ACIAD2064 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 79f68e2f8dd6e3b49443e4e441a96d2d.TrEMBL.fasta
           21 sequences; 8,653 total letters



Query= ACIAD2064

Length=412
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FAN7 Uncharacterized protein [Acinetobacter baylyi (strain AT...   804    0.0   
  N9C049 SfnB family sulfur acquisition oxidoreductase [Acinetoba...   711    0.0   
  A0A009ZBQ5 Sulfur acquisition oxidoreductase, SfnB family [Acin...   706    0.0   
  N9SB39 SfnB family sulfur acquisition oxidoreductase [Acinetoba...   706    0.0   
  A0A2J1E6Q8 SfnB family sulfur acquisition oxidoreductase [Acine...   664    0.0   
  A0A222A5T6 SfnB family sulfur acquisition oxidoreductase [Acine...   663    0.0   
  A0A2S4T084 SfnB family sulfur acquisition oxidoreductase [Acine...   663    0.0   
  A0A2G1TJQ7 SfnB family sulfur acquisition oxidoreductase [Acine...   663    0.0   
  A0A204ET63 SfnB family sulfur acquisition oxidoreductase [Acine...   662    0.0   
  Q65YX2 Acyl-CoA dehydrogenase-family protein [Pseudomonas putida]    337    1e-114
  Q9LBX2 Thermophilic dibenzothiophene desulfurization enzyme C [...   157    3e-46 
  Q8GIB7 DBT monooxygenase DszC [Mycobacterium sp. G3]                 157    3e-46 
  Q6B6H3 DBT monooxygenase [Gordonia alkanivorans]                     155    1e-45 
  Q8GRC5 Dibenzothiophene desulfurization enzyme C [Bacillus subt...   154    5e-45 
  Q3HSE4 DBT monooxygenase [Rhodococcus sp. IIPS7]                     153    1e-44 
  B2CML6 Dibenzothiophene monooxygenase [Mycobacterium goodii]         151    5e-44 
  Q64F43 DszC [Rhodococcus erythropolis]                               151    5e-44 
  Q6WNP1 Dibenzothiophene desulfurization enzyme C [Rhodococcus s...   151    5e-44 
  Q65YX1 Acyl-CoA dehydrogenase-family protein [Pseudomonas putida]    150    9e-44 
  A0A0C6DRW4 DszC protein [Rhodococcus erythropolis]                   150    9e-44 
  Q0ZIH5 DszC [Rhodococcus sp. DS-3]                                   148    6e-43 


> Q6FAN7 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=411

 Score =  804 bits (2077),  Expect = 0.0
 Identities = 410/411 (99%), Positives = 411/411 (100%), Gaps = 0/411 (0%)

Query  1    LISNVGITMSELIFSRSKTAHLIKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQ  60
            +ISNVGITMSELIFSRSKTAHLIKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQ
Sbjct  1    MISNVGITMSELIFSRSKTAHLIKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQ  60

Query  61   FSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTES  120
            FSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTES
Sbjct  61   FSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTES  120

Query  121  QKQFIYSEILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLA  180
            QKQFIYSEILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLA
Sbjct  121  QKQFIYSEILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLA  180

Query  181  IKAIHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILS  240
            IKAIHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILS
Sbjct  181  IKAIHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILS  240

Query  241  QVPTYRGAYSQLLQVAIDVGIAEAAFSDLISTVKKARPIIDAHVEKASLEPFTLQETGKL  300
            QVPTYRGAYSQLLQVAIDVGIAEAAFSDLISTVKKARPIIDAHVEKASLEPFTLQETGKL
Sbjct  241  QVPTYRGAYSQLLQVAIDVGIAEAAFSDLISTVKKARPIIDAHVEKASLEPFTLQETGKL  300

Query  301  NVLLDAAILLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLEL  360
            NVLLDAAILLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLEL
Sbjct  301  NVLLDAAILLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLEL  360

Query  361  GGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI  411
            GGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI
Sbjct  361  GGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI  411


> N9C049 SfnB family sulfur acquisition oxidoreductase [Acinetobacter 
ursingii ANC 3649]
Length=403

 Score =  711 bits (1836),  Expect = 0.0
 Identities = 356/403 (88%), Positives = 388/403 (96%), Gaps = 0/403 (0%)

Query  9    MSELIFSRSKTAHLIKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQFSLKGLGG  68
            MSEL F  +++  +I+NDQQAINAAYQVADFALEGRN RDQ+RILPFEEI+QFSLKGLGG
Sbjct  1    MSELNFYPTRSVQVIQNDQQAINAAYQVADFALEGRNQRDQKRILPFEEIDQFSLKGLGG  60

Query  69   IRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTESQKQFIYSE  128
            IRIPKRYGGAF+SNKTLAQVFRILNKADSS+GQIPQNQISLL+LIDLMGTESQKQFI++E
Sbjct  61   IRIPKRYGGAFVSNKTLAQVFRILNKADSSVGQIPQNQISLLNLIDLMGTESQKQFIFNE  120

Query  129  ILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLAIKAIHPKG  188
            ILSGKRLANGGPE++TKDSKTLQTTLTL+NG+YYLDGEKFYSTGSIFAHWLAIKAIHP+G
Sbjct  121  ILSGKRLANGGPERHTKDSKTLQTTLTLKNGKYYLDGEKFYSTGSIFAHWLAIKAIHPEG  180

Query  189  HVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILSQVPTYRGA  248
            HVVLV+V+  S GIEIIN+WNGFGQRTTASGTVKL+QV VDP+LIFDERIL+Q PTYRGA
Sbjct  181  HVVLVIVDRHSDGIEIINNWNGFGQRTTASGTVKLHQVIVDPDLIFDERILTQAPTYRGA  240

Query  249  YSQLLQVAIDVGIAEAAFSDLISTVKKARPIIDAHVEKASLEPFTLQETGKLNVLLDAAI  308
            YSQLLQVAIDVGIAEAAF+DLIS VKKARPI+DA VEKASLEP+TLQETGKL++LL+AAI
Sbjct  241  YSQLLQVAIDVGIAEAAFADLISAVKKARPILDAQVEKASLEPYTLQETGKLDILLNAAI  300

Query  309  LLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRASLS  368
            LLLDEAA+YLDELDQL Q+TEQQAA+ASILVA AKVYANDAALQISEKLLELGGSRASLS
Sbjct  301  LLLDEAAEYLDELDQLNQVTEQQAAKASILVAEAKVYANDAALQISEKLLELGGSRASLS  360

Query  369  QFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI  411
            QFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI
Sbjct  361  QFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI  403


> A0A009ZBQ5 Sulfur acquisition oxidoreductase, SfnB family [Acinetobacter 
sp. 479375]
Length=403

 Score =  706 bits (1823),  Expect = 0.0
 Identities = 354/403 (88%), Positives = 386/403 (96%), Gaps = 0/403 (0%)

Query  9    MSELIFSRSKTAHLIKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQFSLKGLGG  68
            MSEL F  +++  +I+NDQQAINAAYQVADFALEGRN RDQ+RILPFEEI+QFSLKGLGG
Sbjct  1    MSELNFYPTRSVQVIQNDQQAINAAYQVADFALEGRNQRDQKRILPFEEIDQFSLKGLGG  60

Query  69   IRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTESQKQFIYSE  128
            IRIPKRYGGAF+SNKTLAQVFRILNKADSS+GQIPQNQISLL+LIDLMGTESQK FI++E
Sbjct  61   IRIPKRYGGAFVSNKTLAQVFRILNKADSSVGQIPQNQISLLNLIDLMGTESQKHFIFNE  120

Query  129  ILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLAIKAIHPKG  188
            ILSGKRLANGGPE++TKDSKTLQTTLTL+NG+YYLDGEKFYSTGSIFAHWLAIKAIHP+G
Sbjct  121  ILSGKRLANGGPERHTKDSKTLQTTLTLKNGKYYLDGEKFYSTGSIFAHWLAIKAIHPEG  180

Query  189  HVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILSQVPTYRGA  248
            HVVLV+V+  S GIEIIN+WNGFGQRTTASGTVKL+QV VDP+LIFDERIL+Q PTYRGA
Sbjct  181  HVVLVIVDRHSDGIEIINNWNGFGQRTTASGTVKLHQVIVDPDLIFDERILTQAPTYRGA  240

Query  249  YSQLLQVAIDVGIAEAAFSDLISTVKKARPIIDAHVEKASLEPFTLQETGKLNVLLDAAI  308
            YSQLLQVAIDVGIAEAAF+DLIS VKKARPI+DA VEKASLEP+TLQETGKL++LL+AAI
Sbjct  241  YSQLLQVAIDVGIAEAAFADLISAVKKARPILDAQVEKASLEPYTLQETGKLDILLNAAI  300

Query  309  LLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRASLS  368
            LLLDEAA+YLDELDQL Q+TEQQAA+ASILVA AKVYANDAALQISEKLLELGGSRASLS
Sbjct  301  LLLDEAAEYLDELDQLGQVTEQQAAKASILVAEAKVYANDAALQISEKLLELGGSRASLS  360

Query  369  QFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI  411
            QFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNG LPARHAWI
Sbjct  361  QFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGILPARHAWI  403


> N9SB39 SfnB family sulfur acquisition oxidoreductase [Acinetobacter 
ursingii NIPH 706]
Length=403

 Score =  706 bits (1823),  Expect = 0.0
 Identities = 354/403 (88%), Positives = 386/403 (96%), Gaps = 0/403 (0%)

Query  9    MSELIFSRSKTAHLIKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQFSLKGLGG  68
            MSEL F  +++  +I+NDQQAINAAYQVADFALEGRN RDQ+RILPFEEI+QFSLKGLGG
Sbjct  1    MSELNFYPTRSVQVIQNDQQAINAAYQVADFALEGRNQRDQKRILPFEEIDQFSLKGLGG  60

Query  69   IRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTESQKQFIYSE  128
            IRIPKRYGGAF+SNKTLAQVFRILNKADSS+GQIPQNQISLL+LIDLMGTESQK FI++E
Sbjct  61   IRIPKRYGGAFVSNKTLAQVFRILNKADSSVGQIPQNQISLLNLIDLMGTESQKHFIFNE  120

Query  129  ILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLAIKAIHPKG  188
            ILSGKRLANGGPE++TKDSKTLQTTLTL+NG+YYLDGEKFYSTGSIFAHWLAIKAIHP+G
Sbjct  121  ILSGKRLANGGPERHTKDSKTLQTTLTLKNGKYYLDGEKFYSTGSIFAHWLAIKAIHPEG  180

Query  189  HVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILSQVPTYRGA  248
            HVVLV+V+  S GIEIIN+WNGFGQRTTASGTVKL+QV VDP+LIFDERIL+Q PTYRGA
Sbjct  181  HVVLVIVDRHSDGIEIINNWNGFGQRTTASGTVKLHQVIVDPDLIFDERILTQAPTYRGA  240

Query  249  YSQLLQVAIDVGIAEAAFSDLISTVKKARPIIDAHVEKASLEPFTLQETGKLNVLLDAAI  308
            YSQLLQVAIDVGIAEAAF+DLIS VKKARPI+DA VEKASLEP+TLQETGKL++LL+AAI
Sbjct  241  YSQLLQVAIDVGIAEAAFADLISAVKKARPILDAQVEKASLEPYTLQETGKLDILLNAAI  300

Query  309  LLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRASLS  368
            LLLDEAA+YLDELDQL Q+TEQQAA+ASILVA AKVYANDAALQISEKLLELGGSRASLS
Sbjct  301  LLLDEAAEYLDELDQLGQVTEQQAAKASILVAEAKVYANDAALQISEKLLELGGSRASLS  360

Query  369  QFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI  411
            QFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNG LPARHAWI
Sbjct  361  QFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGILPARHAWI  403


> A0A2J1E6Q8 SfnB family sulfur acquisition oxidoreductase [Acinetobacter 
baumannii]
Length=411

 Score =  664 bits (1712),  Expect = 0.0
 Identities = 325/406 (80%), Positives = 370/406 (91%), Gaps = 0/406 (0%)

Query  6    GITMSELIFSRSKTAHLIKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQFSLKG  65
            G+ MS  +   +    +I+NDQQAINAAYQVADFALEGRN RDQQR+LP E+IE FS KG
Sbjct  6    GVIMSNSLSKTTAYVQVIQNDQQAINAAYQVADFALEGRNTRDQQRLLPHEQIESFSQKG  65

Query  66   LGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTESQKQFI  125
            LGGIRI K+YGGAF+SNKTLAQVFRIL+K D+++GQIPQNQISLL+LI++MGTE QKQFI
Sbjct  66   LGGIRIAKKYGGAFVSNKTLAQVFRILSKGDANVGQIPQNQISLLNLIEIMGTEQQKQFI  125

Query  126  YSEILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLAIKAIH  185
            +SEIL+GKRLANGGPE+NT DSKTL+TTLT+ NG+Y+L+GEKFYSTG+ FAHWLAIKAIH
Sbjct  126  FSEILAGKRLANGGPERNTHDSKTLKTTLTIENGKYFLNGEKFYSTGTSFAHWLAIKAIH  185

Query  186  PKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILSQVPTY  245
            P+GHVVLV+V  D+ GIE+INDWNGFGQRTTASGTVKLNQV+V+P LIFDER+L+QVPTY
Sbjct  186  PEGHVVLVIVNRDAQGIEVINDWNGFGQRTTASGTVKLNQVEVNPELIFDERLLTQVPTY  245

Query  246  RGAYSQLLQVAIDVGIAEAAFSDLISTVKKARPIIDAHVEKASLEPFTLQETGKLNVLLD  305
            RGAYSQLLQVAIDVGIAEAAF D +ST+ KARPIIDA+VEKAS E +TLQE GKLN+LLD
Sbjct  246  RGAYSQLLQVAIDVGIAEAAFEDTLSTIHKARPIIDANVEKASFEHYTLQEVGKLNILLD  305

