ACIAD2290 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 2fa4416be63a222e9f1007c9b3546ffc.SwissProt.fasta
           8 sequences; 4,049 total letters



Query= ACIAD2290

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q09049 Cytochrome bd ubiquinol oxidase subunit 1 [Azotobacter v...   843    0.0   
  P0ABK0 Cytochrome bd-I ubiquinol oxidase subunit 1 [Escherichia...   761    0.0   
  P0ABK1 Cytochrome bd-I ubiquinol oxidase subunit 1 [Shigella fl...   761    0.0   
  P0ABJ9 Cytochrome bd-I ubiquinol oxidase subunit 1 [Escherichia...   761    0.0   
  P45021 Probable cytochrome oxidase subunit 1 [Haemophilus influ...   647    0.0   
  P26459 Cytochrome bd-II ubiquinol oxidase subunit 1 [Escherichi...   600    0.0   
  P94364 Cytochrome bd ubiquinol oxidase subunit 1 [Bacillus subt...   333    2e-111
  C0SP90 Putative cytochrome bd menaquinol oxidase subunit I [Bac...   122    2e-33 


> Q09049 Cytochrome bd ubiquinol oxidase subunit 1 [Azotobacter 
vinelandii]
Length=537

 Score =  843 bits (2179),  Expect = 0.0
 Identities = 402/519 (77%), Positives = 467/519 (90%), Gaps = 0/519 (0%)

Query  2    MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKL  61
            MISESVVDLSR QFAMTA+YHFLFVPLTLG+ F+LAIME+ YV++GK++YKDM KFWGKL
Sbjct  1    MISESVVDLSRLQFAMTALYHFLFVPLTLGMTFLLAIMESVYVMTGKQVYKDMVKFWGKL  60

Query  62   FGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGW  121
            FGINFALGVTTG+TMEFQFGTNWAYYSHYVGDIFGAPLAIEGL AFFLESTFIG+FFFGW
Sbjct  61   FGINFALGVTTGITMEFQFGTNWAYYSHYVGDIFGAPLAIEGLTAFFLESTFIGMFFFGW  120

Query  122  DRLSKVQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNP  181
            DRLSK+QHL VTWLVA+GSN+SALWILVANGWMQ+PVGA FN++TMRMEL DFGAL+ NP
Sbjct  121  DRLSKIQHLAVTWLVALGSNLSALWILVANGWMQHPVGAEFNFETMRMELVDFGALLLNP  180

Query  182  VAQVKFVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLG  241
            VAQVKFVHTV++GYVTGA+FVLAISS+YLLKKRDL FARRSFAIA+ FGMAS+LSVI+LG
Sbjct  181  VAQVKFVHTVASGYVTGAVFVLAISSYYLLKKRDLGFARRSFAIASAFGMASILSVIVLG  240

Query  242  DESGYELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATR  301
            DESGYE+G+VQKAKLAAIE+EWET PAPASFTL G PN++E RTD+A+KIP+ LG+IATR
Sbjct  241  DESGYEVGEVQKAKLAAIEAEWETHPAPASFTLIGFPNEEEQRTDFAVKIPWVLGIIATR  300

Query  302  STTGQVTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLK  361
            S   QV GIKDL+  HEARIRNGMV Y  LE+LRAG++S   +A+F + + DLGYGLLLK
Sbjct  301  SLDEQVIGIKDLIADHEARIRNGMVRYGLLEELRAGNKSPEKIAAFNEVKDDLGYGLLLK  360

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            KY+PNVVDA+E  I+ A KD+IP+V ++F+SFR MV AGF ML+LF+ A W+ A++N E 
Sbjct  361  KYTPNVVDASEEQIKQAAKDTIPSVASMFWSFRAMVGAGFAMLILFVCAFWASARKNEES  420

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
            KPWLLKFAL++LPLPWIA QTGW+VAE GRQPWTIG VLPTHLS SSLS+GD+WGS+ AL
Sbjct  421  KPWLLKFALYSLPLPWIATQTGWFVAEHGRQPWTIGGVLPTHLSASSLSTGDLWGSLIAL  480

