ACIAD2064 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 85490aad8b8ef4e898ca2cf36c63d01c.SwissProt.fasta
           11 sequences; 4,818 total letters



Query= ACIAD2064

Length=412
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P54998 Dibenzothiophene desulfurization enzyme C [Rhodococcus s...   151    3e-44
  Q845S8 Probable FMNH2-dependent monooxygenase SfnC [Pseudomonas...   142    5e-41
  O34421 Probable acyl-CoA dehydrogenase YngJ [Bacillus subtilis ...  73.2    2e-17
  P96608 Putative acyl-CoA dehydrogenase YdbM [Bacillus subtilis ...  65.9    4e-15
  Q8JZN5 Complex I assembly factor ACAD9, mitochondrial [Mus musc...  62.8    6e-14
  P52042 Acyl-CoA dehydrogenase, short-chain specific [Clostridiu...  61.6    9e-14
  P45954 Short/branched chain specific acyl-CoA dehydrogenase, mi...  61.6    1e-13
  Q0NXR6 Isobutyryl-CoA dehydrogenase, mitochondrial [Bos taurus]     57.0    3e-12
  Q9H845 Complex I assembly factor ACAD9, mitochondrial [Homo sap...  57.0    4e-12
  P46703 Probable acyl-CoA dehydrogenase fadE25 [Mycobacterium le...  56.2    5e-12
  Q06319 Acyl-CoA dehydrogenase, short-chain specific [Megasphaer...  55.5    9e-12


> P54998 Dibenzothiophene desulfurization enzyme C [Rhodococcus 
sp. (strain IGTS8)]
Length=417

 Score =  151 bits (382),  Expect = 3e-44
 Identities = 99/364 (27%), Positives = 179/364 (49%), Gaps = 15/364 (4%)

Query  57   EIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLM  116
            E E     GL  + +P+ YGG      T  +V R +  AD SLG +    ++   +I+L+
Sbjct  48   EREDLRASGLLSLLVPREYGGWGADWPTAIEVVREIAAADGSLGHLFGYHLTNAPMIELI  107

Query  117  GTESQKQFIYSEILSGKRLANGGPEKNTKDSKTLQTTLT-LRNGEYYLDGEKFYSTGS--  173
            G++ Q++ +Y++I            +N       + + T   +G Y L+G K + +G+  
Sbjct  108  GSQEQEEHLYTQIAQNNWWTGNASSENNSHVLDWKVSATPTEDGGYVLNGTKHFCSGAKG  167

Query  174  ---IFAHWLAIKAIHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDP  230
               +F   +       +G ++   +    +G+   +DW   G R T SG+   + VKV+P
Sbjct  168  SDLLFVFGVVQDDSPQQGAIIAAAIPTSRAGVTPNDDWAAIGMRQTDSGSTDFHNVKVEP  227

Query  231  NLIF---DERILSQVPTYRGAY----SQLLQVAIDVGIAEAAFSDLIS-TVKKARPIIDA  282
            + +    +  +L+ + + RG+     +QL+   + +GIA  A       T  +ARP   A
Sbjct  228  DEVLGAPNAFVLAFIQSERGSLFAPIAQLIFANVYLGIAHGALDAAREYTRTQARPWTPA  287

Query  283  HVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDEL-DQLQQITEQQAAQASILVAH  341
             +++A+ +P+T++  G+  + L  A     EAA  L  + D+   +T +   +  + V+ 
Sbjct  288  GIQQATEDPYTIRSYGEFTIALQGADAAAREAAHLLQTVWDKGDALTPEDRGELMVKVSG  347

Query  342  AKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHDPVRWKIHAIGNYYLN  401
             K  A +AAL IS  + E+ G+R +  ++  D+ WRN R H+LHDPV +KI  +G + LN
Sbjct  348  VKALATNAALNISSGVFEVIGARGTHPRYGFDRFWRNVRTHSLHDPVSYKIADVGKHTLN  407

Query  402  GTLP  405
            G  P
Sbjct  408  GQYP  411


> Q845S8 Probable FMNH2-dependent monooxygenase SfnC [Pseudomonas 
putida]
Length=395

 Score =  142 bits (357),  Expect = 5e-41
 Identities = 111/380 (29%), Positives = 184/380 (48%), Gaps = 15/380 (4%)

