ACIAD2290 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: dc7828d8e4859cd52f6e2315108e510e.TrEMBL.fasta
           24 sequences; 12,270 total letters



Query= ACIAD2290

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FA37 Cytochrome d terminal oxidase, polypeptide subunit I [Ac...  1049    0.0   
  N9D9K3 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter ...   975    0.0   
  N9S2I9 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter ...   975    0.0   
  A0A009YTX4 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobac...   975    0.0   
  K9B5T6 Cytochrome D ubiquinol oxidase subunit I [Acinetobacter ...   974    0.0   
  A0A022IVY1 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobac...   974    0.0   
  A0A009LIT4 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobac...   974    0.0   
  N9PU88 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter ...   974    0.0   
  N9MBF4 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter ...   974    0.0   
  N9QVN5 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter ...   973    0.0   
  N9RPZ7 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter ...   973    0.0   
  R9B612 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter ...   973    0.0   
  N8UVQ7 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter ...   972    0.0   
  N9EC89 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter ...   972    0.0   
  Q2ACC7 Cytochrome d ubiquinol oxidase subunit I [Shewanella vio...   781    0.0   
  O05191 Subunit I of cytochrome bd [Klebsiella pneumoniae]            746    0.0   
  D2CFB8 Cytochrome b [Allochromatium vinosum]                         735    0.0   
  O67973 Cytochrome d oxidase subunit I [Salmonella typhimurium]       727    0.0   
  C9DT02 Cytochrome bd ubiquinol oxidase subunit I [Agrobacterium...   430    4e-150
  B1PW07 Cytochrome d ubiquinol oxidase subunit I [Campylobacter ...   419    2e-143
  B1PW00 Cyanide-insensitive cytochrome oxidase CioAB, subunit I ...   417    1e-142
  B1PW13 Cytochrome bd oxidase subunit I [Campylobacter coli]          417    1e-142
  Q7X3N1 Cytochrome BD ubiquinol oxidase subunit I [Leifsonia xyl...   321    4e-106
  Q2QFA8 Cytochrome bd quinol oxidase subunit I [Desulfovibrio gi...   297    3e-97 


> Q6FA37 Cytochrome d terminal oxidase, polypeptide subunit I [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=529

 Score = 1049 bits (2712),  Expect = 0.0
 Identities = 528/529 (99%), Positives = 529/529 (100%), Gaps = 0/529 (0%)

Query  1    LMISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGK  60
            +MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGK
Sbjct  1    MMISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGK  60

Query  61   LFGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFG  120
            LFGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFG
Sbjct  61   LFGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFG  120

Query  121  WDRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFN  180
            WDRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFN
Sbjct  121  WDRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFN  180

Query  181  PVAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILL  240
            PVAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILL
Sbjct  181  PVAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILL  240

Query  241  GDESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIAT  300
            GDESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIAT
Sbjct  241  GDESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIAT  300

Query  301  RSTTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLL  360
            RSTTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLL
Sbjct  301  RSTTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLL  360

Query  361  KKYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAE  420
            KKYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAE
Sbjct  361  KKYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAE  420

Query  421  DKPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAA  480
            DKPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAA
Sbjct  421  DKPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAA  480

Query  481  LAAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            LAAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS
Sbjct  481  LAAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529


> N9D9K3 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
ursingii ANC 3649]
Length=528

 Score =  975 bits (2520),  Expect = 0.0
 Identities = 487/528 (92%), Positives = 506/528 (96%), Gaps = 0/528 (0%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHF+FVPLTLGLAF+LAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFIFVPLTLGLAFLLAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            +RLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNY+TMRMEL DF ALIFNP
Sbjct  121  NRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYETMRMELTDFAALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQKAKLAAIESEWET+PAPASFTLFG+PNQQEMRTDYAIKIPYALGLIATR
Sbjct  241  DESGYELGDVQKAKLAAIESEWETQPAPASFTLFGIPNQQEMRTDYAIKIPYALGLIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  QVTGI DLMK+HE RIRNGMVAYSELEKLRAGD+S  LL SF++NQKDLGYGLLLK
Sbjct  301  STDQQVTGITDLMKEHELRIRNGMVAYSELEKLRAGDKSPDLLNSFKENQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KY+ NV DATEA+IQSAVKDSIPNV ALFF+FRIMVA GFLMLLLFILA WSVAKRNAED
Sbjct  361  KYTENVTDATEANIQSAVKDSIPNVPALFFTFRIMVACGFLMLLLFILAAWSVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLS SSLS+GDVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSASSLSTGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEKQE  + +A E QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKQENSNLVAEEAQS  528


> N9S2I9 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
ursingii NIPH 706]
Length=528

 Score =  975 bits (2520),  Expect = 0.0
 Identities = 487/528 (92%), Positives = 506/528 (96%), Gaps = 0/528 (0%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHF+FVPLTLGLAF+LAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFIFVPLTLGLAFLLAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            +RLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNY+TMRMEL DF ALIFNP
Sbjct  121  NRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYETMRMELTDFAALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQKAKLAAIESEWET+PAPASFTLFG+PNQQEMRTDYAIKIPYALGLIATR
Sbjct  241  DESGYELGDVQKAKLAAIESEWETQPAPASFTLFGIPNQQEMRTDYAIKIPYALGLIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  QVTGI DLMK+HE RIRNGMVAYSELEKLRAGD+S  LL SF++NQKDLGYGLLLK
Sbjct  301  STDQQVTGITDLMKEHELRIRNGMVAYSELEKLRAGDKSPDLLNSFKENQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KY+ NV DATEA+IQSAVKDSIPNV ALFF+FRIMVA GFLMLLLFILA WSVAKRNAED
Sbjct  361  KYTENVTDATEANIQSAVKDSIPNVPALFFTFRIMVACGFLMLLLFILAAWSVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLS SSLS+GDVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSASSLSTGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEKQE  + +A E QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKQENSNLVAEEAQS  528


> A0A009YTX4 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
sp. 479375]
Length=528

 Score =  975 bits (2520),  Expect = 0.0
 Identities = 487/528 (92%), Positives = 506/528 (96%), Gaps = 0/528 (0%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHF+FVPLTLGLAF+LAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFIFVPLTLGLAFLLAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            +RLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNY+TMRMEL DF ALIFNP
Sbjct  121  NRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYETMRMELTDFAALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQKAKLAAIESEWET+PAPASFTLFG+PNQQEMRTDYAIKIPYALGLIATR
Sbjct  241  DESGYELGDVQKAKLAAIESEWETQPAPASFTLFGIPNQQEMRTDYAIKIPYALGLIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  QVTGI DLMK+HE RIRNGMVAYSELEKLRAGD+S  LL SF++NQKDLGYGLLLK
Sbjct  301  STDQQVTGITDLMKEHELRIRNGMVAYSELEKLRAGDKSPDLLNSFKENQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KY+ NV DATEA+IQSAVKDSIPNV ALFF+FRIMVA GFLMLLLFILA WSVAKRNAED
Sbjct  361  KYTENVTDATEANIQSAVKDSIPNVPALFFTFRIMVACGFLMLLLFILAAWSVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLS SSLS+GDVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSASSLSTGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEKQE  + +A E QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKQENSNLVAEEAQS  528


> K9B5T6 Cytochrome D ubiquinol oxidase subunit I [Acinetobacter 
sp. WC-323]
Length=525

 Score =  974 bits (2518),  Expect = 0.0
 Identities = 483/528 (91%), Positives = 505/528 (96%), Gaps = 3/528 (1%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DRLSKVQHLGVTWLVAIGSNMSALWIL+ANGWMQNPVGAAFNY+TMRMEL DFGALIFNP
Sbjct  121  DRLSKVQHLGVTWLVAIGSNMSALWILIANGWMQNPVGAAFNYETMRMELVDFGALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQK KLAAIE+EW TEPAPA+FTLFG+PNQQEMRTDYAIKIPY +G+IATR
Sbjct  241  DESGYELGDVQKTKLAAIEAEWHTEPAPAAFTLFGLPNQQEMRTDYAIKIPYVMGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  +VTG++DLMK+HE RIRNGMVAYSELEKLRAGDRS  LLASFEKNQKDLGYGLLLK
Sbjct  301  STDKEVTGLRDLMKEHEVRIRNGMVAYSELEKLRAGDRSPDLLASFEKNQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KYSPNVVDATE HIQ+A KD+IPNV ALFFSFR MVA+GFLMLLLF+LATWSVAKRNAED
Sbjct  361  KYSPNVVDATEEHIQAATKDTIPNVAALFFSFRAMVASGFLMLLLFLLATWSVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPW+IGE+LPTHLS SS+S+GDVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWSIGEILPTHLSASSISTGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEK E     AGE QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKLEAK---AGEAQS  525


> A0A022IVY1 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
sp. 1000160]
Length=525

 Score =  974 bits (2518),  Expect = 0.0
 Identities = 483/528 (91%), Positives = 505/528 (96%), Gaps = 3/528 (1%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DRLSKVQHLGVTWLVAIGSNMSALWIL+ANGWMQNPVGAAFNY+TMRMEL DFGALIFNP
Sbjct  121  DRLSKVQHLGVTWLVAIGSNMSALWILIANGWMQNPVGAAFNYETMRMELVDFGALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQK KLAAIE+EW TEPAPA+FTLFG+PNQQEMRTDYAIKIPY +G+IATR
Sbjct  241  DESGYELGDVQKTKLAAIEAEWHTEPAPAAFTLFGLPNQQEMRTDYAIKIPYVMGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  +VTG++DLMK+HE RIRNGMVAYSELEKLRAGDRS  LLASFEKNQKDLGYGLLLK
Sbjct  301  STDKEVTGLRDLMKEHEVRIRNGMVAYSELEKLRAGDRSPDLLASFEKNQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KYSPNVVDATE HIQ+A KD+IPNV ALFFSFR MVA+GFLMLLLF+LATWSVAKRNAED
Sbjct  361  KYSPNVVDATEEHIQAATKDTIPNVAALFFSFRAMVASGFLMLLLFLLATWSVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPW+IGE+LPTHLS SS+S+GDVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWSIGEILPTHLSASSISTGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEK E     AGE QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKLEAK---AGEAQS  525


> A0A009LIT4 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
baumannii 146457]
Length=525

 Score =  974 bits (2518),  Expect = 0.0
 Identities = 483/528 (91%), Positives = 505/528 (96%), Gaps = 3/528 (1%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DRLSKVQHLGVTWLVAIGSNMSALWIL+ANGWMQNPVGAAFNY+TMRMEL DFGALIFNP
Sbjct  121  DRLSKVQHLGVTWLVAIGSNMSALWILIANGWMQNPVGAAFNYETMRMELVDFGALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQK KLAAIE+EW TEPAPA+FTLFG+PNQQEMRTDYAIKIPY +G+IATR
Sbjct  241  DESGYELGDVQKTKLAAIEAEWHTEPAPAAFTLFGLPNQQEMRTDYAIKIPYVMGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  +VTG++DLMK+HE RIRNGMVAYSELEKLRAGDRS  LLASFEKNQKDLGYGLLLK
Sbjct  301  STDKEVTGLRDLMKEHEVRIRNGMVAYSELEKLRAGDRSPDLLASFEKNQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KYSPNVVDATE HIQ+A KD+IPNV ALFFSFR MVA+GFLMLLLF+LATWSVAKRNAED
Sbjct  361  KYSPNVVDATEEHIQAATKDTIPNVAALFFSFRAMVASGFLMLLLFLLATWSVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPW+IGE+LPTHLS SS+S+GDVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWSIGEILPTHLSASSISTGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEK E     AGE QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKLEAK---AGEAQS  525


> N9PU88 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
sp. NIPH 3623]
Length=525

 Score =  974 bits (2518),  Expect = 0.0
 Identities = 483/528 (91%), Positives = 505/528 (96%), Gaps = 3/528 (1%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DRLSKVQHLGVTWLVAIGSNMSALWIL+ANGWMQNPVGAAFNY+TMRMEL DFGALIFNP
Sbjct  121  DRLSKVQHLGVTWLVAIGSNMSALWILIANGWMQNPVGAAFNYETMRMELVDFGALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQK KLAAIE+EW TEPAPA+FTLFG+PNQQEMRTDYAIKIPY +G+IATR
Sbjct  241  DESGYELGDVQKTKLAAIEAEWHTEPAPAAFTLFGLPNQQEMRTDYAIKIPYVMGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  +VTG++DLMK+HE RIRNGMVAYSELEKLRAGDRS  LLASFEKNQKDLGYGLLLK
Sbjct  301  STDKEVTGLRDLMKEHEVRIRNGMVAYSELEKLRAGDRSPDLLASFEKNQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KYSPNVVDATE HIQ+A KD+IPNV ALFFSFR MVA+GFLMLLLF+LATWSVAKRNAED
Sbjct  361  KYSPNVVDATEEHIQAATKDTIPNVAALFFSFRAMVASGFLMLLLFLLATWSVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPW+IGE+LPTHLS SS+S+GDVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWSIGEILPTHLSASSISTGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEK E     AGE QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKLEAK---AGEAQS  525