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEKQETH  520
             AFYT+LLV+EMYLMI+FARLGPSSLHTG+YHFE+ E H
Sbjct  481  IAFYTLLLVVEMYLMIRFARLGPSSLHTGRYHFEQLEQH  519


> P0ABK0 Cytochrome bd-I ubiquinol oxidase subunit 1 [Escherichia 
coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)]
Length=522

 Score =  761 bits (1964),  Expect = 0.0
 Identities = 362/513 (71%), Positives = 433/513 (84%), Gaps = 0/513 (0%)

Query  7    VVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINF  66
            +V+LSR QFA+TAMYHFLFVPLTLG+AF+LAIMET YV+SGK+IYKDMTKFWGKLFGINF
Sbjct  4    IVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGKQIYKDMTKFWGKLFGINF  63

Query  67   ALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSK  126
            ALGV TGLTMEFQFGTNW+YYSHYVGDIFGAPLAIEGLMAFFLESTF+GLFFFGWDRL K
Sbjct  64   ALGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAFFLESTFVGLFFFGWDRLGK  123

Query  127  VQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQVK  186
            VQH+ VTWLVA+GSN+SALWILVANGWMQNP+ + FN++TMRME+  F  L+ NPVAQVK
Sbjct  124  VQHMCVTWLVALGSNLSALWILVANGWMQNPIASDFNFETMRMEMVSFSELVLNPVAQVK  183

Query  187  FVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESGY  246
            FVHTV++GYVTGA+F+L IS++Y+LK RD  FA+RSFAIAA FGMA+VLSVI+LGDESGY
Sbjct  184  FVHTVASGYVTGAMFILGISAWYMLKGRDFAFAKRSFAIAASFGMAAVLSVIVLGDESGY  243

Query  247  ELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATRSTTGQ  306
            E+GDVQK KLAAIE+EWET+PAPA+FTLFG+P+Q+E    +AI+IPYALG+IATRS    
Sbjct  244  EMGDVQKTKLAAIEAEWETQPAPAAFTLFGIPDQEEETNKFAIQIPYALGIIATRSVDTP  303

Query  307  VTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLKKYSPN  366
            V G+K+LM QHE RIRNGM AYS LE+LR+G    ++   F   +KDLGYGLLLK+Y+PN
Sbjct  304  VIGLKELMVQHEERIRNGMKAYSLLEQLRSGSTDQAVRDQFNSMKKDLGYGLLLKRYTPN  363

Query  367  VVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAEDKPWLL  426
            V DATEA IQ A KDSIP V  L+F+FRIMVA GFL+L +  L+ WSV +    +K WLL
Sbjct  364  VADATEAQIQQATKDSIPRVAPLYFAFRIMVACGFLLLAIIALSFWSVIRNRIGEKKWLL  423

Query  427  KFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAALAAFYT  486
            + AL+ +PLPWIA + GW+VAE GRQPW IGEVLPT ++ SSL++GD+  S+  +   YT
Sbjct  424  RAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLPTAVANSSLTAGDLIFSMVLICGLYT  483

Query  487  VLLVIEMYLMIKFARLGPSSLHTGKYHFEKQET  519
            + LV E++LM KFARLGPSSL TG+YHFE+  T
Sbjct  484  LFLVAELFLMFKFARLGPSSLKTGRYHFEQSST  516


> P0ABK1 Cytochrome bd-I ubiquinol oxidase subunit 1 [Shigella 
flexneri]
Length=522

 Score =  761 bits (1964),  Expect = 0.0
 Identities = 362/513 (71%), Positives = 433/513 (84%), Gaps = 0/513 (0%)

Query  7    VVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINF  66
            +V+LSR QFA+TAMYHFLFVPLTLG+AF+LAIMET YV+SGK+IYKDMTKFWGKLFGINF
Sbjct  4    IVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGKQIYKDMTKFWGKLFGINF  63