Query  33   AYQVADFALEGRNVRDQQRILPFEEIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRIL  92
            A Q A  A+E    RD +   P  E +     GL  + IP+ +GG   S      V R  
Sbjct  20   AGQFAQTAVE----RDDRGGTPKAERDALRDSGLLSLVIPQAFGGQGASWHDTFAVVREF  75

Query  93   NKADSSLGQIPQNQISLLHLIDLMGTESQKQFIYSEILSGKRLANGGPEKNTKDSKTLQT  152
             + DSS+  +      +L  + L     Q Q  + +  + ++    G   N  D++T+  
Sbjct  76   ARVDSSIAHVFGFHHLMLATVRLFSRPDQWQPWFEQ--TARKQWFWGNALNPLDTRTVVK  133

Query  153  TLTLRNGEYYLDGEKFYSTGSIFAHWLAIKAIHPK--GHVVLVVVEHDSSGIEIINDWNG  210
                 +G     G+K + +G+  +  L   A+  +  G +++  +    +GI + NDWN 
Sbjct  134  HF---DGWCEFSGKKSFCSGASDSEMLIASAVDERAGGKLLIAAIPSGRTGISLHNDWNN  190

Query  211  FGQRTTASGTVKLNQVKVDPN-LIFDERILSQ-VPTYRGAYSQLLQVAIDVGIAEAAFSD  268
             GQR T SG+    +V+V+ N L+ D   LS      R   +QL    + +GIAE AF +
Sbjct  191  IGQRQTDSGSATFERVRVEHNELLLDPGPLSTPFAALRPLIAQLHFANLFLGIAEGAFEE  250

Query  269  LIS-TVKKARPIIDAHVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDELDQLQQ-  326
                T+K++RP   +    ++ +P+ L+  G+  V L++  LL++ AA  LD     +  
Sbjct  251  ARQYTLKESRPWFRSSAASSAEDPYVLRHYGEFWVGLESVRLLIERAARQLDAAWAKEHA  310

Query  327  ITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHD  386
            +T Q+    ++ +  AKV A+   L I  +L E+ G+RA+ +    D+HWRN R  TLHD
Sbjct  311  LTAQERGDLALAIGTAKVAASRHGLDICNRLFEVTGARATHASLRFDRHWRNLRTQTLHD  370

Query  387  PVRWKIHAIGNYYLNGTLPA  406
            PV ++IH +G + LN   PA
Sbjct  371  PVDYRIHELGEWALNDKRPA  390


> O34421 Probable acyl-CoA dehydrogenase YngJ [Bacillus subtilis 
(strain 168)]
Length=380

 Score = 73.2 bits (178),  Expect = 2e-17
 Identities = 80/347 (23%), Positives = 150/347 (43%), Gaps = 32/347 (9%)

Query  48   DQQRILPFEEIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQI  107
            DQ    P +  ++    GL GI  P+ YGG+     + A     + KA  S G      +
Sbjct  32   DQTGEFPMQTFKKMGELGLMGIPFPEEYGGSGGDTISYALAVEEVGKACGSTGLSYAAAV  91

Query  108  SL-LHLIDLMGTESQKQFIYSEILSGKRLANGG-PEKNT-KDSKTLQTTLTLRNGEYYLD  164
            SL    +   GTE QKQ   + + SG  L + G  E N   D+   QT       EY ++
Sbjct  92   SLGASPLYYFGTEEQKQTHLTPLASGTALGSFGLTEPNAGSDAGGTQTKAISNGDEYVIN  151

Query  165  GEKFYSTGSIFAHWLAIKAIHPKGH-----VVLVVVEHDSSGIEIINDWNGFGQRTTASG  219
            GEK + T + +A  + + A+  K       +  ++V  D+ G+ I + ++  G R + + 
Sbjct  152  GEKCWITNASYARTVIVTAVTGKNKDGKNIISALIVPTDTPGLTITSPYDKMGVRGSNTA  211

Query  220  TVKLNQVKVD-PNLIFDERILSQVPTYRGAYSQLLQVAIDVGIAEAAFSDLISTVKK---  275
             + L  V+V   NL+ D     +   Y     ++   A+ VGIA+AA    ++  K+   
Sbjct  212  EILLEDVRVPAANLLGDPTKGFKQFLYTLDGGRISIAALAVGIAQAALDASLAYAKERKQ  271