Query  306  AAILLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRA  365
            AAILLLDEAA+YLDELDQLQ +T++Q A+ASILVA AKVYANDAALQISEKLLELGGSR+
Sbjct  306  AAILLLDEAAEYLDELDQLQTVTDEQVAKASILVAEAKVYANDAALQISEKLLELGGSRS  365

Query  366  SLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI  411
            SLSQ NLDQHWRNARVHTLHDPVRWK+HAIGNYYLNG  PARHAWI
Sbjct  366  SLSQHNLDQHWRNARVHTLHDPVRWKLHAIGNYYLNGHFPARHAWI  411


> A0A222A5T6 SfnB family sulfur acquisition oxidoreductase [Acinetobacter 
baumannii]
Length=411

 Score =  663 bits (1710),  Expect = 0.0
 Identities = 323/406 (80%), Positives = 370/406 (91%), Gaps = 0/406 (0%)

Query  6    GITMSELIFSRSKTAHLIKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQFSLKG  65
            G+ MS  +   +    +I+NDQQAINAAYQVADFALEGRN RDQQR+LP E+IE FS KG
Sbjct  6    GVIMSNSLSKTTAYVQVIQNDQQAINAAYQVADFALEGRNTRDQQRLLPHEQIESFSQKG  65

Query  66   LGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTESQKQFI  125
            LGGIRI K+YGGAF+SNKTLAQVFRIL+K D+++GQIPQNQISLL+LI++MGTE QKQFI
Sbjct  66   LGGIRIAKKYGGAFVSNKTLAQVFRILSKGDANVGQIPQNQISLLNLIEIMGTEQQKQFI  125

Query  126  YSEILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLAIKAIH  185
            +SEIL+GKRLANGGPE+NT DSKTL+TTLT+ NG+Y+L+GEKFYSTG+ FAHWLAIKA+H
Sbjct  126  FSEILAGKRLANGGPERNTHDSKTLKTTLTIENGKYFLNGEKFYSTGTSFAHWLAIKAVH  185

Query  186  PKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILSQVPTY  245
            P+GHVVLV+V  D+ GIE+INDWNGFGQRTTASGTVKLNQV+++P LIFDER+L+QVPTY
Sbjct  186  PEGHVVLVIVNRDAQGIEVINDWNGFGQRTTASGTVKLNQVEINPELIFDERLLTQVPTY  245

Query  246  RGAYSQLLQVAIDVGIAEAAFSDLISTVKKARPIIDAHVEKASLEPFTLQETGKLNVLLD  305
            RGAYSQLLQVAIDVGIAEAAF D +ST+ KARPIIDA+VEKAS E +TLQE GKLN+LLD
Sbjct  246  RGAYSQLLQVAIDVGIAEAAFEDTLSTIHKARPIIDANVEKASFEHYTLQEVGKLNILLD  305

Query  306  AAILLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRA  365
            AAILLLDEAA+YLDELDQLQ +T++Q A+ASILVA AKVYANDAALQISEKLLELGGSR+
Sbjct  306  AAILLLDEAAEYLDELDQLQTVTDEQVAKASILVAEAKVYANDAALQISEKLLELGGSRS  365

Query  366  SLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI  411
            SLSQ NLDQHWRNARVHTLHDPVRWK+HAIGNYYLNG  PARHAWI
Sbjct  366  SLSQHNLDQHWRNARVHTLHDPVRWKLHAIGNYYLNGHFPARHAWI  411


> A0A2S4T084 SfnB family sulfur acquisition oxidoreductase [Acinetobacter 
calcoaceticus/baumannii complex sp. ABNIH27]
Length=411

 Score =  663 bits (1710),  Expect = 0.0
 Identities = 323/406 (80%), Positives = 370/406 (91%), Gaps = 0/406 (0%)

Query  6    GITMSELIFSRSKTAHLIKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQFSLKG  65
            G+ MS  +   +    +I+NDQQAINAAYQVADFALEGRN RDQQR+LP E+IE FS KG
Sbjct  6    GVIMSNSLSKTTAYVQVIQNDQQAINAAYQVADFALEGRNTRDQQRLLPHEQIESFSQKG  65

Query  66   LGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTESQKQFI  125
            LGGIRI K+YGGAF+SNKTLAQVFRIL+K D+++GQIPQNQISLL+LI++MGTE QKQFI
Sbjct  66   LGGIRIAKKYGGAFVSNKTLAQVFRILSKGDANVGQIPQNQISLLNLIEIMGTEQQKQFI  125

Query  126  YSEILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLAIKAIH  185
            +SEIL+GKRLANGGPE+NT DSKTL+TTLT+ NG+Y+L+GEKFYSTG+ FAHWLAIKA+H
Sbjct  126  FSEILAGKRLANGGPERNTHDSKTLKTTLTIENGKYFLNGEKFYSTGTSFAHWLAIKAVH  185

Query  186  PKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILSQVPTY  245
            P+GHVVLV+V  D+ GIE+INDWNGFGQRTTASGTVKLNQV+++P LIFDER+L+QVPTY
Sbjct  186  PEGHVVLVIVNRDAQGIEVINDWNGFGQRTTASGTVKLNQVEINPELIFDERLLTQVPTY  245

Query  246  RGAYSQLLQVAIDVGIAEAAFSDLISTVKKARPIIDAHVEKASLEPFTLQETGKLNVLLD  305
            RGAYSQLLQVAIDVGIAEAAF D +ST+ KARPIIDA+VEKAS E +TLQE GKLN+LLD
Sbjct  246  RGAYSQLLQVAIDVGIAEAAFEDTLSTIHKARPIIDANVEKASFEHYTLQEVGKLNILLD  305

Query  306  AAILLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRA  365
            AAILLLDEAA+YLDELDQLQ +T++Q A+ASILVA AKVYANDAALQISEKLLELGGSR+
Sbjct  306  AAILLLDEAAEYLDELDQLQTVTDEQVAKASILVAEAKVYANDAALQISEKLLELGGSRS  365

Query  366  SLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI  411
            SLSQ NLDQHWRNARVHTLHDPVRWK+HAIGNYYLNG  PARHAWI
Sbjct  366  SLSQHNLDQHWRNARVHTLHDPVRWKLHAIGNYYLNGHFPARHAWI  411


> A0A2G1TJQ7 SfnB family sulfur acquisition oxidoreductase [Acinetobacter 
baumannii]
Length=411

 Score =  663 bits (1710),  Expect = 0.0
 Identities = 325/406 (80%), Positives = 370/406 (91%), Gaps = 0/406 (0%)

Query  6    GITMSELIFSRSKTAHLIKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQFSLKG  65
            G+ MS  +   +    +I+NDQQAINAAYQVADFALEGRN RDQQR+LP E+IE FS KG
Sbjct  6    GVIMSNSLSKTTAYVQVIQNDQQAINAAYQVADFALEGRNTRDQQRLLPQEQIESFSQKG  65