Query  67   ALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSK  126
            ALGV TGLTMEFQFGTNW+YYSHYVGDIFGAPLAIEGLMAFFLESTF+GLFFFGWDRL K
Sbjct  64   ALGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAFFLESTFVGLFFFGWDRLGK  123

Query  127  VQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQVK  186
            VQH+ VTWLVA+GSN+SALWILVANGWMQNP+ + FN++TMRME+  F  L+ NPVAQVK
Sbjct  124  VQHMCVTWLVALGSNLSALWILVANGWMQNPIASDFNFETMRMEMVSFSELVLNPVAQVK  183

Query  187  FVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESGY  246
            FVHTV++GYVTGA+F+L IS++Y+LK RD  FA+RSFAIAA FGMA+VLSVI+LGDESGY
Sbjct  184  FVHTVASGYVTGAMFILGISAWYMLKGRDFAFAKRSFAIAASFGMAAVLSVIVLGDESGY  243

Query  247  ELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATRSTTGQ  306
            E+GDVQK KLAAIE+EWET+PAPA+FTLFG+P+Q+E    +AI+IPYALG+IATRS    
Sbjct  244  EMGDVQKTKLAAIEAEWETQPAPAAFTLFGIPDQEEETNKFAIQIPYALGIIATRSVDTP  303

Query  307  VTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLKKYSPN  366
            V G+K+LM QHE RIRNGM AYS LE+LR+G    ++   F   +KDLGYGLLLK+Y+PN
Sbjct  304  VIGLKELMVQHEERIRNGMKAYSLLEQLRSGSTDQAVRDQFNSMKKDLGYGLLLKRYTPN  363

Query  367  VVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAEDKPWLL  426
            V DATEA IQ A KDSIP V  L+F+FRIMVA GFL+L +  L+ WSV +    +K WLL
Sbjct  364  VADATEAQIQQATKDSIPRVAPLYFAFRIMVACGFLLLAIIALSFWSVIRNRIGEKKWLL  423

Query  427  KFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAALAAFYT  486
            + AL+ +PLPWIA + GW+VAE GRQPW IGEVLPT ++ SSL++GD+  S+  +   YT
Sbjct  424  RAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLPTAVANSSLTAGDLIFSMVLICGLYT  483

Query  487  VLLVIEMYLMIKFARLGPSSLHTGKYHFEKQET  519
            + LV E++LM KFARLGPSSL TG+YHFE+  T
Sbjct  484  LFLVAELFLMFKFARLGPSSLKTGRYHFEQSST  516


> P0ABJ9 Cytochrome bd-I ubiquinol oxidase subunit 1 [Escherichia 
coli (strain K12)]
Length=522

 Score =  761 bits (1964),  Expect = 0.0
 Identities = 362/513 (71%), Positives = 433/513 (84%), Gaps = 0/513 (0%)

Query  7    VVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINF  66
            +V+LSR QFA+TAMYHFLFVPLTLG+AF+LAIMET YV+SGK+IYKDMTKFWGKLFGINF
Sbjct  4    IVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGKQIYKDMTKFWGKLFGINF  63

Query  67   ALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSK  126
            ALGV TGLTMEFQFGTNW+YYSHYVGDIFGAPLAIEGLMAFFLESTF+GLFFFGWDRL K
Sbjct  64   ALGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAFFLESTFVGLFFFGWDRLGK  123

Query  127  VQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQVK  186
            VQH+ VTWLVA+GSN+SALWILVANGWMQNP+ + FN++TMRME+  F  L+ NPVAQVK
Sbjct  124  VQHMCVTWLVALGSNLSALWILVANGWMQNPIASDFNFETMRMEMVSFSELVLNPVAQVK  183

Query  187  FVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESGY  246
            FVHTV++GYVTGA+F+L IS++Y+LK RD  FA+RSFAIAA FGMA+VLSVI+LGDESGY
Sbjct  184  FVHTVASGYVTGAMFILGISAWYMLKGRDFAFAKRSFAIAASFGMAAVLSVIVLGDESGY  243

