (83%), Gaps = 3/523 (1%)

Query  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60
            M KN+RQSMAWLHSWTGLLLGWLLFAIF+MG+ SYYRHEI++WMQP+LAQY V QE+++K
Sbjct  1    MQKNIRQSMAWLHSWTGLLLGWLLFAIFLMGSMSYYRHEITMWMQPELAQYDVAQETALK  60

Query  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120
            TAYQYL  HA DAKSWYIGVASE+SPV N+YWQK  GG+E KTL+  TGQEL LSAT GG
Sbjct  61   TAYQYLNVHAHDAKSWYIGVASEKSPVNNVYWQKADGGFERKTLNPATGQELQLSATKGG  120

Query  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180
            DFFY FH+QLFG+P ++GR+IVC+AAFIMLIAL+SGIITHKKIFTDFFTLRTFKSQRSWL
Sbjct  121  DFFYEFHFQLFGVPYLVGRIIVCIAAFIMLIALVSGIITHKKIFTDFFTLRTFKSQRSWL  180

Query  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240
            DFHNVSSV+ALPFFL ITFTGLAIFFYIYLPWGM+KLY +DPFQYFKEIR    E    P
Sbjct  181  DFHNVSSVLALPFFLTITFTGLAIFFYIYLPWGMQKLYSDDPFQYFKEIRAKATEQTVVP  240

Query  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300
               Q++ + TL      +WG+   DS++A NPNT  ++IT TQ++D +IT N+P +T +A
Sbjct  241  STRQDLPINTLLATVHKEWGNTTFDSVSAQNPNTTHSQITFTQSKDETITQNRPTLTLNA  300

Query  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360
              G+V++  RN+SAIATLSFGVYGLHMA FAQPLLRLAFFFSGILGC MI+SGLLLWSLK
Sbjct  301  QTGEVIANTRNDSAIATLSFGVYGLHMATFAQPLLRLAFFFSGILGCFMIASGLLLWSLK  360

Query  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420
            RQ+QNK ++FHFGHYLVDRLNVA+FVGLPIAM SYL ANRL  ++A+  NYE+ +FF VW
Sbjct  361  RQLQNKQQRFHFGHYLVDRLNVASFVGLPIAMLSYLFANRLTDVQASTANYEIISFFTVW  420

Query  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480
            LS+F++A++TP+  LW+SQL +FI   I L CFNL YL+++D++H IS YW F R+DL  
Sbjct  421  LSSFLLALVTPRQLLWKSQLSVFIFCSISLACFNLMYLVQHDYVHHISSYWIFLRIDLML  480

Query  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKL---KLNENVEVNAS  520
            I+FAG A FILKNIHPIQ  A +KL KK+   K  +N EVNAS
Sbjct  481  IVFAGLALFILKNIHPIQTHAHKKLSKKIHSAKNTKNTEVNAS  523


> R9AUQ4 Uncharacterized protein [Acinetobacter tandoii DSM 14970 
= CIP 107469]
Length=518

 Score =  759 bits (1961),  Expect = 0.0
 Identities = 364/518 (70%), Positives = 417/518 (81%), Gaps = 0/518 (0%)

Query  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60
            MHK++RQSMAWLHSWTGLLLGW++FAIF+MGTASYYRHEI+LWMQPQLA+Y++QQ+ +I 
Sbjct  1    MHKSIRQSMAWLHSWTGLLLGWVIFAIFLMGTASYYRHEINLWMQPQLAKYEIQQQIAIL  60

Query  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120
            +A  YLQ HAPDAKSW+IG+AS +SPV NIYWQK  GGYESKTLDA TG+ELSLSAT GG
Sbjct  61   SATNYLQNHAPDAKSWFIGIASAESPVNNIYWQKADGGYESKTLDATTGKELSLSATEGG  120

Query  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180
            DFFY FHYQLFGLPV IGRV V +AAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL
Sbjct  121  DFFYHFHYQLFGLPVDIGRVAVSIAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180