Query  276  -ARPIIDAHVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDELDQLQQITEQQAAQ  334
              +PI      +  L    ++      ++L AA L            D  +  T++    
Sbjct  272  FGQPISSFQAIQFKLADMAMEIDLARQMVLKAAWL-----------KDHNRPFTKE----  316

Query  335  ASILVAHAKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARV  381
                 A+AK++A++ A +   + +++ G    + ++ +++  R+A++
Sbjct  317  ----AAYAKLFASEMATRACNQAIQIHGGSGYMKEYGVERMLRDAKL  359


> P96608 Putative acyl-CoA dehydrogenase YdbM [Bacillus subtilis 
(strain 168)]
Length=381

 Score = 65.9 bits (159),  Expect = 4e-15
 Identities = 84/375 (22%), Positives = 158/375 (42%), Gaps = 25/375 (7%)

Query  23   IKNDQQA--INAAYQVADFALEGRNVRDQQRILPFEEIEQFSLKGLGGIRIPKRYGGAFI  80
            I+NDQQ   +    ++AD   +     D+Q   P E+I++    G   + +P  +GG  I
Sbjct  5    IQNDQQRQWMEKIGRIADEFQQTAAEDDEQGRFPAEKIQKLRDAGYTALTLPASHGGGGI  64

Query  81   SNKTLAQVFRILNKADSSLGQIPQNQISLLHLIDLMGT--ESQKQFIYSEILSGKRLANG  138
            S   +      L + D+         +S++  +    +  E    F+  E+ +G  +   
Sbjct  65   SVYDMLLFQERLARGDAPTALSIGWHLSVIGELGEGNSWDEDVFAFVAKEVQNGAVINRA  124

Query  139  GPEKNTKDSKT---LQTTLTLRNGEYYLDGEKFYSTGSIFAHWLAIKA-IHPKGHVVLVV  194
              E  T          T    ++G++ ++G K ++T S    +  + A I  K    + +
Sbjct  125  ATEAKTGSPTRGGRPGTHAVKKDGKWAVNGRKTFTTMSQALDYFLVTAWIEDKQTTGVFL  184

Query  195  VEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLIFDERILSQVPTYRGAYSQLLQ  254
            +  D  G+ I   W+    R T S  + LN+V +D N + +   L Q P        LL 
Sbjct  185  IHKDDPGLSIEETWDMMAMRATGSHDLVLNEVMLDENKLVE---LLQGPRGAKPNGWLLH  241

Query  255  V-AIDVGIAEAAFSDLISTVKKARP-IIDAHVEKASLEPFTLQETGKLNVLLDAAILLLD  312
            + AI +G+A+AA    +    +  P  ++  ++     P   Q TG++ + L  A   L 
Sbjct  242  IPAIYLGVAQAARDYAVQFASEYSPNSLNGPIKNV---PAVQQRTGEMELELLNARHFLF  298

Query  313  EAADYLDELDQLQQITEQQAAQASILVAHAKVYANDAALQISEKLLELGGSRASLSQFNL  372
              A   D+  +   +T +  A        AK    +AAL + +K + + G+++      L
Sbjct  299  HIAQLYDDPVRRPHLTSELGA--------AKHIVTNAALSVVDKAMRIVGAKSLERTNPL  350

Query  373  DQHWRNARVHTLHDP  387
             +++R+ R   LH+P
Sbjct  351  QRYYRDVRA-GLHNP  364


> Q8JZN5 Complex I assembly factor ACAD9, mitochondrial [Mus musculus]
Length=625

 Score = 62.8 bits (151),  Expect = 6e-14
 Identities = 81/351 (23%), Positives = 151/351 (43%), Gaps = 34/351 (10%)

Query  48   DQQRILPFEEIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQI  107
            DQ+  +P + +E+    GL GI++P+ YGG  +SN   A++  I++   S    +  +Q 
Sbjct  92   DQEGKIPVDTLEKLKSLGLFGIQVPEEYGGLGLSNTMYARLGEIISLDASITVTLAAHQA  151

