ACIAD1919 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 9b2ee70120ca3af9a49bf40ba7af8364.TrEMBL.fasta
           11 sequences; 2,030 total letters



Query= ACIAD1919

Length=182
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FB16 LRAT domain-containing protein [Acinetobacter baylyi (st...   377    5e-138
  N9QQ23 LRAT domain-containing protein [Acinetobacter ursingii N...   311    4e-112
  A0A009YLV2 Lecithin retinol acyltransferase family protein [Aci...   311    4e-112
  N9BZJ6 LRAT domain-containing protein [Acinetobacter ursingii A...   307    1e-110
  N9AEM4 LRAT domain-containing protein [Acinetobacter soli NIPH ...   303    7e-109
  A0A0M1I759 Phosphatidylcholine--retinol O-acyltransferase [Acin...   303    7e-109
  A0A1P8EH48 Phosphatidylcholine--retinol O-acyltransferase [Acin...   300    6e-108
  A0A1H8LW28 Lecithin retinol acyltransferase [Acinetobacter sp. ...   294    3e-105
  D0S3E1 LRAT domain-containing protein [Acinetobacter calcoaceti...   294    4e-105
  A0A0A8XE54 LRAT domain-containing protein [Acinetobacter calcoa...   293    6e-105
  N9EKV1 LRAT domain-containing protein [Acinetobacter calcoaceti...   293    6e-105


> Q6FB16 LRAT domain-containing protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=181

 Score =  377 bits (967),  Expect = 5e-138
 Identities = 180/181 (99%), Positives = 181/181 (100%), Gaps = 0/181 (0%)

Query  1    LVLEHMQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQK  60
            +VLEHMQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQK
Sbjct  1    MVLEHMQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQK  60

Query  61   FSHGKKIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVV  120
            FSHGKKIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVV
Sbjct  61   FSHGKKIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVV  120

Query  121  KMMNRLTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHK  180
            KMMNRLTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHK
Sbjct  121  KMMNRLTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHK  180

Query  181  K  181
            K
Sbjct  181  K  181


> N9QQ23 LRAT domain-containing protein [Acinetobacter ursingii 
NIPH 706]
Length=176

 Score =  311 bits (796),  Expect = 4e-112
 Identities = 142/176 (81%), Positives = 163/176 (93%), Gaps = 0/176 (0%)

Query  6    MQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQKFSHGK  65
            MQ  IKR+PIG+HL++ HLGYSHHGIYAGRGRVIHYSG AHLFKKKPIEITTL++FSHGK
Sbjct  1    MQHSIKRFPIGSHLIVKHLGYSHHGIYAGRGRVIHYSGLAHLFKKKPIEITTLEQFSHGK  60

Query  66   KIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNR  125
            KIH+R Y  PKYKGR VVRRMRSR+HEN+YHLIINNCEHLCSWAITG+E+S QVVKMMNR
Sbjct  61   KIHVRYYHHPKYKGRVVVRRMRSRMHENYYHLIINNCEHLCSWAITGIESSPQVVKMMNR  120

Query  126  LTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHKK  181
            LTT+GY+SS+MSYMNS +LTIATTCFALVLYIKKKLRDKAKM++P  +FY ++HK+
Sbjct  121  LTTLGYISSMMSYMNSFYLTIATTCFALVLYIKKKLRDKAKMQMPTYLFYKQDHKE  176


> A0A009YLV2 Lecithin retinol acyltransferase family protein [Acinetobacter 
sp. 479375]
Length=176

 Score =  311 bits (796),  Expect = 4e-112
 Identities = 142/176 (81%), Positives = 163/176 (93%), Gaps = 0/176 (0%)

Query  6    MQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQKFSHGK  65
            MQ  IKR+PIG+HL++ HLGYSHHGIYAGRGRVIHYSG AHLFKKKPIEITTL++FSHGK
Sbjct  1    MQHSIKRFPIGSHLIVKHLGYSHHGIYAGRGRVIHYSGLAHLFKKKPIEITTLEQFSHGK  60

Query  66   KIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNR  125
            KIH+R Y  PKYKGR VVRRMRSR+HEN+YHLIINNCEHLCSWAITG+E+S QVVKMMNR
Sbjct  61   KIHVRYYHHPKYKGRVVVRRMRSRMHENYYHLIINNCEHLCSWAITGIESSPQVVKMMNR  120

Query  126  LTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHKK  181
            LTT+GY+SS+MSYMNS +LTIATTCFALVLYIKKKLRDKAKM++P  +FY ++HK+
Sbjct  121  LTTLGYISSMMSYMNSFYLTIATTCFALVLYIKKKLRDKAKMQMPTYLFYKQDHKE  176


> N9BZJ6 LRAT domain-containing protein [Acinetobacter ursingii 
ANC 3649]
Length=176

 Score =  307 bits (787),  Expect = 1e-110
 Identities = 140/176 (80%), Positives = 162/176 (92%), Gaps = 0/176 (0%)