Query  247  ELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATRSTTGQ  306
            E+GDVQK KLAAIE+EWET+PAPA+FTLFG+P+Q+E    +AI+IPYALG+IATRS    
Sbjct  244  EMGDVQKTKLAAIEAEWETQPAPAAFTLFGIPDQEEETNKFAIQIPYALGIIATRSVDTP  303

Query  307  VTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLKKYSPN  366
            V G+K+LM QHE RIRNGM AYS LE+LR+G    ++   F   +KDLGYGLLLK+Y+PN
Sbjct  304  VIGLKELMVQHEERIRNGMKAYSLLEQLRSGSTDQAVRDQFNSMKKDLGYGLLLKRYTPN  363

Query  367  VVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAEDKPWLL  426
            V DATEA IQ A KDSIP V  L+F+FRIMVA GFL+L +  L+ WSV +    +K WLL
Sbjct  364  VADATEAQIQQATKDSIPRVAPLYFAFRIMVACGFLLLAIIALSFWSVIRNRIGEKKWLL  423

Query  427  KFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAALAAFYT  486
            + AL+ +PLPWIA + GW+VAE GRQPW IGEVLPT ++ SSL++GD+  S+  +   YT
Sbjct  424  RAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLPTAVANSSLTAGDLIFSMVLICGLYT  483

Query  487  VLLVIEMYLMIKFARLGPSSLHTGKYHFEKQET  519
            + LV E++LM KFARLGPSSL TG+YHFE+  T
Sbjct  484  LFLVAELFLMFKFARLGPSSLKTGRYHFEQSST  516


> P45021 Probable cytochrome oxidase subunit 1 [Haemophilus influenzae 
(strain ATCC 51907 / DSM 11121 / KW20 / Rd)]
Length=521

 Score =  647 bits (1668),  Expect = 0.0
 Identities = 317/515 (62%), Positives = 397/515 (77%), Gaps = 5/515 (1%)

Query  7    VVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINF  66
            VVDLSR QFA+TA+YHF+FVPLTLGL+FIL IMET YV +GKE+YKDMTKFWGKLFGINF
Sbjct  4    VVDLSRLQFALTALYHFIFVPLTLGLSFILVIMETIYVATGKEVYKDMTKFWGKLFGINF  63

Query  67   ALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSK  126
            ALGVTTG+ MEFQFGTNW+YYSHYVGDIFGAPLAIE L+AFFLESTF+GLFFFGWDRLSK
Sbjct  64   ALGVTTGIIMEFQFGTNWSYYSHYVGDIFGAPLAIEALLAFFLESTFVGLFFFGWDRLSK  123

Query  127  VQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQVK  186
             +HL  T+ VA GSN+SA+WILVANGWMQ P G+ FN++T+RME+ +F  L  NPVAQ K
Sbjct  124  GKHLLATYCVAFGSNLSAMWILVANGWMQAPTGSEFNFETVRMEMTNFLDLWLNPVAQSK  183

Query  187  FVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESGY  246
            F+HT+SAGYVTGA FVLAISS++LLK RD  FA+RSF++AA FG  + +SV++LGDESGY
Sbjct  184  FLHTLSAGYVTGAFFVLAISSYFLLKGRDFEFAKRSFSVAATFGFIASISVLILGDESGY  243

Query  247  ELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATRSTTGQ  306
            ++G  Q  KLAA+E+E+ET PAPA F    +PN  EM+ D+AI+IPY  G+IATRS   +
Sbjct  244  DIGKAQPVKLAAMEAEFETHPAPAPFLPVAIPNTAEMKNDFAIEIPYLGGVIATRSIDKE  303

Query  307  VTGIKDLMKQHEARIRNGMVAYSELEKLRA-----GDRSASLLASFEKNQKDLGYGLLLK  361
            + G+KDL   +E R+R+G+ AY    +LRA     G  +    A F + +KDLG+GLLLK
Sbjct  304  IIGLKDLQALNETRVRSGIRAYELFTQLRAEKKANGQVNEETKAQFNEVKKDLGFGLLLK  363