Query  108  SLLHLIDLMGTESQKQFIYSEILSGKRLANG--GPEKNTKDSKTLQTTLTLRNGEYY--L  163
              L  I L+G E QK     ++ SG+ +A        +  D+ ++QT  TL   + Y  L
Sbjct  152  IGLKGIILVGNEEQKAKYLPKLSSGEHIAAFCLTEPASGSDAASIQTRATLSEDKKYFIL  211

Query  164  DGEKFYST----GSIFAHWLAIKAIHPKG----HVVLVVVEHDSSGIEIINDWNGFGQRT  215
            +G K + T     +IF  +   + +   G     +   +VE D  GI      +  G R 
Sbjct  212  NGSKVWITNGGLANIFTVFAKTEVVDSDGSKTDKMTAFIVERDFGGITNGKPEDKLGIRG  271

Query  216  TASGTVKLNQVKVDPNLIFDERILSQVPTYRGAYSQLLQVAIDVGIAEAAFSDLISTVKK  275
            + +  V     +V       E +L +V    G +    +VA+++ +    FS   +    
Sbjct  272  SNTCEVHFENTRVPV-----ENVLGEV---GGGF----KVAMNI-LNSGRFSMGSAVAGM  318

Query  276  ARPIIDAHVEKASLEP---FTLQETGKLNVLLDAAILLLDEAADYLDELDQLQ--QITEQ  330
             + +I+   E A         L E G    L+     L+ + A  ++ +  L    + + 
Sbjct  319  LKKLIELTAEYACTRKQFNRNLSEFG----LIQEKFALMAQKAYVMESMAYLTSGMLDQP  374

Query  331  QAAQASILVAHAKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARV  381
                 SI  A  KV++++AA Q   + L++ G    +  +  ++  R+AR+
Sbjct  375  GFPDCSIEAAMVKVFSSEAAWQCVSEALQILGGSGYMKDYPYERMLRDARI  425


> P52042 Acyl-CoA dehydrogenase, short-chain specific [Clostridium 
acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 
5710 / VKM B-1787)]
Length=379

 Score = 61.6 bits (148),  Expect = 9e-14
 Identities = 86/353 (24%), Positives = 151/353 (43%), Gaps = 35/353 (10%)

Query  48   DQQRILPFEEIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRI--LNKADSSLGQIPQN  105
            D+    P E +++    G+ GI   K YGGA      L+ +  +  L+K   + G I   
Sbjct  32   DETERFPMENVKKMGQYGMMGIPFSKEYGGA--GGDVLSYIIAVEELSKVCGTTGVILSA  89

Query  106  QISL-LHLIDLMGTESQKQFIYSEILSGKRL-ANGGPEKNT-KDSKTLQTTLTLRNGEYY  162
              SL   LI+  GTE QKQ     +  G+++ A G  E N   DS   QT   L    Y 
Sbjct  90   HTSLCASLINEHGTEEQKQKYLVPLAKGEKIGAYGLTEPNAGTDSGAQQTVAVLEGDHYV  149

Query  163  LDGEKFYSTGSIFAHWLAIKAI--HPKG--HVVLVVVEHDSSGIEIINDWNGFGQRTTAS  218
            ++G K + T    A    I A+    KG   +   ++E    G  I       G R  AS
Sbjct  150  INGSKIFITNGGVADTFVIFAMTDRTKGTKGISAFIIEKGFKGFSIGKVEQKLGIR--AS  207

Query  219  GTVKL---NQVKVDPNLIFDERILSQVPTYRGAYSQLLQVAIDVGIAEAAFSDLISTVKK  275
             T +L   + +    N+I  E     +        ++   A  +GIAE AF++  + +K+
Sbjct  208  STTELVFEDMIVPVENMIGKEGKGFPIAMKTLDGGRIGIAAQALGIAEGAFNEARAYMKE  267

Query  276  ARPIIDAHVEKASLEPF--TLQETGKLNVLLDAAILLLDEAADYLDELDQLQQITEQQAA  333
             +          SL+ F         ++V +++A  L+ +AA YL          +Q   
Sbjct  268  RKQF------GRSLDKFQGLAWMMADMDVAIESARYLVYKAA-YL----------KQAGL  310