Query  6    MQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQKFSHGK  65
            MQ  +KR+PIG+HL++ HLGYSHHGIYAGRGRVIHYSG AHLFKKKPIEITTL++FSHGK
Sbjct  1    MQHSVKRFPIGSHLIVKHLGYSHHGIYAGRGRVIHYSGLAHLFKKKPIEITTLEQFSHGK  60

Query  66   KIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNR  125
            KIH+R Y  PKYKGR VVRRMRSR+HEN+YHLIINNCEHLCSWAITG+E+S QVVKMMNR
Sbjct  61   KIHVRYYHHPKYKGRVVVRRMRSRMHENYYHLIINNCEHLCSWAITGIESSPQVVKMMNR  120

Query  126  LTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHKK  181
            LTT+GY+SS+MSYMNS +LTIATTC ALVLYIKKKLRDKAKM++P  +FY ++HK+
Sbjct  121  LTTLGYISSMMSYMNSFYLTIATTCSALVLYIKKKLRDKAKMQMPTYLFYKQDHKE  176


> N9AEM4 LRAT domain-containing protein [Acinetobacter soli NIPH 
2899]
Length=179

 Score =  303 bits (775),  Expect = 7e-109
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 0/175 (0%)

Query  6    MQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQKFSHGK  65
            MQ+  KRYPIG+HLV+YH GYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTL  FSHGK
Sbjct  1    MQRTNKRYPIGSHLVVYHFGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLSHFSHGK  60

Query  66   KIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNR  125
            KIH+R Y+  +YKGR VVRRMRSR+HENHYHLI+NNCEHLCSWAITG+E+S QVVKMMNR
Sbjct  61   KIHVRHYEHARYKGRIVVRRMRSRMHENHYHLILNNCEHLCSWAITGIEDSPQVVKMMNR  120

Query  126  LTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHK  180
            LTTIGY+SSIMSYMNS FLTIATTCFA+VLYIKKKLR++AKMK P  +   +E K
Sbjct  121  LTTIGYISSIMSYMNSFFLTIATTCFAIVLYIKKKLRERAKMKAPYHLLLKDEQK  175


> A0A0M1I759 Phosphatidylcholine--retinol O-acyltransferase [Acinetobacter 
sp. C15]
Length=179

 Score =  303 bits (775),  Expect = 7e-109
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 0/175 (0%)

Query  6    MQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQKFSHGK  65
            MQ+  KRYPIG+HLV+YH GYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTL  FSHGK
Sbjct  1    MQRTNKRYPIGSHLVVYHFGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLSHFSHGK  60

Query  66   KIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNR  125
            KIH+R Y+  +YKGR VVRRMRSR+HENHYHLI+NNCEHLCSWAITG+E+S QVVKMMNR
Sbjct  61   KIHVRHYEHARYKGRIVVRRMRSRMHENHYHLILNNCEHLCSWAITGIEDSPQVVKMMNR  120

Query  126  LTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHK  180
            LTTIGY+SSIMSYMNS FLTIATTCFA+VLYIKKKLR++AKMK P  +   +E K
Sbjct  121  LTTIGYISSIMSYMNSFFLTIATTCFAIVLYIKKKLRERAKMKAPYHLLLKDEQK  175


> A0A1P8EH48 Phosphatidylcholine--retinol O-acyltransferase [Acinetobacter 
soli]
Length=179

 Score =  300 bits (769),  Expect = 6e-108
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 0/175 (0%)

Query  6    MQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQKFSHGK  65
            MQ+  KRYPIG+HLV+YH GYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTL  FSHGK
Sbjct  1    MQRTNKRYPIGSHLVVYHFGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLSHFSHGK  60

Query  66   KIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNR  125
            KIH+R Y+  +YKGR VVRRMRSR+HENHYHLI+NNCEHLCSWAITG+E+S QVVKMMNR
Sbjct  61   KIHVRHYEHARYKGRIVVRRMRSRMHENHYHLILNNCEHLCSWAITGIEDSPQVVKMMNR  120

Query  126  LTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHK  180
            LTTIGY+SSIMSYMNS  LTIATTCFA+VLYIKKKLR++AKMK P  +   +E K
Sbjct  121  LTTIGYISSIMSYMNSFLLTIATTCFAIVLYIKKKLRERAKMKAPYHLLLKDEQK  175


> A0A1H8LW28 Lecithin retinol acyltransferase [Acinetobacter sp. 
yr461]
Length=196

 Score =  294 bits (753),  Expect = 3e-105
 Identities = 138/176 (78%), Positives = 155/176 (88%), Gaps = 0/176 (0%)

Query  6    MQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQKFSHGK  65
            MQQ  KRYP+GAHL++ HLGYSHHGIYAGRGRVIHYSG AH  KK+PIEIT++  FSHGK
Sbjct  1    MQQPNKRYPLGAHLIVRHLGYSHHGIYAGRGRVIHYSGLAHFIKKRPIEITSIDAFSHGK  60

