ACIAD2327 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: df46307c8fd20474c5ed7d3aff6cfe85.SwissProt.fasta
           1 sequences; 394 total letters



Query= ACIAD2327

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P42514 Uncharacterized protein PA4219 [Pseudomonas aeruginosa (...  59.3    7e-14


> P42514 Uncharacterized protein PA4219 [Pseudomonas aeruginosa 
(strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 
12228 / 1C / PRS 101 / PAO1)]
Length=394

 Score = 59.3 bits (142),  Expect = 7e-14
 Identities = 90/368 (24%), Positives = 141/368 (38%), Gaps = 72/368 (20%)

Query  121  DFFYAFHYQLF-GLPVMIGRVIVCLAAFIMLIALISGIITHKKIFTDFFTLRTFKSQR-S  178
            D     H  LF G P   GRV+V L    +L+  ++G++ H + + D    R  +  R +
Sbjct  5    DLLLNLHKSLFVGFP---GRVLVSLFGVSLLLLCLAGVLLHSRRWRDLRRWRRDRGLRLA  61

Query  179  WLDFHNVSSVIALPFFLMITFTGL-----AIFFYIYLPWGMKKLYPEDPFQYFKEIRTNV  233
              D H +  +  LP+ L+  FTG      A+   +  P      YP++P + F       
Sbjct  62   LFDLHGLIGIWGLPWLLLFGFTGALSGLGALGTLLLAP----VAYPQEPNRVF-------  110

Query  234  VEIQRPPQP-------MQNISLETLFVKAQSQWGHQAIDSITADNPNTDQARITITQAQD  286
            VE+  PP P          I L+ L           A D++ A  P     R++++ A D
Sbjct  111  VELMGPPPPAAEGRPLASRIDLDRLL----------AGDAVRA--PGFVAQRLSLSHAGD  158

Query  287  HS----ITGNKPQITFDATHGKVLSAIRNESAIATLSFGVYGLHMANF--AQPL------  334
             +    I G +  +   A   +    + + + +   S    G  +  F   QPL      
Sbjct  159  VAGSVEIAGIRRGLPSTANFERHRYRLADGTLLGERSSAQRGFWLRAFIAVQPLHFAQYQ  218

Query  335  ---------LRLAFFFSGILGCLMISSGLLLWSLKRQIQNKIRKFHFGHYLVDRLNVATF  385
                     LR      G+  CL+ +SGL LW  +R      R       L+ RL+    
Sbjct  219  WLGPGWSAALRGLHLAMGLGACLLCASGLYLWLQRRASAPDARV-----RLLQRLSQGFC  273

Query  386  VGLPIAMTSYLLANRLIKLEANMPNYEVYTFFMVWLSTFIIAILTPKVW-LWRSQLGIFI  444
             GL  A    LL  +L   E     +    F ++W +  + A+L P  W L R  LG+  
Sbjct  274  AGLVAAAALLLLGLQLAPSELLAGPWPGRLFLVLWAAAGLAALLLPGDWPLARGLLGV--  331

Query  445  GLGIGLPC  452
                GL C
Sbjct  332  ---AGLAC  336


 Score = 16.5 bits (31),  Expect = 1.8
 Identities = 8/19 (42%), Positives = 11/19 (58%), Gaps = 0/19 (0%)

Query  440  LGIFIGLGIGLPCFNLFYL  458
            L + +GLG  L C +  YL
Sbjct  231  LHLAMGLGACLLCASGLYL  249


 Score = 14.6 bits (26),  Expect = 7.3
 Identities = 5/12 (42%), Positives = 8/12 (67%), Gaps = 0/12 (0%)

Query  141  IVCLAAFIMLIA  152
            + CLAA +  +A
Sbjct  334  LACLAAAVAHLA  345



Lambda      K        H        a         alpha
   0.329    0.141    0.443    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 176168


  Database: df46307c8fd20474c5ed7d3aff6cfe85.SwissProt.fasta
    Posted date:  Sep 24, 2020  3:53 AM
  Number of letters in database: 394
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40