> N9MBF4 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
sp. NIPH 1847]
Length=525

 Score =  974 bits (2518),  Expect = 0.0
 Identities = 483/528 (91%), Positives = 505/528 (96%), Gaps = 3/528 (1%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DRLSKVQHLGVTWLVAIGSNMSALWIL+ANGWMQNPVGAAFNY+TMRMEL DFGALIFNP
Sbjct  121  DRLSKVQHLGVTWLVAIGSNMSALWILIANGWMQNPVGAAFNYETMRMELVDFGALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQK KLAAIE+EW TEPAPA+FTLFG+PNQQEMRTDYAIKIPY +G+IATR
Sbjct  241  DESGYELGDVQKTKLAAIEAEWHTEPAPAAFTLFGLPNQQEMRTDYAIKIPYVMGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  +VTG++DLMK+HE RIRNGMVAYSELEKLRAGDRS  LLASFEKNQKDLGYGLLLK
Sbjct  301  STDKEVTGLRDLMKEHEVRIRNGMVAYSELEKLRAGDRSPDLLASFEKNQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KYSPNVVDATE HIQ+A KD+IPNV ALFFSFR MVA+GFLMLLLF+LATWSVAKRNAED
Sbjct  361  KYSPNVVDATEEHIQAATKDTIPNVAALFFSFRAMVASGFLMLLLFLLATWSVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPW+IGE+LPTHLS SS+S+GDVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWSIGEILPTHLSASSISTGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEK E     AGE QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKLEAK---AGEAQS  525


> N9QVN5 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
colistiniresistens]
Length=525

 Score =  973 bits (2516),  Expect = 0.0
 Identities = 483/528 (91%), Positives = 505/528 (96%), Gaps = 3/528 (1%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DRLSKVQHLGVTWLVAIGSNMSALWIL+ANGWMQNPVGAAFNY+TMRMEL DFGALIFNP
Sbjct  121  DRLSKVQHLGVTWLVAIGSNMSALWILIANGWMQNPVGAAFNYETMRMELVDFGALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQK KLAAIE+EW TEPAPA+FTLFG+PNQQEMRTDYAIKIPY +G+IATR
Sbjct  241  DESGYELGDVQKTKLAAIEAEWHTEPAPAAFTLFGLPNQQEMRTDYAIKIPYVMGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  +VTG++DLMK+HE RIRNGMVAYSELEKLRAGDRS  LLASFEKNQKDLGYGLLLK
Sbjct  301  STDKEVTGLRDLMKEHEVRIRNGMVAYSELEKLRAGDRSPELLASFEKNQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KYSPNVVDATEAHIQ+A KD+IPNV ALFFSFR MVA+GFLMLLLF+LATWSVAKRNAED
Sbjct  361  KYSPNVVDATEAHIQAATKDTIPNVAALFFSFRAMVASGFLMLLLFLLATWSVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFAL ALPLPWIAAQTGWYVAEGGRQPW+IGE+LPTHLS SS+S+GDVWGSI AL
Sbjct  421  KPWLLKFALLALPLPWIAAQTGWYVAEGGRQPWSIGEILPTHLSASSVSTGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEK E     AGE QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKLEAK---AGEAQS  525


> N9RPZ7 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
sp. ANC 3880]
Length=525

 Score =  973 bits (2515),  Expect = 0.0
 Identities = 482/528 (91%), Positives = 505/528 (96%), Gaps = 3/528 (1%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DRLSKVQHLGVTWLVAIGSNMSALWIL+ANGWMQNPVGAAFNY+TMRMEL DFGALIFNP
Sbjct  121  DRLSKVQHLGVTWLVAIGSNMSALWILIANGWMQNPVGAAFNYETMRMELVDFGALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQK KLAAIE+EW TEPAPA+FTLFG+PNQQEMRTDYAIKIPY +G+IATR
Sbjct  241  DESGYELGDVQKTKLAAIEAEWHTEPAPAAFTLFGLPNQQEMRTDYAIKIPYVMGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  +VTG++DLMK+HE RIRNGMVAYSELEKLRAGDRS  LLASFEKNQKDLGYGLLLK
Sbjct  301  STDKEVTGLRDLMKEHEVRIRNGMVAYSELEKLRAGDRSPDLLASFEKNQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KYSPNVVDATEAHIQ+A KD+IPNV ALFFSFR MVA+GFLMLLLF+LATW+VAKRNAED
Sbjct  361  KYSPNVVDATEAHIQAATKDTIPNVAALFFSFRAMVASGFLMLLLFLLATWAVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPW+IGE+LPTHLS SS+S+GDVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWSIGEILPTHLSASSVSAGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEK E      GE QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKLEAK---TGEAQS  525


> R9B612 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
sp. CIP 110321]
Length=525

 Score =  973 bits (2515),  Expect = 0.0
 Identities = 482/528 (91%), Positives = 505/528 (96%), Gaps = 3/528 (1%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DRLSKVQHLGVTWLVAIGSNMSALWIL+ANGWMQNPVGAAFNY+TMRMEL DFGALIFNP
Sbjct  121  DRLSKVQHLGVTWLVAIGSNMSALWILIANGWMQNPVGAAFNYETMRMELVDFGALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQK KLAAIE+EW TEPAPA+FTLFG+PNQQEMRTDYAIKIPY +G+IATR
Sbjct  241  DESGYELGDVQKTKLAAIEAEWHTEPAPAAFTLFGLPNQQEMRTDYAIKIPYVMGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  +VTG++DLMK+HE RIRNGMVAYSELEKLRAGDRS  LLASFEKNQKDLGYGLLLK
Sbjct  301  STDKEVTGLRDLMKEHEVRIRNGMVAYSELEKLRAGDRSPDLLASFEKNQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KYSPNVVDATEAHIQ+A KD+IPNV ALFFSFR MVA+GFLMLLLF+LATW+VAKRNAED
Sbjct  361  KYSPNVVDATEAHIQAATKDTIPNVAALFFSFRAMVASGFLMLLLFLLATWAVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPW+IGE+LPTHLS SS+S+GDVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWSIGEILPTHLSASSVSAGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEK E      GE QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKLEAK---TGEAQS  525


> N8UVQ7 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
sp. NIPH 758]
Length=525