Query  66   KIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNR  125
            KIHIR YD P+YKGR VVRRMRSR+HENHYHLIINNCEHLCSWAITGVE+S QV +MM+R
Sbjct  61   KIHIRSYDTPRYKGRAVVRRMRSRMHENHYHLIINNCEHLCSWAITGVESSTQVERMMHR  120

Query  126  LTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHKK  181
            LTTIGY+SSIMSYMN + LT+ATTCFALVLYIKKKLRD+AKMKVP   F  E+ +K
Sbjct  121  LTTIGYVSSIMSYMNGMMLTVATTCFALVLYIKKKLRDQAKMKVPTYQFLREKSEK  176


> D0S3E1 LRAT domain-containing protein [Acinetobacter calcoaceticus 
RUH2202]
Length=196

 Score =  294 bits (752),  Expect = 4e-105
 Identities = 137/176 (78%), Positives = 155/176 (88%), Gaps = 0/176 (0%)

Query  6    MQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQKFSHGK  65
            MQQ  KRYP+GAHL++ HLGYSHHGIYAGRGRVIHYSG AH  KK+PIEIT++  FSHGK
Sbjct  1    MQQPNKRYPLGAHLIVRHLGYSHHGIYAGRGRVIHYSGLAHFIKKRPIEITSIDAFSHGK  60

Query  66   KIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNR  125
            KIHIR YD P+YKGR VVRRMRSR+HENHYHLIINNCEHLCSWAITG+E+S QV +MM+R
Sbjct  61   KIHIRSYDTPRYKGRAVVRRMRSRMHENHYHLIINNCEHLCSWAITGIESSTQVERMMHR  120

Query  126  LTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHKK  181
            LTTIGY+SSIMSYMN + LT+ATTCFALVLYIKKKLRD+AKMKVP   F  E+ +K
Sbjct  121  LTTIGYVSSIMSYMNGMMLTVATTCFALVLYIKKKLRDQAKMKVPTYQFLREKSEK  176


> A0A0A8XE54 LRAT domain-containing protein [Acinetobacter calcoaceticus]
Length=196

 Score =  293 bits (751),  Expect = 6e-105
 Identities = 136/176 (77%), Positives = 155/176 (88%), Gaps = 0/176 (0%)

Query  6    MQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQKFSHGK  65
            MQQ  KRYP+GAHL++ HLGYSHHGIYAGRGRVIHYSG AH  KK+PIEIT++  FSHGK
Sbjct  1    MQQPNKRYPLGAHLIVRHLGYSHHGIYAGRGRVIHYSGLAHFIKKRPIEITSIDAFSHGK  60

Query  66   KIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNR  125
            KIH+R YD P+YKGR VVRRMRSR+HENHYHLIINNCEHLCSWAITG+E+S QV +MM+R
Sbjct  61   KIHVRSYDTPRYKGRAVVRRMRSRMHENHYHLIINNCEHLCSWAITGIESSTQVERMMHR  120

Query  126  LTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHKK  181
            LTTIGY+SSIMSYMN + LT+ATTCFALVLYIKKKLRD+AKMKVP   F  E+ +K
Sbjct  121  LTTIGYVSSIMSYMNGMMLTVATTCFALVLYIKKKLRDQAKMKVPTYQFLREKSEK  176


> N9EKV1 LRAT domain-containing protein [Acinetobacter calcoaceticus 
ANC 3680]
Length=196

 Score =  293 bits (751),  Expect = 6e-105
 Identities = 136/176 (77%), Positives = 155/176 (88%), Gaps = 0/176 (0%)

Query  6    MQQHIKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLFKKKPIEITTLQKFSHGK  65
            MQQ  KRYP+GAHL++ HLGYSHHGIYAGRGRVIHYSG AH  KK+PIEIT++  FSHGK
Sbjct  1    MQQPNKRYPLGAHLIVRHLGYSHHGIYAGRGRVIHYSGLAHFIKKRPIEITSIDAFSHGK  60

Query  66   KIHIRIYDQPKYKGRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNR  125
            KIH+R YD P+YKGR VVRRMRSR+HENHYHLIINNCEHLCSWAITG+E+S QV +MM+R
Sbjct  61   KIHVRSYDTPRYKGRAVVRRMRSRMHENHYHLIINNCEHLCSWAITGIESSTQVERMMHR  120

Query  126  LTTIGYLSSIMSYMNSLFLTIATTCFALVLYIKKKLRDKAKMKVPDSIFYHEEHKK  181
            LTTIGY+SSIMSYMN + LT+ATTCFALVLYIKKKLRD+AKMKVP   F  E+ +K
Sbjct  121  LTTIGYVSSIMSYMNGMMLTVATTCFALVLYIKKKLRDQAKMKVPTYQFLREKSEK  176



Lambda      K        H        a         alpha
   0.330    0.141    0.440    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 241815


  Database: 9b2ee70120ca3af9a49bf40ba7af8364.TrEMBL.fasta
    Posted date:  Oct 1, 2020  6:25 AM
  Number of letters in database: 2,030
  Number of sequences in database:  11



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40