Query  334  QASILVAHAKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHD  386
              ++  A AK++A + A+ ++ K ++L G       + +++  R+A++  +++
Sbjct  311  PYTVDAARAKLHAANVAMDVTTKAVQLFGGYGYTKDYPVERMMRDAKITEIYE  363


> P45954 Short/branched chain specific acyl-CoA dehydrogenase, 
mitochondrial [Homo sapiens]
Length=432

 Score = 61.6 bits (148),  Expect = 1e-13
 Identities = 83/339 (24%), Positives = 146/339 (43%), Gaps = 40/339 (12%)

Query  64   KGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQISLLH-LIDLMGTESQK  122
            +GL GI +   YGG   S  +   V   L K D+S+    + Q +L++ LI   GTE QK
Sbjct  100  QGLMGIEVDPEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQNTLINTLIRKHGTEEQK  159

Query  123  QFIYSEILSGK----RLANGGPEKNTKDSKTLQTTLTLRNGEYYLDGEKFYSTGSIFAHW  178
                 ++ + K     L+  G      DS  L+T        Y L+G K + + +  A  
Sbjct  160  ATYLPQLTTEKVGSFCLSEAGA---GSDSFALKTRADKEGDYYVLNGSKMWISSAEHAGL  216

Query  179  LAIKA-----IHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTVKLNQVKVDPNLI  233
              + A     I  KG +   +V+ D+ G+ I    N  G R +++  +    VKV     
Sbjct  217  FLVMANVDPTIGYKG-ITSFLVDRDTPGLHIGKPENKLGLRASSTCPLTFENVKVP----  271

Query  234  FDERILSQV-PTYRGAYSQLLQVAIDV-----GIAEAAFSDLISTVKKARPIIDAHVEKA  287
             +  IL Q+   Y+ A   L +  I +     G+A+  F   I  +K+         +  
Sbjct  272  -EANILGQIGHGYKYAIGSLNEGRIGIAAQMLGLAQGCFDYTIPYIKERIQFGKRLFDFQ  330

Query  288  SLEPFTLQETGKLNVLLDAAILLLDEAADYLDELDQLQQITEQQAAQASILVAHAKVYAN  347
             L+     +   +   L+AA LL   AA       +L +  +    +AS+    AK YA+
Sbjct  331  GLQ----HQVAHVATQLEAARLLTYNAA-------RLLEAGKPFIKEASM----AKYYAS  375

Query  348  DAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHD  386
            + A Q + K +E  G       + +++++R+A++ T+++
Sbjct  376  EIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYE  414


> Q0NXR6 Isobutyryl-CoA dehydrogenase, mitochondrial [Bos taurus]
Length=416

 Score = 57.0 bits (136),  Expect = 3e-12
 Identities = 75/345 (22%), Positives = 139/345 (40%), Gaps = 24/345 (7%)

Query  48   DQQRILPFEEIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQI  107
            DQ+ + P + + + +  G GG+ +    GGA +S    + +F  L    +S         
Sbjct  69   DQKELFPVDTMRKAAQLGFGGVYVQTDVGGAGLSRLDTSIIFEALATGCTSTTAYMSIHN  128

Query  108  SLLHLIDLMGTESQKQFIYSEILSGKRLANG--GPEKNTKDSKTLQTTLTLRNGEYYLDG  165
              + +ID  G+E Q+  +   + + ++ A+       +  D+ +L T+   ++  Y L+G
Sbjct  129  MCVWIIDRFGSEEQRHRLCPPLCTMEKFASYCLTEPGSGSDAASLMTSAVRQHDHYILNG  188

Query  166  EKFYSTG----SIFAHWLAIKAIHPKGHVVLVVVEHDSSGIEIINDWNGFGQRTTASGTV  221
             K + +G     I+          P+G +  VVVE  + G+         G  +  +  V
Sbjct  189  SKAFISGGGEADIYVVMCRTGGPGPRG-ISCVVVEKGTPGLSFGKKEKKVGWNSQPTQAV  247

Query  222  KLNQVKVD-PNLIFDERILSQVPTYRGAYSQLLQVA-IDVGIAEAAFSDLISTVKKARPI  279
                  V   N I DE     +   +G     + VA   +G A A+   L     K R  
Sbjct  248  IFEDCAVPVANRIGDEG-QGFLIAMKGLNGGRINVASCSLGAAHASIV-LARDYLKVRKQ  305