Query  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240
            DFHNVSSVIALPFFLMITFTGLAIFFY+YLPWGMK LYPE+P+QYF EIRTNVV      
Sbjct  181  DFHNVSSVIALPFFLMITFTGLAIFFYLYLPWGMKALYPENPYQYFTEIRTNVVTQNTSI  240

Query  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300
             P  N+ +  L  K +  WG Q + SI+  NPNT+QA  T TQ QDHSITGN+PQIT   
Sbjct  241  TPQANLQMSELLQKVEQHWGKQELRSISVQNPNTNQALYTFTQLQDHSITGNQPQITLRG  300

Query  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360
                + +A RN SA+ATLSFGVYGLHMA FAQPLLRLA FFSG+LGC MI+SGLLLWSLK
Sbjct  301  HDALITAATRNNSAVATLSFGVYGLHMATFAQPLLRLALFFSGLLGCCMIASGLLLWSLK  360

Query  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420
            RQ+QNK ++FH GHYLVDRLNVATFVGLP+AM  Y   NRL+ + A+MPNYE+Y FF+ W
Sbjct  361  RQLQNKTQQFHLGHYLVDRLNVATFVGLPLAMMGYFYTNRLVYITADMPNYEIYNFFIFW  420

Query  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480
              + + A  TPK WLWRSQL   I L   LP F+LFYLI++ +I  +  YW FFRVDLFF
Sbjct  421  GLSLVAAFFTPKQWLWRSQLACLIILAACLPAFDLFYLIQHQYIDSLRSYWAFFRVDLFF  480

Query  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKLKLNENVEVN  518
            IL A  +YFI KNIHPIQ  AK+K+ KKL     V+ +
Sbjct  481  ILLAILSYFIFKNIHPIQTTAKQKIIKKLTSTPEVKAS  518


> A0A2L0HZC9 Peptidase [Acinetobacter sp. ACNIH2]
Length=518

 Score =  758 bits (1957),  Expect = 0.0
 Identities = 364/518 (70%), Positives = 420/518 (81%), Gaps = 0/518 (0%)

Query  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60
            MHK++RQSMAWLHSWTGLLLGW++FAIF+MGTASYYRHEI+LWMQPQLA+Y++QQ+ +I 
Sbjct  1    MHKSIRQSMAWLHSWTGLLLGWVIFAIFLMGTASYYRHEINLWMQPQLAKYEIQQQIAIL  60

Query  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120
            +A  YLQ HAPDAKSW+IG+AS +SPV NIYWQK  GGYESKTLDA TG+ELSLSAT GG
Sbjct  61   SATNYLQNHAPDAKSWFIGIASAESPVNNIYWQKADGGYESKTLDATTGKELSLSATEGG  120

Query  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180
            DFFY FHYQLFGLPV IGRV V +AAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL
Sbjct  121  DFFYHFHYQLFGLPVDIGRVAVSIAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180

Query  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240
            DFHNVSSVIALPFFLMITFTGLAIFFY+YLPWGMK LYPE+P+QYF EIRTNVV      
Sbjct  181  DFHNVSSVIALPFFLMITFTGLAIFFYLYLPWGMKALYPENPYQYFTEIRTNVVTQNTSI  240

Query  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300
             P  N+ +  L  K +  WG Q + SI+  NPNT+QA  T TQ QDHSITGN+PQIT   
Sbjct  241  TPQANLQMSELLQKVEQHWGKQELRSISVQNPNTNQALYTFTQLQDHSITGNQPQITLRG  300

Query  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360
                + +A RN+SA+ATLSFGVYGLHMA FAQPLLRLA FFSG+LGC MI+SGLLLWSLK
Sbjct  301  HDALMTAATRNDSAVATLSFGVYGLHMATFAQPLLRLALFFSGLLGCCMIASGLLLWSLK  360

Query  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420
            RQ+QNK ++FH+GHYLVDRLNVATFVGLP+AM  Y   NRL+ + A+MPNYE+Y FF+ W
Sbjct  361  RQLQNKTQQFHWGHYLVDRLNVATFVGLPLAMMGYFYTNRLVFITADMPNYEIYNFFIFW  420