Query  362  KYSPNVVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAED  421
            +Y+ NVVDATE  I+ A +D+IPNV   F++FR M+AAG L+ LL   A     +     
Sbjct  364  RYTNNVVDATEEQIKQAARDTIPNVGPNFWAFRAMIAAGGLIALLTFGAFVQNLRNKVTQ  423

Query  422  KPWLLKFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAAL  481
             P LLK  L+ LPLPWIA + GW++AE GRQPW   E+LP  +S S+LS+GD+W SI  +
Sbjct  424  IPLLLKVLLWGLPLPWIAIECGWFLAEYGRQPWATYEILPVGVSASNLSTGDLWFSIGLI  483

Query  482  AAFYTVLLVIEMYLMIKFARLGPSSLHTGKYHFEK  516
             A Y   +++EMYLM K+ARLGPS+L TGKY+FE+
Sbjct  484  CALYLAFIIVEMYLMFKYARLGPSALKTGKYYFEQ  518


> P26459 Cytochrome bd-II ubiquinol oxidase subunit 1 [Escherichia 
coli (strain K12)]
Length=514

 Score =  600 bits (1548),  Expect = 0.0
 Identities = 284/503 (56%), Positives = 382/503 (76%), Gaps = 0/503 (0%)

Query  7    VVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINF  66
            V+DLSR+QFA+TA+YHFLFVPLTLGL F+LAIMET YV++GK IY+DMT+FWGKLFGINF
Sbjct  4    VIDLSRWQFALTALYHFLFVPLTLGLIFLLAIMETIYVVTGKTIYRDMTRFWGKLFGINF  63

Query  67   ALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSK  126
            ALGV TGLTMEFQFGTNW++YS+YVGDIFGAPLA+E LMAFFLESTF+GLFFFGW RL+K
Sbjct  64   ALGVATGLTMEFQFGTNWSFYSNYVGDIFGAPLAMEALMAFFLESTFVGLFFFGWQRLNK  123

Query  127  VQHLGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQVK  186
             QHL VTWLVA GSN+SALWIL ANGWMQ P GA F+  T+RME+  F  L+FNPV+QVK
Sbjct  124  YQHLLVTWLVAFGSNLSALWILNANGWMQYPTGAHFDIDTLRMEMTSFSELVFNPVSQVK  183

Query  187  FVHTVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESGY  246
            FVHTV AGYVTGA+F++AIS++YLL+ R+   A RSFAI ++FG  +++  + LGD S Y
Sbjct  184  FVHTVMAGYVTGAMFIMAISAWYLLRGRERNVALRSFAIGSVFGTLAIIGTLQLGDSSAY  243

Query  247  ELGDVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATRSTTGQ  306
            E+  VQ  KLAA+E EW+TEPAPA F +   P Q + R  +A+KIP  LG++AT S    
Sbjct  244  EVAQVQPVKLAAMEGEWQTEPAPAPFHVVAWPEQDQERNAFALKIPALLGILATHSLDKP  303

Query  307  VTGIKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLKKYSPN  366
            V G+K+LM +   R++ G +A+  ++++  G+R   +L +F   + DLGYG+LL +Y+P+
Sbjct  304  VPGLKNLMAETYPRLQRGRMAWLLMQEISQGNREPHVLQAFRGLEGDLGYGMLLSRYAPD  363

Query  367  VVDATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAEDKPWLL  426
            +   T A  Q+A++ +IP V  +F+SFRIMV  G L+LL+ ++A     +   +   W+L
Sbjct  364  MNHVTAAQYQAAMRGAIPQVAPVFWSFRIMVGCGSLLLLVMLIALVQTLRGKIDQHRWVL  423