 Score =  972 bits (2514),  Expect = 0.0
 Identities = 482/528 (91%), Positives = 505/528 (96%), Gaps = 3/528 (1%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DRLSKVQHLGVTWLVAIGSNMSALWIL+ANGWMQNPVGAAFNY+TMRMEL DFGALIFNP
Sbjct  121  DRLSKVQHLGVTWLVAIGSNMSALWILIANGWMQNPVGAAFNYETMRMELVDFGALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQK KLAAIE+EW TEPAPA+FTLFG+PNQQEMRTDYAIKIPY +G+IATR
Sbjct  241  DESGYELGDVQKTKLAAIEAEWHTEPAPAAFTLFGLPNQQEMRTDYAIKIPYVMGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  +VTG++DLMK+HE RIRNGMVAYS+LEKLRAGDRS  LLASFEKNQKDLGYGLLLK
Sbjct  301  STDKEVTGLRDLMKEHEVRIRNGMVAYSDLEKLRAGDRSPDLLASFEKNQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KYSPNVVDATE HIQ+A KD+IPNV ALFFSFR MVA+GFLMLLLF+LATWSVAKRNAED
Sbjct  361  KYSPNVVDATEEHIQAATKDTIPNVAALFFSFRAMVASGFLMLLLFLLATWSVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPW+IGE+LPTHLS SS+S+GDVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWSIGEILPTHLSASSVSTGDVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEK E     AGE QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKLEAK---AGEAQS  525


> N9EC89 Cytochrome d ubiquinol oxidase subunit 1 [Acinetobacter 
beijerinckii CIP 110307]
Length=525

 Score =  972 bits (2514),  Expect = 0.0
 Identities = 483/528 (91%), Positives = 504/528 (95%), Gaps = 3/528 (1%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL
Sbjct  1    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DRLSKVQHLGVTWLVAIGSNMSALWIL+ANGWMQNPVGAAFNY+TMRMEL DFGALIFNP
Sbjct  121  DRLSKVQHLGVTWLVAIGSNMSALWILIANGWMQNPVGAAFNYETMRMELVDFGALIFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTVSAGYVTGAIFVLAISS+YLLKKRDLPFARRSFAIAAIFG+AS LSVILLG
Sbjct  181  VAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYELGDVQK KLAAIE+EW TEPAPA+FTLFG+PNQ+EMRTDYAIKIPY +G+IATR
Sbjct  241  DESGYELGDVQKTKLAAIEAEWHTEPAPAAFTLFGLPNQKEMRTDYAIKIPYVMGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            ST  QVTGI+DLMK+HE RIRNGMVAYSELEKLRAGDRS  LLASFEKNQKDLGYGLLLK
Sbjct  301  STDTQVTGIRDLMKEHEVRIRNGMVAYSELEKLRAGDRSPELLASFEKNQKDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KYSPNVVDATEAHIQ+A KD+IPNV ALFFSFR MVA+GFLMLLLF+LATW+VAKRNAED
Sbjct  361  KYSPNVVDATEAHIQAATKDTIPNVAALFFSFRAMVASGFLMLLLFLLATWAVAKRNAED  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPW+IGE+LPTHLS SS+SS DVWGSI AL
Sbjct  421  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWSIGEILPTHLSASSISSADVWGSIIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAGEVQS  529
            AAFYTVLL+IEMYLMIKFARLGPSSLHTGKYHFEK E      GE QS
Sbjct  481  AAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKLEAK---TGEAQS  525


> Q2ACC7 Cytochrome d ubiquinol oxidase subunit I [Shewanella violacea]
Length=518

 Score =  781 bits (2017),  Expect = 0.0
 Identities = 375/514 (73%), Positives = 441/514 (86%), Gaps = 0/514 (0%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MI E VV+LSRFQFAMTAMYHFLFVPLTLGLAF+LAIME+ YV++GK+IYKDMTKFWGKL
Sbjct  1    MILEEVVELSRFQFAMTAMYHFLFVPLTLGLAFLLAIMESLYVMTGKQIYKDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGL MEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLEST +G+FFFGW
Sbjct  61   FGINFALGVTTGLAMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTLVGMFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DR SK QHL VTWLVA GSNMSALWIL+ANGWMQ+PVG+ FNY+TMRME+  +G ++FNP
Sbjct  121  DRFSKRQHLAVTWLVAFGSNMSALWILIANGWMQHPVGSVFNYETMRMEMTSWGDVLFNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTV++GYV GA+FVLAISS+Y+LKKRDLPFARRSFAIAA FG+AS++SVI+LG
Sbjct  181  VAQVKFVHTVASGYVAGAMFVLAISSYYILKKRDLPFARRSFAIAASFGLASIISVIVLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGY++G+VQK KLAAIE+EW TEPAPASFT  G PNQ+ M TDYAIKIP+A+G+IATR
Sbjct  241  DESGYKVGEVQKVKLAAIEAEWHTEPAPASFTAIGFPNQETMETDYAIKIPFAMGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            S   QVTGI DL+  HE RIRNG+ AY+ L +LR G+ +  L A+FE+ + DLGYG LLK
Sbjct  301  SLDEQVTGIHDLIADHEIRIRNGIKAYAMLTELRHGNETPELRAAFEEAKVDLGYGFLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            +Y+  VVDATE  I +A KDSIPNV  +F++FRIMV +G +MLL+F  A W   +   E+
Sbjct  361  RYTDKVVDATEEQIVAAAKDSIPNVAPMFWTFRIMVGSGMIMLLVFAAAFWQSTRHRIEE  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPW+LK AL++LPLPWIA + GW+V+E GRQPWTI EVLPT +S SS+S GD+W SI ++
Sbjct  421  KPWVLKAALYSLPLPWIAIECGWFVSEYGRQPWTISEVLPTFMSASSVSVGDLWFSIISI  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFE  515
              FYTVLLVIE YLMIKFAR+GPSSL TG+YHFE
Sbjct  481  LTFYTVLLVIEAYLMIKFARMGPSSLKTGRYHFE  514


> O05191 Subunit I of cytochrome bd [Klebsiella pneumoniae]
Length=521

 Score =  746 bits (1926),  Expect = 0.0
 Identities = 360/510 (71%), Positives = 430/510 (84%), Gaps = 1/510 (0%)

Query  7    VVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINF  66
            +V+LSR QFA+TAMYHFLFVPLTLG+AF+LAIMET YV+SGK+IYKDMTKFWGKLFGINF
Sbjct  4    IVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGKQIYKDMTKFWGKLFGINF  63

Query  67   ALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSK  126
            ALGV TGLTMEFQFGTNW+YYSHYVGDIFGAPLAIEGLMAFFLESTF+GLFFFGWDRL K
Sbjct  64   ALGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAFFLESTFVGLFFFGWDRLGK  123

Query  127  VQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQVK  186
            VQH+ VTW VA+GSN+SALWILVANGWMQNP+ + FN++TMRME+  F  L+ NPVAQVK
Sbjct  124  VQHMAVTWPVALGSNLSALWILVANGWMQNPIASDFNFETMRMEMVSFSELVLNPVAQVK  183