Query  280  IDAHVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDELDQLQQITEQQAAQASILV  339
                +  +    F L +   +   L A+ L++  AA  L E          +   A +L 
Sbjct  306  FGEPLANSQYLQFQLAD---MAARLVASRLMIRTAATALQE----------EREDAIVLC  352

Query  340  AHAKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTL  384
            + AK++A D    I  + L++ G    L  + + Q+ R++RVH +
Sbjct  353  SMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQI  397


> Q9H845 Complex I assembly factor ACAD9, mitochondrial [Homo sapiens]
Length=621

 Score = 57.0 bits (136),  Expect = 4e-12
 Identities = 81/333 (24%), Positives = 143/333 (43%), Gaps = 35/333 (11%)

Query  48   DQQRILPFEEIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQNQI  107
            DQ+  +P E +E+    GL G+++P+ YGG   SN   +++  I++   S    +  +Q 
Sbjct  88   DQEGKIPDETLEKLKSLGLFGLQVPEEYGGLGFSNTMYSRLGEIISMDGSITVTLAAHQA  147

Query  108  SLLHLIDLMGTESQKQFIYSEILSGKRLANG--GPEKNTKDSKTLQTTLTLRNGE--YYL  163
              L  I L GTE QK     ++ SG+ +A        +  D+ ++++  TL   +  Y L
Sbjct  148  IGLKGIILAGTEEQKAKYLPKLASGEHIAAFCLTEPASGSDAASIRSRATLSEDKKHYIL  207

Query  164  DGEKFYST----GSIFAHWLAIKAIHPKGHV----VLVVVEHDSSGIEIINDWNGFGQRT  215
            +G K + T     +IF  +   + +   G V       +VE D  G+      +  G R 
Sbjct  208  NGSKVWITNGGLANIFTVFAKTEVVDSDGSVKDKITAFIVERDFGGVTNGKPEDKLGIRG  267

Query  216  TASGTVKLNQVKVDPNLIFDERILSQVPTYRGAYSQLLQVAIDVGIAEAAFSDLISTVKK  275
            + +  V     K+       E IL +V           +VA+++ +    FS        
Sbjct  268  SNTCEVHFENTKIPV-----ENILGEV-------GDGFKVAMNI-LNSGRFSMGSVVAGL  314

Query  276  ARPIIDAHVEKA-SLEPFT--LQETGKLNVLLDAAILLLDEAADYLDELDQLQ--QITEQ  330
             + +I+   E A + + F   L E G    L+     L+ + A  ++ +  L    + + 
Sbjct  315  LKRLIEMTAEYACTRKQFNKRLSEFG----LIQEKFALMAQKAYVMESMTYLTAGMLDQP  370

Query  331  QAAQASILVAHAKVYANDAALQ-ISEKLLELGG  362
                 SI  A  KV++++AA Q +SE L  LGG
Sbjct  371  GFPDCSIEAAMVKVFSSEAAWQCVSEALQILGG  403


> P46703 Probable acyl-CoA dehydrogenase fadE25 [Mycobacterium 
leprae (strain TN)]
Length=389

 Score = 56.2 bits (134),  Expect = 5e-12
 Identities = 72/351 (21%), Positives = 148/351 (42%), Gaps = 31/351 (9%)

Query  48   DQQRILPFEEIEQFSLKGLGGIRIPKRYGGAFISNKTLAQVFRILNKADSSLGQIPQ-NQ  106
            DQ+   P E +   +  G   I +P+ YGG    +     V   + + D+S   IP  N+
Sbjct  42   DQRARFPEEALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVNK  101

Query  107  ISLLHLIDLMGTESQKQFIYSEILSGKRLANGGPEKNT-KDSKTLQTTLTLRNGEYYLDG  165
            +  + LI     E +KQ + S    G   +    E+    D+ +++T       ++ L+G
Sbjct  102  LGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRAKADGDDWILNG  161