Query  66   LGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTESQKQFI  125
            LGGIRI K+YGGAF+SNKTLAQVFRIL+K D+++GQIPQNQISLL+LI++MGTE QKQFI
Sbjct  66   LGGIRIAKKYGGAFVSNKTLAQVFRILSKGDANVGQIPQNQISLLNLIEIMGTEQQKQFI  125

Query  126  YSEILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLAIKAIH  185
            +SEIL+GKRLANGGPE+NT DSKTL+TTLT+ NG+Y+L+GEKFYSTG+ FAHWLAIKAIH
Sbjct  126  FSEILAGKRLANGGPERNTHDSKTLKTTLTIENGKYFLNGEKFYSTGTSFAHWLAIKAIH  185

Query  186  PKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILSQVPTY  245
            P+GHVVLV+V  D+ GIE+INDWNGFGQRTTASGTVKLNQV+V+P LIFDER+L+QVPTY
Sbjct  186  PEGHVVLVIVNRDAQGIEVINDWNGFGQRTTASGTVKLNQVEVNPELIFDERLLTQVPTY  245

Query  246  RGAYSQLLQVAIDVGIAEAAFSDLISTVKKARPIIDAHVEKASLEPFTLQETGKLNVLLD  305
            RGAYSQLLQVAIDVGIAEAAF D +ST+ KARPIIDA+VEKAS E +TLQE GKLN+LLD
Sbjct  246  RGAYSQLLQVAIDVGIAEAAFEDTLSTIHKARPIIDANVEKASFEHYTLQEVGKLNILLD  305

Query  306  AAILLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRA  365
            AAILLLDEAA+YLDELDQLQ +T++Q A+ASILVA AKVYANDAALQISEKLLELGGSR+
Sbjct  306  AAILLLDEAAEYLDELDQLQTVTDEQVAKASILVAEAKVYANDAALQISEKLLELGGSRS  365

Query  366  SLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI  411
            SLSQ NLDQHWRNARVHTLHDPVRWK+HAIGNYYLNG  PARHAWI
Sbjct  366  SLSQHNLDQHWRNARVHTLHDPVRWKLHAIGNYYLNGHFPARHAWI  411


> A0A204ET63 SfnB family sulfur acquisition oxidoreductase [Acinetobacter 
baumannii]
Length=403

 Score =  662 bits (1707),  Expect = 0.0
 Identities = 324/403 (80%), Positives = 368/403 (91%), Gaps = 0/403 (0%)

Query  9    MSELIFSRSKTAHLIKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQFSLKGLGG  68
            MS  +F  +    +I+NDQQAINAAYQVADFALEGRN RDQQR+LP E+IE FS KGLGG
Sbjct  1    MSNSLFKTTAYVQVIQNDQQAINAAYQVADFALEGRNTRDQQRLLPHEQIESFSQKGLGG  60

Query  69   IRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTESQKQFIYSE  128
            IRI K+YGGAF+SNKTLAQVFRIL+K D+++GQIPQNQISLL+LI++MGTE QKQFI+SE
Sbjct  61   IRIAKKYGGAFVSNKTLAQVFRILSKGDANVGQIPQNQISLLNLIEIMGTEQQKQFIFSE  120

Query  129  ILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLAIKAIHPKG  188
            IL+GKRLANGGPE+NT DSKTL+TTLT+ NG+Y L+GEKFYSTG+ FAHWLAIKA+HP+G
Sbjct  121  ILAGKRLANGGPERNTHDSKTLKTTLTIENGKYILNGEKFYSTGTSFAHWLAIKAVHPEG  180

Query  189  HVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILSQVPTYRGA  248
            HVVLV+V  D+ GIE+INDWNGFGQRTTASGTVKLNQV+V+P LIFDER+L+QVPTYRGA
Sbjct  181  HVVLVIVNRDAQGIEVINDWNGFGQRTTASGTVKLNQVEVNPELIFDERLLTQVPTYRGA  240

Query  249  YSQLLQVAIDVGIAEAAFSDLISTVKKARPIIDAHVEKASLEPFTLQETGKLNVLLDAAI  308
            YSQLLQVAIDVGIAEAAF D +ST+ KARPIIDA+VEKAS E +TLQE GKLN+LLDAAI
Sbjct  241  YSQLLQVAIDVGIAEAAFEDTLSTIHKARPIIDANVEKASFEHYTLQEVGKLNILLDAAI  300

Query  309  LLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRASLS  368
            LLLDEAA+YLDELDQLQ +T++Q A+ASILVA AKVYANDAALQISEKLLELGGSR+SLS
Sbjct  301  LLLDEAAEYLDELDQLQTVTDEQVAKASILVAEAKVYANDAALQISEKLLELGGSRSSLS  360

Query  369  QFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAWI  411
            Q NLDQHWRNARVHTLHDPVRWK+HAIGNYYLNG  PARHAWI
Sbjct  361  QHNLDQHWRNARVHTLHDPVRWKLHAIGNYYLNGHFPARHAWI  403


> Q65YX2 Acyl-CoA dehydrogenase-family protein [Pseudomonas putida]
Length=412

 Score =  337 bits (863),  Expect = 1e-114
 Identities = 177/403 (44%), Positives = 259/403 (64%), Gaps = 5/403 (1%)

Query  10   SELIFSRSKTAHLIKNDQQAINAAYQVA-DFALEGRNVRDQQRILPFEEIEQFSLKGLGG  68
            S ++   SK AH + ++++AI AA+ +A DF  E    RD++R LP  E+E +S  GL  
Sbjct  12   SIVLHPSSKPAHRLGSEREAIEAAHALAQDFRREAA-ARDRERRLPLAELEAYSQSGLWS  70

Query  69   IRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTESQKQFIYSE  128
            I +P+ YGG   S +T+ +VF+I++ AD SLGQ+PQN   +L  I    +++QK+F +  
Sbjct  71   ITVPQAYGGLGASYRTVGEVFKIISAADGSLGQLPQNHFVILAHIGFDASDAQKRFFFDL  130

Query  129  ILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLAIKAIHPKG  188
             LSG R  N   E+N K    LQT +T    +Y ++G+KF+STG++ AHW+ I ++  +G
Sbjct  131  ALSGARFGNAFSERNGKHVADLQTRITRDGDDYVVNGQKFFSTGALVAHWIPIVSVDEQG  190

Query  189  HVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILSQVPTYRGA  248
               L VV  ++ G+++INDW+ FGQRTTASGTV + QV+V  + +         PT  GA
Sbjct  191  RPHLAVVPRETEGLKVINDWSSFGQRTTASGTVLIEQVRVQASQVVPIWQAFDRPTAGGA  250

Query  249  YSQLLQVAIDVGIAEAAFSDLISTVKK-ARPIIDAHVEKASLEPFTLQETGKLNVLLDAA  307
             SQ +Q AID G+A  A +D +  V++  RP ID+ +EKA+ +P+ LQ+ G L + L AA
Sbjct  251  ISQFIQAAIDAGLAREALADTLDYVRRHTRPWIDSGLEKATDDPYILQQLGDLQIRLRAA  310