Query  187  FVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESGY  246
            FVHTV++GYVTGA+F+LAISS+Y+LK RD  FA+RSFAIAA FGMA++LSVI+LGDESGY
Sbjct  184  FVHTVASGYVTGAMFILAISSWYMLKGRDFAFAKRSFAIAASFGMAAILSVIVLGDESGY  243

Query  247  ELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATRSTTGQ  306
            E+GDVQK KLAAIE+EWET+PAPA+FTLFG+P+Q+  RT +AI+IP+ALG+IATRS   Q
Sbjct  244  EMGDVQKTKLAAIEAEWETQPAPAAFTLFGIPDQRRRRT-FAIQIPFALGIIATRSVDKQ  302

Query  307  VTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLKKYSPN  366
            VTG+K LM QHE RIRNGM AY+ LE+LRAG    ++   F   +KDLGYGLLLK+Y+ N
Sbjct  303  VTGLKALMVQHEERIRNGMKAYALLEQLRAGSTDQAVRDRFNDVKKDLGYGLLLKRYTDN  362

Query  367  VVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAEDKPWLL  426
            V+DATE  I  A KDSIP V  L+F+FRIMVA G LMLL+  L+ WSV +    +K WLL
Sbjct  363  VLDATEEQIALAAKDSIPAVAPLYFAFRIMVACGVLMLLIIALSFWSVIRNRIGEKKWLL  422

Query  427  KFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAALAAFYT  486
              A + LPLPWIA ++GW+VAE GRQPW IGEVLPT ++ SSL++GD+  S+  +   YT
Sbjct  423  AAAFYGLPLPWIAVESGWFVAEYGRQPWAIGEVLPTAVANSSLTAGDLIFSMVLICGLYT  482

Query  487  VLLVIEMYLMIKFARLGPSSLHTGKYHFEK  516
            + LV E++LM KFAR GPSSL TG+YHFE+
Sbjct  483  LFLVAELFLMFKFARKGPSSLKTGRYHFEQ  512


> D2CFB8 Cytochrome b [Allochromatium vinosum]
Length=534

 Score =  735 bits (1898),  Expect = 0.0
 Identities = 352/519 (68%), Positives = 435/519 (84%), Gaps = 0/519 (0%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            M+  ++V+LSR+QFA+TAMYHFLFVPLTLGL++IL IME+ YV++G+EIY+DMTKFWGKL
Sbjct  1    MLDSTMVELSRWQFAITAMYHFLFVPLTLGLSWILVIMESVYVMTGREIYRDMTKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTGLTMEFQFGTNWAYYSHYVGD+FGAPLAIEGLMAFFLESTFIGLFF GW
Sbjct  61   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDVFGAPLAIEGLMAFFLESTFIGLFFLGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            +RLSK QHL VT+L A+GSN+SALWILVANGWMQNPVG+ F+Y+TMRME+  F  L+ NP
Sbjct  121  ERLSKRQHLTVTFLTALGSNLSALWILVANGWMQNPVGSEFSYETMRMEMTSFTELLLNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTV+AGYVT ++FVL IS++Y+LK RDL FA+RSF++A  FG+AS+LSVILLG
Sbjct  181  VAQVKFVHTVAAGYVTASMFVLGISAWYMLKGRDLAFAKRSFSVAVGFGLASILSVILLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYE+GDVQK KLAAIE+EW TEPAPA+FT++G P+ ++  T  A+K+P+ LGLIATR
Sbjct  241  DESGYEVGDVQKVKLAAIEAEWHTEPAPAAFTIYGNPSNEDEETHNAVKVPWLLGLIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            S   +V G+KDLM++HE RIR+GM+AY  LE+LR G+ +    A FE+++KDLG+GLLLK
Sbjct  301  SLDTEVAGLKDLMREHEVRIRSGMIAYQYLERLRGGEDTPGNRAVFEEHKKDLGFGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            +Y+ N  +ATE  IQ AVKDSIP V  LF++FRIMV AG  ML+L +L  +  AKR  E+
Sbjct  361  RYTENPAEATEEQIQLAVKDSIPEVAPLFWTFRIMVGAGVWMLVLLVLGFYFNAKRVIEE  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            K WLL+  L+++P PWIAA+TGW+VAE GRQPW IGEVLPT ++ SSL++ D+  S++  
Sbjct  421  KRWLLRLFLYSIPAPWIAAETGWFVAEFGRQPWAIGEVLPTSIAVSSLTANDILISLSGF  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETH  520
              FYT L +IEMYLM KFARLGPSSLHTG+YH E+   H
Sbjct  481  ILFYTPLFIIEMYLMFKFARLGPSSLHTGRYHHERDTGH  519


> O67973 Cytochrome d oxidase subunit I [Salmonella typhimurium]
Length=522

 Score =  727 bits (1876),  Expect = 0.0
 Identities = 346/510 (68%), Positives = 418/510 (82%), Gaps = 0/510 (0%)

Query  7    VVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINF  66
            +V+LSR QFA+TAMYHFLFVPLTLG+AF+LAIMET YV+SGK+IYKDMTKFWGKLFGIN 
Sbjct  4    IVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGKQIYKDMTKFWGKLFGINL  63

Query  67   ALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSK  126
            ALGV TGLTMEFQFGTNW+YYSHY+GDI GAPL+I G+M+FF E+TF+GLFFFGWDRLSK
Sbjct  64   ALGVGTGLTMEFQFGTNWSYYSHYLGDISGAPLSIXGVMSFFXEATFVGLFFFGWDRLSK  123

Query  127  VQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQVK  186
            VQH+ VTWLVA+GSN+SALWILVANGWMQNP+    N++TMRME+  F  L+ NPVAQVK
Sbjct  124  VQHMCVTWLVALGSNLSALWILVANGWMQNPIAPDXNFETMRMEMVSFSELVLNPVAQVK  183

Query  187  FVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESGY  246
            FVHTV++GYVTGA+F+L IS++Y+LK RD  FA+RSFAIAA FGMA+VLSVI+LGDESGY
Sbjct  184  FVHTVASGYVTGAMFILGISAYYMLKGRDFAFAKRSFAIAASFGMAAVLSVIVLGDESGY  243

Query  247  ELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATRSTTGQ  306
            E+GDVQK KLAAIE+EWET+PAPASFTLFG+P+Q +     AI+IPYALG+IATRS    
Sbjct  244  EMGDVQKTKLAAIEAEWETQPAPASFTLFGIPDQDKQENHLAIQIPYALGIIATRSVDTP  303