Query  427  KFALFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTSSLSSGDVWGSIAALAAFYT  486
            K AL++LPLPWIA + GW++ E GRQPW I ++LPT+ + S+L++G +  S+  +   YT
Sbjct  424  KMALWSLPLPWIAIEAGWFMTEFGRQPWAIQDILPTYSAHSALTTGQLAFSLIMIVGLYT  483

Query  487  VLLVIEMYLMIKFARLGPSSLHT  509
            + L+ E+YLM K+ARLGPS++ +
Sbjct  484  LFLIAEVYLMQKYARLGPSAMQS  506


> P94364 Cytochrome bd ubiquinol oxidase subunit 1 [Bacillus subtilis 
(strain 168)]
Length=468

 Score =  333 bits (855),  Expect = 2e-111
 Identities = 188/495 (38%), Positives = 274/495 (55%), Gaps = 59/495 (12%)

Query  10   LSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINFALG  69
            L+R QFA T ++HFLFVP+++GL F++A+MET Y++   E+Y  M KFWG LF INFA+G
Sbjct  6    LARIQFASTTLFHFLFVPMSIGLVFMVALMETLYLVKKNELYLKMAKFWGHLFLINFAVG  65

Query  70   VTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSKVQH  129
            V TG+  EFQFG NW+ YS +VGD+FGAPLAIE L+AFF+ES FIGL+ FGWDRL K  H
Sbjct  66   VVTGILQEFQFGLNWSDYSRFVGDVFGAPLAIEALLAFFMESIFIGLWIFGWDRLPKKIH  125

Query  130  LGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQVKFVH  189
                WLV+ G+ MS+ WIL AN +MQ PVG  F  +  R E+ DFGALI NP   V+F H
Sbjct  126  ALCIWLVSFGTIMSSFWILTANSFMQEPVG--FTIKNGRAEMNDFGALITNPQLWVEFPH  183

Query  190  TVSAGYVTGAIFVLAISSFYLLKKRDLPFARRSFAIAAIFGMASVLSVILLGDESGYELG  249
             +     TGA F+  +S+F LLKK+++PF ++SF +A I G+ + L V L G      L 
Sbjct  184  VIFGALATGAFFIAGVSAFKLLKKKEVPFFKQSFKLAMIVGLCAGLGVGLSGHMQAEHLM  243

Query  250  DVQKAKLAAIESEWETEPAPASFTLFGVPNQQEMRTDYAIKIPYALGLIATRSTTGQVTG  309
            + Q  K+AA E  WE    PA++T F   + +  ++   IK+PYAL  +A +  +G V G
Sbjct  244  ESQPMKMAASEGLWEDSGDPAAWTAFATIDTKNEKSSNEIKVPYALSYLAYQKFSGSVKG  303

Query  310  IKDLMKQHEARIRNGMVAYSELEKLRAGDRSASLLASFEKNQKDLGYGLLLKKYSPNVVD  369
            +K L  ++E         Y +      GD    +  +F   +  +G G+++         
Sbjct  304  MKTLQAEYEK-------IYGK------GDYIPPVKTTFWSFRIMVGAGVVM---------  341

Query  370  ATEAHIQSAVKDSIPNVKALFFSFRIMVAAGFLMLLLFILATWSVAKRNAEDKPWLLKFA  429
                                     I+ A G L         W   ++  E+  W L+  
Sbjct  342  -------------------------ILAALGGL---------WLNRRKKLENSKWYLRIM  367

Query  430  LFALPLPWIAAQTGWYVAEGGRQPWTIGEVLPTHLSTS-SLSSGDVWGSIAALAAFYTVL  488
            +  +  P++A   GW + E GRQPWT+  ++ T  S S ++++G +  SI A    Y +L
Sbjct  368  IALISFPFLANSAGWIMTEIGRQPWTVMGLMTTAQSVSPNVTAGSLLFSIIAFGVMYMIL  427

Query  489  LVIEMYLMIKFARLG  503
              + ++L I+  + G
Sbjct  428  GALLVFLFIREIKKG  442


> C0SP90 Putative cytochrome bd menaquinol oxidase subunit I [Bacillus 
subtilis (strain 168)]
Length=443