Query  308  ILLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRASL  367
              +LD AAD +D    +++ +E+  A+ASI  A AKV   + A+  S +L EL G+R++L
Sbjct  311  EAVLDLAADAIDL--AIREPSEESVAEASIRTAEAKVLTTEVAILASNRLFELAGTRSTL  368

Query  368  SQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLPARHAW  410
             +++LD+HWRNARVHTLHDPVRWK H IGNY LNG  P RH W
Sbjct  369  EEYSLDRHWRNARVHTLHDPVRWKYHLIGNYLLNGIKPPRHPW  411


> Q9LBX2 Thermophilic dibenzothiophene desulfurization enzyme C 
[Paenibacillus sp. A11-2]
Length=414

 Score =  157 bits (398),  Expect = 3e-46
 Identities = 115/398 (29%), Positives = 186/398 (47%), Gaps = 15/398 (4%)

Query  23   IKNDQQAINAAYQVADFALEGRNVRDQQRILPFEEIEQFSLKGLGGIRIPKRYGGAFISN  82
            ++ D +A++ A ++A         R++    P  E +     GL  + I K  GG   S 
Sbjct  11   VREDHRALDVATELAKTFRVTVRERERAGGTPKAERDAIRRSGLLTLLISKERGGLGESW  70

Query  83   KTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGTESQKQFIYSEILSGKR-LANGGPE  141
             T+ +    +  AD+SLG +     S    +DL  +  QK   Y + +  +  L N   E
Sbjct  71   PTVYEAIAEIASADASLGHLFGYHFSNFAYVDLFASPEQKARWYPQAVRERWFLGNASSE  130

Query  142  KNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHWLAIKAIHPK-----GHVVLVVVE  196
             N        T   L +G Y ++G K + +GS  A  L + A+  +     G +V  ++ 
Sbjct  131  NNAHVLDWRVTATPLPDGSYEINGTKAFCSGSADADRLLVFAVTSRDPNGDGRIVAALIP  190

Query  197  HDSSGIEIINDWNGFGQRTTASGTVKLNQVKV-------DPNLIFDERILSQVPTYRGAY  249
             D +G+++  DW+  G R T SG+V  + V V        P  + D       P+     
Sbjct  191  SDRAGVQVNGDWDSLGMRQTDSGSVTFSGVVVYPDELLGTPGQVTDAFASGSKPSLWTPI  250

Query  250  SQLLQVAIDVGIAEAAFSDLISTVKK-ARPIIDAHVEKASLEPFTLQETGKLNVLLDAAI  308
            +QL+   + +GIA  A  +     +  +RP   A VEKA+ +P+ L   G+    L  A 
Sbjct  251  TQLIFTHLYLGIARGALEEAAHYSRSHSRPFTLAGVEKATEDPYVLAIYGEFAAQLQVAE  310

Query  309  LLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRASLS  368
                E A  + EL +   +T +Q  Q  + VA AK+ A    ++++ +L E  G+RA+ S
Sbjct  311  AGAREVALRVQELWERNHVTPEQRGQLMVQVASAKIVATRLVIELTSRLYEAMGARAAAS  370

Query  369  -QFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLNGTLP  405
             QF  D+ WR+AR HTLHDPV +KI  +GN++LN   P
Sbjct  371  RQFGFDRFWRDARTHTLHDPVAYKIREVGNWFLNHRFP  408


> Q8GIB7 DBT monooxygenase DszC [Mycobacterium sp. G3]
Length=415

 Score =  157 bits (398),  Expect = 3e-46
 Identities = 106/365 (29%), Positives = 172/365 (47%), Gaps = 15/365 (4%)

Query  56   EEIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDL  115
            EE E     GL  + +P+  GG      T  +V R + K D SLG +    +S   +IDL
Sbjct  45   EEREDLRTSGLLSVTVPRHLGGWGADWPTALEVVREIAKVDGSLGHLFGYHLSTPAVIDL  104

Query  116  MGTESQKQFIYSEILSGKRLANGGPEKNTKDSKTLQTTLT-LRNGEYYLDGEKFYSTGSI  174
             G+  QK+ +  ++            +N       + T T   +G Y+ +G K +S+G+ 
Sbjct  105  WGSPEQKERLLRQLAENNWWTGNASSENNSHILDWKVTATPADDGGYFFNGIKHFSSGAK  164

Query  175  FAHWLAIKAIHPKGH-----VVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKV-  228
             +  L +  + P+G      +V   +     G++  +DW   G R T SGT + + V V 
Sbjct  165  GSDLLLVFGVIPEGFPQQGAIVAAAIPTTREGVQPNDDWQALGMRRTDSGTTEFHNVAVR  224

Query  229  ------DPNLIFDERILSQVPTYRGAYSQLLQVAIDVGIAEAAFSDLIS-TVKKARPIID  281
                   PN I +  + S   +  G   QL+  ++ +GIA  A       T  +ARP   
Sbjct  225  PDEVLGKPNAILEAFLASGRGSLFGPIVQLVFSSVYLGIARGALETAREYTRTQARPWTP  284

Query  282  AHVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDEL-DQLQQITEQQAAQASILVA  340
            A V +A  +P+T++  G+  + L AA     EAA  L    D+   +T Q+  +  + ++
Sbjct  285  AGVTQAVEDPYTIRSYGEFGIQLQAADAAAREAAQLLQAAWDRGDALTSQERGELMVQIS  344

Query  341  HAKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYL  400
              K  A  AAL ++ ++ E+ G+R +  ++  D+ WRN R HTLHDPV +KI  +GNY L
Sbjct  345  GVKAIATQAALDVTSRIFEVIGARGTHPKYGFDRFWRNIRTHTLHDPVSYKIAEVGNYVL  404

Query  401  NGTLP  405
            N   P
Sbjct  405  NQRYP  409


> Q6B6H3 DBT monooxygenase [Gordonia alkanivorans]
Length=416

 Score =  155 bits (393),  Expect = 1e-45
 Identities = 104/364 (29%), Positives = 179/364 (49%), Gaps = 15/364 (4%)

Query  57   EIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLM  116
            E E     GL  + IP++YGG      T  +V R +  AD SLG +    +S   +I+L 
Sbjct  47   EREDLRASGLLSLLIPRQYGGWGADWPTAIEVVREIAAADGSLGHLLGYHLSSAPMIELF  106

Query  117  GTESQKQFIYSEILSGKR-LANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIF  175
            G++ Q+Q +Y +I        N   E N+       +     +G Y L+G K + +G+  
Sbjct  107  GSQEQEQRLYRQIAQNDWWTGNASSENNSHVLDWKVSASPTEDGGYLLNGTKHFCSGAKG  166

Query  176  AHWLAIKAI-----HPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDP  230
            +  L +  +       +G ++  V+     G+++ +DW   G R T SG+   + VKV+P
Sbjct  167  SDLLLVFGVIQDDSPQQGAIIAAVIPTSRHGVQVNDDWAAIGMRQTDSGSTDFHSVKVEP  226