Query  307  VTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLKKYSPN  366
            V G+KDLM QHE R RNGM  Y  LE+ RAG    ++   F + +KDLGYGLLLK+Y+PN
Sbjct  304  VIGLKDLMVQHEERFRNGMKDYELLEQXRAGSTDQAVRDQFNRMKKDLGYGLLLKRYTPN  363

Query  367  VVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAEDKPWLL  426
            V DATEA IQ A KDSIP V  L+ ++RI V  GFL+L +  L+ WSV +    +K WLL
Sbjct  364  VTDATEAQIQQATKDSIPRVAPLYXAYRIXVVCGFLLLAIIALSFWSVIRNRIGEKKWLL  423

Query  427  KFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAALAAFYT  486
            + AL+ +PLPWIA + GW+VAE GRQPW IGEVLPT +  SSL+ GD+  S++ +   YT
Sbjct  424  RAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLPTAVVNSSLTVGDLLFSMSLICGLYT  483

Query  487  VLLVIEMYLMIKFARLGPSSLHTGKYHFEK  516
            + LV E++LM KFARLGPSSL TG+YHFE+
Sbjct  484  LFLVAELFLMFKFARLGPSSLKTGRYHFEQ  513


> C9DT02 Cytochrome bd ubiquinol oxidase subunit I [Agrobacterium 
sp. ATCC 31749]
Length=339

 Score =  430 bits (1105),  Expect = 4e-150
 Identities = 210/339 (62%), Positives = 261/339 (77%), Gaps = 4/339 (1%)

Query  50   IYKDMTKFWGKLFGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFL  109
            I++ MTKFWG LFGINF LGV+TG+ MEFQFG NW+YYSHYVGDIFGAPLAIEG+MAFFL
Sbjct  1    IWRQMTKFWGTLFGINFVLGVSTGIVMEFQFGMNWSYYSHYVGDIFGAPLAIEGMMAFFL  60

Query  110  ESTFIGLFFFGWDRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRM  169
            E+TF+GLFFFGWD+LSK+ HL  TW VAIGSN SALWIL+ANGWMQNP G+AFN QTMRM
Sbjct  61   EATFVGLFFFGWDKLSKLGHLVATWCVAIGSNFSALWILIANGWMQNPTGSAFNPQTMRM  120

Query  170  ELADFGALIFNPVAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIF  229
            E+ DF A++FNPVAQ KFVHTVSAGYVT +IFVL +S++Y+LK R +  A+RS  +AA F
Sbjct  121  EVTDFFAVLFNPVAQAKFVHTVSAGYVTASIFVLGVSAWYVLKGRHVDLAKRSMTVAASF  180

Query  230  GMASVLSVILLGDESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAI  289
            G+AS LSV++LGDESGY   + QK KLA+IE+ WETEPAPA FT  G P+Q+   T +A+
Sbjct  181  GLASALSVVVLGDESGYLSTEHQKMKLASIEAMWETEPAPAPFTAIGFPDQEARETHFAV  240

Query  290  KIPYALGLIATRSTTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASL----LA  345
            KIP+ +GLI TRS   Q+ GI DL++Q + RIR+G+ AY  L ++RA  + A L      
Sbjct  241  KIPWVMGLIGTRSLDTQIPGINDLVEQAKTRIRDGIKAYDALMQIRATGKGAELPEEVRG  300

Query  346  SFEKNQKDLGYGLLLKKYSPNVVDATEAHIQSAVKDSIP  384
            +F +   +LGY LLLK+Y  +   A+E  I  A  D+IP
Sbjct  301  TFAEVGHELGYALLLKRYVDDPRQASEEQIAKAAADTIP  339


> B1PW07 Cytochrome d ubiquinol oxidase subunit I [Campylobacter 
coli]
Length=520

 Score =  419 bits (1078),  Expect = 2e-143
 Identities = 236/541 (44%), Positives = 319/541 (59%), Gaps = 48/541 (9%)

Query  6    SVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGIN  65
            S VD SR QFA+TA+YHFLFVPLTLGL+FI+AIMET YV +G E +K +TKFW  LF IN
Sbjct  5    SSVDWSRAQFALTALYHFLFVPLTLGLSFIIAIMETIYVKTGNERWKKITKFWLSLFAIN  64

Query  66   FALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLS  125
            FA+GV TG+ MEF+FGTNWA YS +VGDIFGAPLA+EG+MAFFLE+TF  + FFGWD++S
Sbjct  65   FAIGVATGIIMEFEFGTNWANYSWFVGDIFGAPLAVEGIMAFFLEATFFAVMFFGWDKVS  124

Query  126  KVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQV  185
            K  HL  TW VAIGSN+SA WILVANGWMQ PVG +FN  T R E+  F  +  +PVA  
Sbjct  125  KKFHLISTWCVAIGSNLSAFWILVANGWMQYPVGMSFNPDTARNEMQSFFEVALSPVAIS  184

Query  186  KFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESG  245
            KF+HT+ +GYV  A+FV+ IS++++LK R +  A++S  + A FG+   + +   GDES 
Sbjct  185  KFLHTIGSGYVISALFVMGISAWFMLKGRHIIEAKKSLVVGASFGLVCSIFLFFSGDESA  244

Query  246  YELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTD------YAIKIPYALGLIA  299
            Y +   Q  KLAA+E  ++ E   A    FG+ N ++   +      + I IPYAL ++ 
Sbjct  245  YRVTQTQPMKLAAMEGVYQGEHR-AGLVPFGILNPKKTIDNNESVFLFDITIPYALSILG  303

Query  300  TRSTTGQVTGIKDLMKQHEA--------RIRNGMVAYSELEKLRAGDRSASLLAS-----  346
             R     V GI+DL+  +E+        RI  G +A   L+  +    +   +A      
Sbjct  304  NRDPNSFVPGIEDLIYGNESKGIEPMQNRINRGKIAIQALKDYKLAKENNDTIAMANHKS  363

Query  347  -FEKNQKDLGYGLLLKKYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLL  405
              E + KD GYG L K                   D+IP V   F+SF IMVA G    L
Sbjct  364  ILETHFKDFGYGYLEKP-----------------SDTIPPVALTFYSFHIMVALGSFFFL  406

Query  406  LFILATWSVAKRNAEDKPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLS  465
            LFI+  +     + E    +L   L ++PL +IAA+ GW VAE GRQPW I ++LP H++
Sbjct  407  LFIVTLYLTMANDIEKFRKVLWVCLLSIPLGYIAAEAGWIVAEVGRQPWAIQDLLPVHIA  466

Query  466  TSSLSSGDVWGSIAALAAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAG  525
             + L   +V  S    A  +T LL+ E+ +M+   + G          F+    H PL G
Sbjct  467  ATQLGKVNVQISFWIFAVLFTALLIAEVKIMLTQIKKG----------FDAHAGHTPLMG  516