Query  166  EKFYSTGSIFAHWLAIKAI--HPKG--HVVLVVVEHDSSGIEIINDWNGFGQRTTASGTV  221
             K + T    + W  + A+    KG   +   +V  D  G  I       G + + +  +
Sbjct  162  FKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDEGFSIGPKEKKLGIKGSPTTEL  221

Query  222  KLNQVKVDPNLIFDERILSQVPT-YRGAYSQLLQV-----AIDVGIAEAAFSDLISTVKK  275
              ++ ++       +RI+ +  T ++ A + L        A  VGIA+ A    I   K 
Sbjct  222  YFDKCRIP-----GDRIIGEPGTGFKTALATLDHTRPTIGAQAVGIAQGALDAAIVYTKD  276

Query  276  ARPIIDAHVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDELDQLQQITEQQAAQA  335
             +   ++     S++ F L +   + + ++AA L++  AA             E+     
Sbjct  277  RKQFGESISTFQSIQ-FMLAD---MAMKVEAARLIVYAAA----------ARAERGEPDL  322

Query  336  SILVAHAKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHD  386
              + A +K +A+D A++++   ++L G     S F +++  R+A++  +++
Sbjct  323  GFISAASKCFASDIAMEVTTDAVQLFGGAGYTSDFPVERFMRDAKITQIYE  373


> Q06319 Acyl-CoA dehydrogenase, short-chain specific [Megasphaera 
elsdenii]
Length=383

 Score = 55.5 bits (132),  Expect = 9e-12
 Identities = 78/352 (22%), Positives = 153/352 (43%), Gaps = 27/352 (8%)

Query  47   RDQQRILPFEEIEQFSLKGLGGIRIPKRYGGAFISN-KTLAQVFRI--LNKADSSLGQIP  103
            RD + I   E I++    G+ G    ++YGG+       L+ +  +  L K D+ +    
Sbjct  31   RDHKGIYDKELIDELLSLGITGAYFEEKYGGSGDDGGDVLSYILAVEELAKYDAGVAITL  90

Query  104  QNQISLL-HLIDLMGTESQKQFIYSEILSGKRL-ANGGPEKNTKDSKTLQTTLTLRN--G  159
               +SL  + I   GTE+QK+     ++ G +L A G  E N     + Q T+  +N  G
Sbjct  91   SATVSLCANPIWQFGTEAQKEKFLVPLVEGTKLGAFGLTEPNAGTDASGQQTIATKNDDG  150

Query  160  EYYLDGEKFYSTGSIFAHWLAIKAIHPKGH----VVLVVVEHDSSGIEIINDWNGFGQRT  215
             Y L+G K + T    A    + A+  K      +   ++E  + G       +  G  T
Sbjct  151  TYTLNGSKIFITNGGAADIYIVFAMTDKSKGNHGITAFILEDGTPGFTYGKKEDKMGIHT  210

Query  216  TASGTVKLNQVKVDP-NLIFDERILSQVPTYRGAYSQLLQVAIDVGIAEAAFSDLISTVK  274
            + +  +    VKV   N++ +E    ++        ++   A  +GIAEAA +D +    
Sbjct  211  SQTMELVFQDVKVPAENMLGEEGKGFKIAMMTLDGGRIGVAAQALGIAEAALADAVE-YS  269

Query  275  KARPIIDAHVEKASLEPFTLQETGKLNVLLDAAILLLDEAADYLDELDQLQQITEQQAAQ  334
            K R      + K     F L +   + + ++AA  L+ +AA             +Q+   
Sbjct  270  KQRVQFGKPLCKFQSISFKLAD---MKMQIEAARNLVYKAA-----------CKKQEGKP  315

Query  335  ASILVAHAKVYANDAALQISEKLLELGGSRASLSQFNLDQHWRNARVHTLHD  386
             ++  A AK  A+D A++++ + +++ G      ++ + +H R+A++  +++
Sbjct  316  FTVDAAIAKRVASDVAMRVTTEAVQIFGGYGYSEEYPVARHMRDAKITQIYE  367



Lambda      K        H        a         alpha
   0.319    0.135    0.385    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561560


  Database: 85490aad8b8ef4e898ca2cf36c63d01c.SwissProt.fasta
    Posted date:  Sep 21, 2020  4:17 AM
  Number of letters in database: 4,818
  Number of sequences in database:  11



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40