Query  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480
              + + A  TPK WLWRSQL   I L   LP F+LFYLI++ +I  + +YW FFRVDLFF
Sbjct  421  GLSLVAAFFTPKQWLWRSQLICLIILAACLPVFDLFYLIQHQYIDSLRNYWAFFRVDLFF  480

Query  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKLKLNENVEVN  518
            IL A  +YFI KNIHPIQ  AK+K+ KKL     V+ +
Sbjct  481  ILLAILSYFIFKNIHPIQTTAKQKIIKKLTSTPEVKTS  518


> A0A0Q5G3W3 Peptidase [Acinetobacter sp. Leaf130]
Length=518

 Score =  750 bits (1937),  Expect = 0.0
 Identities = 358/516 (69%), Positives = 426/516 (83%), Gaps = 1/516 (0%)

Query  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60
            MHK +RQSMAWLHSWTGL+ GWL+FAIF+MG+ SYYRHEI+LWMQP LAQY+V+Q+ +IK
Sbjct  1    MHKGIRQSMAWLHSWTGLIFGWLVFAIFLMGSLSYYRHEINLWMQPPLAQYEVKQDIAIK  60

Query  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120
            TAYQYLQ+HAPDAKSWY+ VA+ +SPV  +YW+K  GGY + TLDANTGQEL LSATLGG
Sbjct  61   TAYQYLQEHAPDAKSWYLNVATPESPVNTMYWEKADGGYGNATLDANTGQELKLSATLGG  120

Query  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180
            DFFY FHYQLFG+P+ IGR+IVCLAAFIMLIAL+SGIITHKKIFTDFFTLRTFKSQRSWL
Sbjct  121  DFFYRFHYQLFGIPIFIGRLIVCLAAFIMLIALVSGIITHKKIFTDFFTLRTFKSQRSWL  180

Query  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240
            DFHN+SSVIALPFFL ITFTGLAIFFY+YLPWGM+KLYPE+P+QYF EIRT  V   +  
Sbjct  181  DFHNISSVIALPFFLTITFTGLAIFFYLYLPWGMQKLYPENPYQYFTEIRTKTVLENQSI  240

Query  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300
            QP QN+S+E L  + Q  WG+Q + +I+  NPNT+QA+IT  Q +DHSIT N+ QIT +A
Sbjct  241  QPAQNLSIEKLLSQVQQNWGNQTLSTISVKNPNTNQAQITFIQNEDHSITRNQAQITLNA  300

Query  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360
            + GKVL+  RN SAIATL+ GVYGLHMA FAQPLLRL FFFSGILGC+MI+SGLLLWSLK
Sbjct  301  STGKVLADTRNNSAIATLNAGVYGLHMATFAQPLLRLGFFFSGILGCVMIASGLLLWSLK  360

Query  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420
            RQIQNK  KFHFGHYLVDRLNVATFVGLP A  +YL ANRL  + +   NYE+Y+FF+VW
Sbjct  361  RQIQNKNSKFHFGHYLVDRLNVATFVGLPCATVAYLSANRLFTVTSTTINYEIYSFFLVW  420

Query  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480
            L + IIA++T K +LWR+QL IFI L + LP  NL YL+++D++   ++YWTF R+D+F 
Sbjct  421  LISLIIALVTKKQYLWRTQLSIFILLCMALPVLNLIYLLKHDYVESFNNYWTFARIDVFL  480

Query  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKL-KLNENV  515
             +FA  A FI   I PIQ KA EK++KKL KLN  V
Sbjct  481  WIFAALAIFIFCKIQPIQHKAVEKIQKKLNKLNTEV  516


> A0A0B2UF12 Peptidase [Acinetobacter oleivorans]
Length=518

 Score =  748 bits (1930),  Expect = 0.0
 Identities = 359/516 (70%), Positives = 425/516 (82%), Gaps = 1/516 (0%)