 Score =  122 bits (305),  Expect = 2e-33
 Identities = 85/306 (28%), Positives = 144/306 (47%), Gaps = 10/306 (3%)

Query  10   LSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINFALG  69
            L+R  F  T  +H +F  L +GL  ++ + E  Y  +  + Y  M K W K   +   + 
Sbjct  6    LARSLFGTTMGFHIIFATLGVGLPLMILVAELIYQKTKDDHYAIMAKRWTKAQAVLLGVA  65

Query  70   VTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSKVQH  129
            + TG     Q    W  +   +G +   P  IE + AFF+E+ F+ ++ +  DRLS    
Sbjct  66   IPTGTIAGTQLALLWPGFMEVIGRVMSLPFQIE-IYAFFVEALFMSIYVYAADRLSPAMR  124

Query  130  LGVTWLVAIGSNMSALWILVANGWMQNPVGAAFNYQTMRMELADFGALIFNPVAQVKFVH  189
            +   + V +G+  SA+ I   + +   P G  F     ++   D  A  FNP   +   H
Sbjct  125  IVAVFFVLVGAAASAVLITNVHAFEGTPAG--FKILNGKITDVDPWAAFFNPSFFITAGH  182

Query  190  TVSAGYVTGAIFVLAISSFYLL----KKRDLPFARRSFAIAAIFGMASVLSVILLGDESG  245
             V + ++TGA  V +++++ ++    K+R   F R++  +A   G    L   L G ES 
Sbjct  183  VVLSAFMTGAFIVASVAAYKMIRTRKKERVYRFHRKALLLALTIGGIFSLLTALNGHESA  242

Query  246  YELGDVQKAKLAAIESEWETEP-APASFTLFGVPNQQEMRTDYAIKIPYALGLIATRSTT  304
              L + Q  KLA  E  +ET   AP +   F  PN+++++  +AI+IP+AL  +A     
Sbjct  243  QMLYEYQPEKLAGAEGLFETRSHAPLAIGGFTDPNEEKVK--WAIEIPWALSFLAANRFD  300

Query  305  GQVTGI  310
              V G+
Sbjct  301  TVVKGL  306


 Score = 49.7 bits (117),  Expect = 9e-10
 Identities = 39/132 (30%), Positives = 56/132 (42%), Gaps = 21/132 (16%)

Query  393  FRIMVAAGFLMLLLFILAT-WSVAKRNAEDKPWLLKFALFALPLPWIAAQTGWYVAEGGR  451
            F  MV  G L++L  I+   W    +      WLL   + A P   I  + GW  A  GR
Sbjct  323  FNAMVGVGMLLILYSIIGVVWRKVLKKDRFPTWLLIIFMTAGPFSLIGIEFGWIFACTGR  382

Query  452  QPWTIGEVLPTHLSTSSLSSGDVWGSIAALAAFYTVLLVIEMYLMIKFARLGPSSLHTGK  511
            QPW I  +L T    ++       GSI  L  F+T +          +A LG + ++   
Sbjct  383  QPWVIYHLLKTSDVVTTT------GSIGVLFLFFTFV----------YAVLGAAVVYVLL  426

Query  512  YHFEKQETHHPL  523
            Y+F K    HP+
Sbjct  427  YYFRK----HPV  434


 Score = 18.1 bits (35),  Expect = 6.5
 Identities = 5/20 (25%), Positives = 10/20 (50%), Gaps = 0/20 (0%)

Query  130  LGVTWLVAIGSNMSALWILV  149
            +GV W   +  +    W+L+
Sbjct  339  IGVVWRKVLKKDRFPTWLLI  358



Lambda      K        H        a         alpha
   0.325    0.138    0.419    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1759017


  Database: 2fa4416be63a222e9f1007c9b3546ffc.SwissProt.fasta
    Posted date:  Sep 28, 2020  1:09 PM
  Number of letters in database: 4,049
  Number of sequences in database:  8



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40