Query  526  E  526
            +
Sbjct  517  K  517


> B1PW00 Cyanide-insensitive cytochrome oxidase CioAB, subunit 
I [Campylobacter coli]
Length=520

 Score =  417 bits (1073),  Expect = 1e-142
 Identities = 234/518 (45%), Positives = 312/518 (60%), Gaps = 38/518 (7%)

Query  6    SVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGIN  65
            S VD SR QFA+TA+YHFLFVPLTLGL+FI+AIMET YV +G E +K +TKFW  LF IN
Sbjct  5    SSVDWSRAQFALTALYHFLFVPLTLGLSFIIAIMETIYVKTGNERWKKITKFWLSLFAIN  64

Query  66   FALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLS  125
            FA+GV TG+ MEF+FGTNWA YS +VGDIFGAPLA+EG+MAFFLE+TF  + FFGWD++S
Sbjct  65   FAIGVATGIIMEFEFGTNWANYSWFVGDIFGAPLAVEGIMAFFLEATFFAVMFFGWDKVS  124

Query  126  KVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQV  185
            K  HL  TW VAIGSN+SA WILVANGWMQ PVG  FN  T R E+  F  +  +PVA  
Sbjct  125  KKFHLISTWCVAIGSNLSAFWILVANGWMQYPVGMQFNPDTARNEMQSFFEVALSPVAIS  184

Query  186  KFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESG  245
            KF+HT+ +GYV  A+FV+ IS++++LK R +  A++S  + A FG+   + +   GDES 
Sbjct  185  KFLHTIGSGYVISALFVMGISAWFILKGRHIIEAKKSLVVGASFGLVCSVFLFFSGDESA  244

Query  246  YELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTD------YAIKIPYALGLIA  299
            Y +   Q  KLAA+E  ++ E   A    FG+ N ++   +      + I IPYAL ++ 
Sbjct  245  YRVTQTQPMKLAAMEGVYQGEHR-AGLVPFGILNPKKTIDNNESVFLFDITIPYALSILG  303

Query  300  TRSTTGQVTGIKDLMKQHE--------ARIRNGMVAYSELE--KLRAGDRSASLLAS---  346
             R     V GI+DL+  +E         RI  G +A   L+  KL   +   + +A+   
Sbjct  304  NRDPNSFVPGIEDLIHGNEDRGIEPMQERIDKGKIAIQALKDYKLAKDNNDTAAMATHKS  363

Query  347  -FEKNQKDLGYGLLLKKYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLL  405
              E N KD GYG L K                   D+IP V   F+SF IMVA G L  L
Sbjct  364  ILEANFKDFGYGYLEKP-----------------TDAIPPVALTFYSFHIMVALGSLFFL  406

Query  406  LFILATWSVAKRNAEDKPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLS  465
            LFI   +     + E    +L   L  +PL +IAA+ GW VAE GRQPW I +++P H++
Sbjct  407  LFIATLYLTMANDIEKFRKILWLCLLCIPLGYIAAEAGWIVAEVGRQPWAIQDLMPVHIA  466

Query  466  TSSLSSGDVWGSIAALAAFYTVLLVIEMYLMIKFARLG  503
             + L   +V  S    A  +T LL+ E+ +M+   + G
Sbjct  467  ATELGKVNVQISFWIFAVLFTALLIAEIKIMLTQIKKG  504


> B1PW13 Cytochrome bd oxidase subunit I [Campylobacter coli]
Length=520

 Score =  417 bits (1072),  Expect = 1e-142
 Identities = 236/541 (44%), Positives = 317/541 (59%), Gaps = 48/541 (9%)

Query  6    SVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGIN  65
            S VD SR QFA+TA+YHFLFVPLTLGL+FI+AIMET YV +G E +K +TKFW  LF IN
Sbjct  5    SSVDWSRAQFALTALYHFLFVPLTLGLSFIIAIMETIYVKTGNERWKKITKFWLSLFAIN  64

Query  66   FALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLS  125
            FA+GV TG+ MEF+FGTNWA YS +VGDIFGAPLA+EG+MAFFLE+TF  + FFGWD++S
Sbjct  65   FAIGVATGIIMEFEFGTNWANYSWFVGDIFGAPLAVEGIMAFFLEATFFAVMFFGWDKVS  124

Query  126  KVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQV  185
            K  HL  TW VAIGSN+SA WILVANGWMQ PVG  FN  T R E+  F  +  +PVA  
Sbjct  125  KKFHLISTWCVAIGSNLSAFWILVANGWMQYPVGMQFNPDTARNEMQSFFEVALSPVAIS  184

Query  186  KFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESG  245
            KF+HT+ +GYV  A+FV+ IS++++LK R +  A++S  + A FG+   + +   GDES 
Sbjct  185  KFLHTIGSGYVISALFVMGISAWFILKGRHIIEAKKSLVVGASFGLVCSVFLFFSGDESA  244

Query  246  YELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTD------YAIKIPYALGLIA  299
            Y +   Q  KLAA+E  ++ E   A    FG+ N ++   +      + I IPYAL ++ 
Sbjct  245  YRVTQTQPMKLAAMEGVYQGEHR-AGLVPFGILNPKKTIDNNESVFLFDITIPYALSILG  303

Query  300  TRSTTGQVTGIKDLMKQHE--------ARIRNGMVAYSELEKLRAGDRSASLLAS-----  346
             R     V GI+DL+  +E         RI  G +A   L+  +    +   +A      
Sbjct  304  NRDPNSFVPGIEDLIHGNEDRGIEPMQERIDKGKIAIQALKDYKLAKENNDTIAMANHKS  363

Query  347  -FEKNQKDLGYGLLLKKYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLL  405
              E + KD GYG L K                   D+IP V   F+SF IMVA G    L
Sbjct  364  ILETHFKDFGYGYLEKP-----------------SDTIPPVALTFYSFHIMVALGSFFFL  406

Query  406  LFILATWSVAKRNAEDKPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLS  465
            LFI+  +     + E    +L   L ++PL +IAA+ GW VAE GRQPW I ++LP H++
Sbjct  407  LFIVTLYLTMANDIEKFRKVLWVCLLSIPLGYIAAEAGWIVAEVGRQPWAIQDLLPVHIA  466

Query  466  TSSLSSGDVWGSIAALAAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLAG  525
             + L   +V  S    A  +T LL+ E+ +M+   + G          F+    H PL G
Sbjct  467  ATQLGKVNVQISFWIFAVLFTALLIAEVKIMLTQIKKG----------FDAHAGHTPLMG  516