Query  1    MHKNVRQSMAWLHSWTGLLLGWLLFAIFIMGTASYYRHEISLWMQPQLAQYQVQQESSIK  60
            MHK +RQSMAWLHSWTGL+ GWL+FAIF+MG+ SYYRHEI+LWMQP LAQY+V+Q+ +IK
Sbjct  1    MHKGIRQSMAWLHSWTGLIFGWLVFAIFLMGSLSYYRHEINLWMQPPLAQYEVKQDVAIK  60

Query  61   TAYQYLQQHAPDAKSWYIGVASEQSPVTNIYWQKKQGGYESKTLDANTGQELSLSATLGG  120
            TAYQYLQ HAPDAKSWY+ VA+ +S V  +YW+K  GGY + TLDANTGQEL LSATLGG
Sbjct  61   TAYQYLQDHAPDAKSWYLTVATPESAVNTMYWEKPDGGYGNATLDANTGQELQLSATLGG  120

Query  121  DFFYAFHYQLFGLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQRSWL  180
            DFFY FHYQLFGLP+ IGR+IVCLAAFIMLIAL+SGIITHKKIFTDFFTLRTFKSQRSWL
Sbjct  121  DFFYRFHYQLFGLPIFIGRLIVCLAAFIMLIALVSGIITHKKIFTDFFTLRTFKSQRSWL  180

Query  181  DFHNVSSVIALPFFLMITFTGLAIFFYIYLPWGMKKLYPEDPFQYFKEIRTNVVEIQRPP  240
            DFHN+SSVIALPFFL ITFTGLAIFFY+YLPWGM+KLYPE+P+QYF EIRT  V   +  
Sbjct  181  DFHNISSVIALPFFLTITFTGLAIFFYLYLPWGMQKLYPENPYQYFTEIRTKAVPENQSI  240

Query  241  QPMQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQDHSITGNKPQITFDA  300
            QP QN+S+E L  + Q  WG+Q + +I+  NPNT+QA+IT  Q +DHSIT N+ QIT +A
Sbjct  241  QPAQNLSIEKLLSQVQQNWGNQTLSTISVKNPNTNQAQITFIQKEDHSITRNQAQITLNA  300

Query  301  THGKVLSAIRNESAIATLSFGVYGLHMANFAQPLLRLAFFFSGILGCLMISSGLLLWSLK  360
            + G+VL+  RN SAIATL+ GVYGLHMA FAQPLLRL FFFSGILGC+MI+SGLLLWSLK
Sbjct  301  STGEVLADTRNNSAIATLNAGVYGLHMATFAQPLLRLGFFFSGILGCVMIASGLLLWSLK  360

Query  361  RQIQNKIRKFHFGHYLVDRLNVATFVGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVW  420
            RQIQNK  KFHFGHYLVDRLNVATFVGLP A  +YL ANRL  + +   NYE+Y+FF+VW
Sbjct  361  RQIQNKNSKFHFGHYLVDRLNVATFVGLPCATVAYLSANRLFTVTSTTINYEIYSFFLVW  420

Query  421  LSTFIIAILTPKVWLWRSQLGIFIGLGIGLPCFNLFYLIRYDFIHQISDYWTFFRVDLFF  480
            L + IIA++T K  LWR+QL IFI L + LP  NL YL+++D+I  ++ YW F R+D+F 
Sbjct  421  LISLIIALVTKKQHLWRTQLSIFIMLCMVLPILNLSYLLQHDYIQSLNSYWVFARIDIFL  480

Query  481  ILFAGFAYFILKNIHPIQIKAKEKLEKKL-KLNENV  515
            ++FAG A FIL  I PIQ KA EK++KKL KLN  V
Sbjct  481  LIFAGLAIFILCKIQPIQHKAVEKIQKKLNKLNTEV  516



Lambda      K        H        a         alpha
   0.329    0.141    0.443    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2423790


  Database: 50049ff3f980c82656f55582634b36e4.TrEMBL.fasta
    Posted date:  Sep 21, 2020  5:23 AM
  Number of letters in database: 5,718
  Number of sequences in database:  11



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40