Query  231  NLIFDER---ILSQVPTYRGAYS----QLLQVAIDVGIAEAAFSDLIS-TVKKARPIIDA  282
            + +  E    I++ + + RG+      QL+   + +GIA  A       T  +ARP   A
Sbjct  227  DEVLGEPNAFIVAFIQSERGSLFAPIVQLIFANVYLGIAHGALDAAREYTRTQARPWTPA  286

Query  283  HVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDEL-DQLQQITEQQAAQASILVAH  341
             V++A+ +P+ L+  G+  + L  A     EAA  L  + D+   +T +   +  + ++ 
Sbjct  287  GVQQATEDPYVLRAYGEFTIALQGADAAAREAAHLLQTVWDKGDALTPEDRGELMVKISG  346

Query  342  AKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLN  401
             K  A +AAL ++  + E+ G+R +  ++  D+ WRN R HTLHDPV +KI  +G + LN
Sbjct  347  VKALATNAALDVNSGIFEVIGARGTHPKYGFDRFWRNVRTHTLHDPVSYKIADVGKHTLN  406

Query  402  GTLP  405
            G  P
Sbjct  407  GQYP  410


> Q8GRC5 Dibenzothiophene desulfurization enzyme C [Bacillus subtilis]
Length=415

 Score =  154 bits (389),  Expect = 5e-45
 Identities = 106/365 (29%), Positives = 169/365 (46%), Gaps = 15/365 (4%)

Query  56   EEIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDL  115
            EE E     GL  + +P+  GG      T  +V R + K D SLG +    +S   +IDL
Sbjct  45   EEREDLRASGLLSVTVPRHLGGWGADWPTALEVVREIAKVDGSLGHLFGYHLSTPAVIDL  104

Query  116  MGTESQKQFIYSEILSGKR-LANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSI  174
             G+  Q + +  ++        N   E N+   +   T     +G Y L+G K +S+G+ 
Sbjct  105  WGSPEQSERLLRQLAENNWWTGNASSENNSHILEWKVTATPTDDGGYLLNGIKHFSSGAK  164

Query  175  FAHWLAIKAIHPKGH-----VVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKV-  228
             +  L +  + P+G      +V   +     G++  +DW   G R T SGT + + V V 
Sbjct  165  GSDLLLVFGVIPEGSPQQGAIVAAAIPTTREGVQTNDDWQALGMRRTDSGTTEFHNVVVR  224

Query  229  ------DPNLIFDERILSQVPTYRGAYSQLLQVAIDVGIAEAAFSDLIS-TVKKARPIID  281
                   PN + +  + S   +  G   QL+   + +GIA  A       T  +ARP   
Sbjct  225  PDEVLGKPNAVVEAFLASGRGSLFGPIVQLVFATVYLGIARGALETAREYTRTQARPWTP  284

Query  282  AHVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDEL-DQLQQITEQQAAQASILVA  340
            A V +A  +P+T++  G+  + L A      EAA  L    D+   +T Q+  + ++ VA
Sbjct  285  AGVTQAVEDPYTIRSYGEFGIELQAGDAAAREAAQLLQTAWDKGDALTPQERGELAVQVA  344

Query  341  HAKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYL  400
              K  A  A L ++ ++ E+ G+R +   +  D+ WRN R HTLHDPV +KI  +GNY L
Sbjct  345  GVKAIATKAGLDVTSRIFEVIGARGTHPNYGFDRFWRNIRTHTLHDPVSYKIAEVGNYVL  404

Query  401  NGTLP  405
            N   P
Sbjct  405  NQRYP  409


> Q3HSE4 DBT monooxygenase [Rhodococcus sp. IIPS7]
Length=417

 Score =  153 bits (387),  Expect = 1e-44
 Identities = 100/364 (27%), Positives = 180/364 (49%), Gaps = 15/364 (4%)

Query  57   EIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLM  116
            E E     GL  + +P+ YGG      T  +V R +  AD SLG +    ++   +I+L+
Sbjct  48   EREDLHASGLLSLLVPREYGGWGADWPTAIEVVREIAAADGSLGHLFGYHLTNAPMIELI  107

Query  117  GTESQKQFIYSEILSGKRLANGGPEKNTKDSKTLQTTLT-LRNGEYYLDGEKFYSTGS--  173
            G++ Q++ +Y++I            +N       + + T   +G Y L+G K + +G+  
Sbjct  108  GSQEQEEHLYTQIAQNNWWTGNASSENNSHVLDWKVSATPTEDGGYVLNGTKHFCSGAKG  167

Query  174  ---IFAHWLAIKAIHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDP  230
               +F   +A      +G ++   +    +G+   +DW   G R T SG+   + VKV+P
Sbjct  168  SDLLFVFGVAQDDSPQQGAIIAAAIPTSRAGVTPNDDWAAIGMRQTDSGSTGFHNVKVEP  227

Query  231  NLIF---DERILSQVPTYRGAY----SQLLQVAIDVGIAEAAFSDLIS-TVKKARPIIDA  282
            + +    +  +L+ + + RG+     +QL+   + +GIA  A       T  +ARP   A
Sbjct  228  DEVLGAPNAFVLAFIQSERGSLFAPIAQLIFANVYLGIAHGALDAAREYTRTQARPWTPA  287

Query  283  HVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDEL-DQLQQITEQQAAQASILVAH  341
             +++A+ +P+T++  G+  + L  A     EAA  L  + D+   +T +   +  + V+ 
Sbjct  288  GIQQATEDPYTIRSYGEFTIALQGADAAAREAAHLLQTVWDKGDALTPEDRGELMVKVSG  347

Query  342  AKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLN  401
             K  A +AAL IS  + E+ G+R +  ++  D+ WRN R H+LHDPV +KI  +G + LN
Sbjct  348  VKALATNAALNISSGVFEVIGARGTYPRYGFDRFWRNVRTHSLHDPVSYKIADVGKHTLN  407

Query  402  GTLP  405
            G  P
Sbjct  408  GQYP  411


> B2CML6 Dibenzothiophene monooxygenase [Mycobacterium goodii]
Length=417

 Score =  151 bits (382),  Expect = 5e-44
 Identities = 99/364 (27%), Positives = 179/364 (49%), Gaps = 15/364 (4%)

Query  57   EIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLM  116
            E E     GL  + +P+ YGG      T  +V R +  AD SLG +    ++   +I+L+
Sbjct  48   EREDLRASGLLSLLVPREYGGWGTDWPTAIEVVREIAAADGSLGHLFGYHLTNAPMIELI  107

Query  117  GTESQKQFIYSEILSGKRLANGGPEKNTKDSKTLQTTLT-LRNGEYYLDGEKFYSTGS--  173
            G++ Q++ +Y++I            +N       + + T   +G Y L+G K + +G+  
Sbjct  108  GSQEQEEHLYTQIAQNNWWTGNASSENNSHVLDWKVSATPTEDGGYVLNGTKHFCSGAKG  167