Query  526  E  526
            +
Sbjct  517  K  517


> Q7X3N1 Cytochrome BD ubiquinol oxidase subunit I [Leifsonia xyli 
subsp. xyli]
Length=470

 Score =  321 bits (823),  Expect = 4e-106
 Identities = 185/517 (36%), Positives = 277/517 (54%), Gaps = 61/517 (12%)

Query  10   LSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINFALG  69
            LSR+QF +T +YHFLFVPLT+GL  ++A+ +T +  +GK  Y  +T F+GKLF INFA+G
Sbjct  10   LSRWQFGLTTIYHFLFVPLTIGLVTVVAVFQTAWYRTGKVHYLQLTHFFGKLFLINFAMG  69

Query  70   VTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSKVQH  129
            V TG+  EFQFG NW+ YS +VGDIFGAPLA+EGL+AFFLE+TFIGL+ FGWD+L K  H
Sbjct  70   VVTGIVQEFQFGMNWSDYSRFVGDIFGAPLALEGLLAFFLEATFIGLWIFGWDKLPKGLH  129

Query  130  LGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQVKFVH  189
            L   W+ A G+ +SA +I+ AN +MQNPVG   N    R EL D GA++ N VA   F H
Sbjct  130  LATVWVTAAGTILSAYFIIAANAFMQNPVGYHLNESRGRAELTDIGAVLTNKVALAAFPH  189

Query  190  TVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESGYELG  249
            T+   ++  A  ++++++++L + + L   R +        + + +S ++ GD+ G  + 
Sbjct  190  TIFGTFMVSAGLIISVAAWHLSRNQHLESMRPALKAGLWLMVGASISTVISGDQLGLAMV  249

Query  250  DVQKAKLAAIESEWETEP-APASFTLFGVPNQQEMRTDYAIKIPYALGLIATRSTTGQVT  308
              Q  K+AA E+ ++T   A ASF++F +     +   ++I++PY L  ++T +  G V 
Sbjct  250  QTQPMKMAAAEALYKTSTGADASFSIFTLGTPDGVHELFSIRVPYLLSFLSTHTLDGTVE  309

Query  309  GIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLKKYSPNVV  368
            GI DL  Q           Y++L                               Y P   
Sbjct  310  GIDDLQAQ-----------YAQL-------------------------------YGPG--  325

Query  369  DATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAEDKPWLLKF  428
                        D  P V   ++SFR M+  G L  L+ +   W   K       W  K 
Sbjct  326  ------------DYTPIVWITYWSFRWMIGLGMLHALVAVAGLWLTRKGRTPQHVWQWKI  373

Query  429  ALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSG-DVWGSIAALAAFYTV  487
            A++A+PL  +A   GW   E GRQPW +  ++ T    S+ ++G DV  S+ A  A Y  
Sbjct  374  AIWAMPLSLLAMVVGWVFTEMGRQPWIVFSLMKTADGVSTGTTGLDVLLSLLAFTAVYGA  433

Query  488  LLVIEMYLMIKFARLGPSSLHTGKYHFEKQETHHPLA  524
            L V+E  L+ + A+ GP+     + H + +  H P+A
Sbjct  434  LTVVEFTLIKRAAQKGPA---PAEDHLDDEGRHVPVA  467


> Q2QFA8 Cytochrome bd quinol oxidase subunit I [Desulfovibrio 
gigas]
Length=443

 Score =  297 bits (761),  Expect = 3e-97
 Identities = 151/308 (49%), Positives = 209/308 (68%), Gaps = 4/308 (1%)

Query  10   LSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINFALG  69
            LSR+QFA+ + +HFLFVPLTLGL+ ++A+MET YV +G E YK M KFWG+LF INFALG
Sbjct  6    LSRWQFAVASFFHFLFVPLTLGLSVLVAMMETKYVRTGDETYKRMAKFWGRLFLINFALG  65

Query  70   VTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSKVQH  129
            V TG+T+EFQFGTNWA YS +VGDIFG+ LA+E  +AFFLESTFI ++ FGWDRLSK  H
Sbjct  66   VVTGITLEFQFGTNWARYSSFVGDIFGSLLAVEATVAFFLESTFIAVWVFGWDRLSKKMH  125

Query  130  LGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQVKFVH  189
                W+VAI +N+SA+WIL+ANG+MQNPVG  +  +  R EL  F  ++ N     +F H
Sbjct  126  NAAIWIVAIATNLSAIWILLANGFMQNPVG--YVIRNGRAELDSFYEVVTNGFGWSQFFH  183

Query  190  TVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESGYELG  249
            TVS  ++    FV+ IS+++LL+  ++ F +RSF   A F +   + V + G   G ++ 
Sbjct  184  TVSGAWMLAGFFVMGISAWHLLRNNEMDFFKRSFKFGAAFAIIFSVLVAVQGHHHGNQVA  243

Query  250  DVQKAKLAAIESEWETEPAPASFTLFGVPNQ-QEMRTDYAIKIPYALGLIATRSTTGQVT  308
             +Q  K+AA+ES WETE  PA  +L  +P++  E      +KIPY L ++A      +V 
Sbjct  244  RLQPTKMAAMESLWETE-KPAGMSLLVIPDEANERNLVEFLKIPYVLSILAFNDPMAEVK  302

Query  309  GIKDLMKQ  316
            G+K+  K+
Sbjct  303  GLKEWPKE  310


 Score = 80.1 bits (196),  Expect = 6e-19
 Identities = 49/133 (37%), Positives = 75/133 (56%), Gaps = 3/133 (2%)

Query  380  KDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAEDKPWLLKFALFALPLPWIA  439
            K+  P V   F SFR MV  G L + L  +A W + +   E K  LL+  ++A+PLP++A
Sbjct  309  KEDRPPVTLTFLSFRAMVGLGTLFIALGAMA-W-LWRNKIETKRTLLRVLVYAIPLPYLA  366

Query  440  AQTGWYVAEGGRQPWTIGEVLPTHLSTS-SLSSGDVWGSIAALAAFYTVLLVIEMYLMIK  498
             + GW VAE GRQPW +  ++ T  + S  +S+  V  S+ A    YT+L +I+ +L+ K
Sbjct  367  LEFGWAVAEIGRQPWIVWGLMRTENAHSVGVSATQVAVSLGAFFVVYTLLGLIDFFLLRK  426

Query  499  FARLGPSSLHTGK  511
            +A  GP    T +
Sbjct  427  YAVKGPEKASTSE  439



Lambda      K        H        a         alpha
   0.325    0.138    0.419    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5156646


  Database: dc7828d8e4859cd52f6e2315108e510e.TrEMBL.fasta
    Posted date:  Sep 28, 2020  2:05 PM
  Number of letters in database: 12,270
  Number of sequences in database:  24



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40