Query  174  ---IFAHWLAIKAIHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDP  230
               +F   +       +G ++   +    +G+   +DW   G R T SG+   + VKV+P
Sbjct  168  SDLLFVFGVVQDDSPQQGAIIAAAIPTSRAGVTPNDDWAAIGMRQTDSGSTDFHNVKVEP  227

Query  231  NLIF---DERILSQVPTYRGAY----SQLLQVAIDVGIAEAAFSDLIS-TVKKARPIIDA  282
            + +    +  +L+ + + RG+     +QL+   + +GIA  A       T  +ARP   A
Sbjct  228  DEVLGAPNAFVLAFIQSERGSLFAPIAQLIFANVYLGIAHGALDAAREYTRTQARPWTPA  287

Query  283  HVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDEL-DQLQQITEQQAAQASILVAH  341
             +++A+ +P+T++  G+  + L  A     EAA  L  + D+   +T +   +  + V+ 
Sbjct  288  GIQQATEDPYTIRSYGEFTIALQGADAAAREAAHLLQTVWDKGDALTPEDRGELMVKVSG  347

Query  342  AKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLN  401
             K  A +AAL IS  + E+ G+R +  ++  D+ WRN R H+LHDPV +KI  +G + LN
Sbjct  348  VKALATNAALNISSGVFEVIGARGTHPRYGFDRFWRNVRTHSLHDPVSYKIADVGKHTLN  407

Query  402  GTLP  405
            G  P
Sbjct  408  GQYP  411


> Q64F43 DszC [Rhodococcus erythropolis]
Length=417

 Score =  151 bits (382),  Expect = 5e-44
 Identities = 99/364 (27%), Positives = 179/364 (49%), Gaps = 15/364 (4%)

Query  57   EIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLM  116
            E E     GL  + +P+ YGG      T  +V R +  AD SLG +    ++   +I+L+
Sbjct  48   EREDLRASGLLSLLVPREYGGWGADWPTAIEVVREIAAADGSLGHLFGYHLTNAPMIELI  107

Query  117  GTESQKQFIYSEILSGKRLANGGPEKNTKDSKTLQTTLT-LRNGEYYLDGEKFYSTGS--  173
            G++ Q++ +Y++I            +N       + + T   +G Y L+G K + +G+  
Sbjct  108  GSQEQEEHLYTQIAQNNWWTGNASSENNSHVLDWKVSATPTEDGGYVLNGTKHFCSGAKG  167

Query  174  ---IFAHWLAIKAIHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDP  230
               +F   +       +G ++   +    +G+   +DW   G R T SG+   + VKV+P
Sbjct  168  SDLLFVFGVVQDDSPQQGAIIAAAIPTSRAGVTPNDDWAAIGMRQTDSGSTDFHNVKVEP  227

Query  231  NLIF---DERILSQVPTYRGAY----SQLLQVAIDVGIAEAAFSDLIS-TVKKARPIIDA  282
            + +    +  +L+ + + RG+     +QL+   + +GIA  A       T  +ARP   A
Sbjct  228  DEVLGAPNAFVLAFIQSERGSLFAPIAQLIFANVYLGIAHGALDAAREYTRTQARPWTPA  287

Query  283  HVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDEL-DQLQQITEQQAAQASILVAH  341
             +++A+ +P+T++  G+  + L  A     EAA  L  + D+   +T +   +  + V+ 
Sbjct  288  GIQQATEDPYTIRSYGEFTIALQGADAAAREAAHLLQTVWDKGDALTPEDRGELMVKVSG  347

Query  342  AKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLN  401
             K  A +AAL IS  + E+ G+R +  ++  D+ WRN R H+LHDPV +KI  +G + LN
Sbjct  348  VKALATNAALNISSGVFEVIGARGTHPRYGFDRFWRNVRTHSLHDPVSYKIADVGKHTLN  407

Query  402  GTLP  405
            G  P
Sbjct  408  GQYP  411


> Q6WNP1 Dibenzothiophene desulfurization enzyme C [Rhodococcus 
sp. XP]
Length=417

 Score =  151 bits (382),  Expect = 5e-44
 Identities = 99/364 (27%), Positives = 179/364 (49%), Gaps = 15/364 (4%)

Query  57   EIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLM  116
            E E     GL  + +P+ YGG      T  +V R +  AD SLG +    ++   +I+L+
Sbjct  48   EREDLRASGLLSLLVPREYGGWGADWPTAIEVVREIAAADGSLGHLFGYHLTNAPMIELI  107

Query  117  GTESQKQFIYSEILSGKRLANGGPEKNTKDSKTLQTTLT-LRNGEYYLDGEKFYSTGS--  173
            G++ Q++ +Y++I            +N       + + T   +G Y L+G K + +G+  
Sbjct  108  GSQEQEEHLYTQIAQNNWWTGNASSENNSHVLDWKVSATPTEDGGYVLNGTKHFCSGAKG  167

Query  174  ---IFAHWLAIKAIHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDP  230
               +F   +       +G ++   +    +G+   +DW   G R T SG+   + VKV+P
Sbjct  168  SDLLFVFGVVQDDSPQQGAIIAAAIPTSRAGVTPNDDWAAIGMRQTDSGSTDFHNVKVEP  227

Query  231  NLIF---DERILSQVPTYRGAY----SQLLQVAIDVGIAEAAFSDLIS-TVKKARPIIDA  282
            + +    +  +L+ + + RG+     +QL+   + +GIA  A       T  +ARP   A
Sbjct  228  DEVLGAPNAFVLAFIQSERGSLFAPIAQLIFANVYLGIAHGALDAAREYTRTQARPWTPA  287

Query  283  HVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDEL-DQLQQITEQQAAQASILVAH  341
             +++A+ +P+T++  G+  + L  A     EAA  L  + D+   +T +   +  + V+ 
Sbjct  288  GIQQATEDPYTIRSYGEFTIALQGADAAAREAAHLLQTVWDKGDALTPEDRGELMVKVSG  347

Query  342  AKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLN  401
             K  A +AAL IS  + E+ G+R +  ++  D+ WRN R H+LHDPV +KI  +G + LN
Sbjct  348  VKALATNAALNISSGVFEVIGARGTHPRYGFDRFWRNVRTHSLHDPVSYKIADVGKHTLN  407

Query  402  GTLP  405
            G  P
Sbjct  408  GQYP  411


> Q65YX1 Acyl-CoA dehydrogenase-family protein [Pseudomonas putida]
Length=412

 Score =  150 bits (380),  Expect = 9e-44
 Identities = 110/371 (30%), Positives = 176/371 (47%), Gaps = 10/371 (3%)

Query  42   EGRNVRDQQRILPFEEIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQ  101
            EG   R++ R LPFE I      G G +R+P  +GGA  S   L Q+   L +ADS++ Q
Sbjct  32   EGSVERERTRSLPFEPIRWLKEAGFGAVRVPVEHGGAGASLPQLFQLLIELAEADSNVPQ  91

Query  102  IPQNQISLLHLIDLMGTESQKQFIYSEILSGKRLANGGPEKNTKDSKTLQTTLTLRNGEY  161
              +   + +         + +   +   + G  +     E  +     + T ++ +  ++
Sbjct  92   ALRGHFAFVEDRLNAHASAAQDVWFKRFVEGDLVGCAWTEVGSVKIGDVITRVSRKGDKW  151

Query  162  YLDGEKFYSTGSIFAHWLAIKAIHPK-GHVVLVVVEHDSSGIEIINDWNGFGQRTTASGT  220
             ++G K+YSTGS+F+ W+ + A     G  V+  +     GI   +DW+GFGQRTT SGT
Sbjct  152  VVNGTKYYSTGSLFSDWIDLFARRDDTGGDVIAAIRTRQPGITQSDDWDGFGQRTTGSGT  211

Query  221  VKLNQVKVDPNLIFDERILSQVPTYRGAYSQLLQVAIDVGIAEAAFSDLIS-TVKKARPI  279
                  +V+   I D     +   Y+ A+ QL+ +A+ VG   AA  D    T K+ R  
Sbjct  212  SVFENAEVEEENIIDFATRFK---YQTAFYQLVLLAVIVGSGRAALRDFSQETRKRTRVF  268

Query  280  IDAHVEKASLEPFTLQETGKLNVLL---DAAILLLDEAAD--YLDELDQLQQITEQQAAQ  334
               +    S +P  LQ  GK   L+   +A  L   EAA   YL      +    Q    
Sbjct  269  SHGNAPAVSQDPQVLQVIGKACALVYAAEAGTLRATEAAQQAYLARFGHDEAAERQANIA  328

Query  335  ASILVAHAKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHA  394
            A +  A A+V A +  L+ +  L    G+ ++ +   LD+HWRNAR   +H+PV +K   
Sbjct  329  AELESAQAQVAAVELVLRATSDLFNTLGASSTSTTKQLDRHWRNARTAAVHNPVIYKERI  388

Query  395  IGNYYLNGTLP  405
            IG++++NGT P
Sbjct  389  IGDWHVNGTEP  399


> A0A0C6DRW4 DszC protein [Rhodococcus erythropolis]
Length=417

 Score =  150 bits (380),  Expect = 9e-44
 Identities = 99/364 (27%), Positives = 178/364 (49%), Gaps = 15/364 (4%)

Query  57   EIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLM  116
            E E     GL  + +P+ YGG      T  +V R +  AD SLG +    ++   +I+L+
Sbjct  48   EREDLRASGLLSLLVPREYGGWGADWPTAIEVVREIAAADGSLGHLFGYHLTNAPMIELI  107

Query  117  GTESQKQFIYSEILSGKRLANGGPEKNTKDSKTLQTTLT-LRNGEYYLDGEKFYSTGS--  173
            G++ Q++ +Y++I            +N       +   T   +G Y L+G K + +G+  
Sbjct  108  GSQEQEEHLYTQIAQNNWWTGNASSENNSHVLDWKVRATPTEDGGYVLNGTKHFCSGAKG  167

Query  174  ---IFAHWLAIKAIHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDP  230
               +F   +       +G ++   +    +G+   +DW   G R T SG+   + VKV+P
Sbjct  168  SDLLFVFGVVQDDSPQQGAIIAAAIPTSRAGVTPNDDWAAIGMRQTDSGSTDFHNVKVEP  227

Query  231  NLIF---DERILSQVPTYRGAY----SQLLQVAIDVGIAEAAFSDLIS-TVKKARPIIDA  282
            + +    +  +L+ + + RG+     +QL+   + +GIA  A       T  +ARP   A
Sbjct  228  DEVLGAPNAFVLAFIQSERGSLFAPIAQLIFANVYLGIAHGALDAAREYTRTQARPWTPA  287

Query  283  HVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDEL-DQLQQITEQQAAQASILVAH  341
             +++A+ +P+T++  G+  + L  A     EAA  L  + D+   +T +   +  + V+ 
Sbjct  288  GIQQATEDPYTIRSYGEFTIALQGADAAAREAAHLLQTVWDKGDALTPEDRGELMVKVSG  347

Query  342  AKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLN  401
             K  A +AAL IS  + E+ G+R +  ++  D+ WRN R H+LHDPV +KI  +G + LN
Sbjct  348  VKALATNAALNISSGVFEVIGARGTHPRYGFDRFWRNVRTHSLHDPVSYKIADVGKHTLN  407

Query  402  GTLP  405
            G  P
Sbjct  408  GQYP  411


> Q0ZIH5 DszC [Rhodococcus sp. DS-3]
Length=417

 Score =  148 bits (374),  Expect = 6e-43
 Identities = 98/364 (27%), Positives = 178/364 (49%), Gaps = 15/364 (4%)

Query  57   EIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLM  116
            E E      L  + +P+ YGG      T  +V R +  AD SLG +    ++   +I+L+
Sbjct  48   EREDLRASALLSLLVPREYGGWGADWPTAIEVVREIAAADGSLGHLFGYHLTNAPMIELI  107

Query  117  GTESQKQFIYSEILSGKR-LANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGS--  173
            G++ Q++ +Y++I        N   E N+ +     +     +G Y L+G K + +G+  
Sbjct  108  GSQEQEEHLYTQIAQNNWWTGNASSENNSHELDVKVSATPTEDGGYVLNGTKHFCSGAKG  167

Query  174  ---IFAHWLAIKAIHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDP  230
               +F   +       +G ++   +    +G+   +DW   G R T SG+   + VKV+P
Sbjct  168  SDLLFVFGVVQDDSPQQGAIIAAAIPTSRAGVTPNDDWAAIGMRQTDSGSTDFHNVKVEP  227

Query  231  NLIF---DERILSQVPTYRGAY----SQLLQVAIDVGIAEAAFSDLIS-TVKKARPIIDA  282
            + +    +  +L+ + + RG+     +QL+   + +GIA  A       T  +ARP   A
Sbjct  228  DEVLGAPNAFVLAFIQSERGSLFRPIAQLIFANVYLGIAHGALDAAREYTRTQARPWTPA  287

Query  283  HVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDEL-DQLQQITEQQAAQASILVAH  341
             +++A+ +P+T++  G+  + L  A     EAA  +  + D+   +T +   +    V+ 
Sbjct  288  GIQQATEDPYTIRSYGEFTIALQGADAAAREAAHLVQTVWDKGDALTPEDRGELMAKVSG  347

Query  342  AKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLN  401
             K  A +AAL IS  + E+ G+R +  ++  D+ WRN R H+LHDPV +KI  +G + LN
Sbjct  348  VKSLATNAALNISSGVFEVIGARGTHPRYGFDRFWRNVRTHSLHDPVSYKIADVGKHTLN  407

Query  402  GTLP  405
            G  P
Sbjct  408  GQYP  411



Lambda      K        H        a         alpha
   0.319    0.135    0.385    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2721960


  Database: 79f68e2f8dd6e3b49443e4e441a96d2d.TrEMBL.fasta
    Posted date:  Sep 21, 2020  5:05 AM
  Number of letters in database: 8,653
  Number of sequences in database:  21



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40