ACIAD1919 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: da121e5bb9ee124a591a156f32f80b2d.SwissProt.fasta
           14 sequences; 2,803 total letters



Query= ACIAD1919

Length=182
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q9JI61 Lecithin retinol acyltransferase [Rattus norvegicus]         43.1    6e-09
  Q9NWW9 Phospholipase A and acyltransferase 2 [Homo sapiens]         40.0    5e-08
  O95237 Lecithin retinol acyltransferase [Homo sapiens]              39.3    1e-07
  Q6DC39 Deubiquitinase DESI2 [Danio rerio]                           38.9    2e-07
  Q5PQ09 Deubiquitinase DESI2 [Xenopus laevis]                        38.5    2e-07
  Q9JI60 Lecithin retinol acyltransferase [Mus musculus]              38.1    3e-07
  Q5ZIV7 Deubiquitinase DESI2 [Gallus gallus]                         37.4    5e-07
  A3QRX8 Deubiquitinase DESI2 [Sus scrofa]                            36.6    9e-07
  Q5R456 Deubiquitinase DESI2 [Pongo abelii]                          36.6    9e-07
  Q9BSY9 Deubiquitinase DESI2 [Homo sapiens]                          36.6    9e-07
  Q9D291 Deubiquitinase DESI2 [Mus musculus]                          36.6    9e-07
  Q5XIT6 Deubiquitinase DESI2 [Rattus norvegicus]                     36.2    1e-06
  Q9BGL2 Lecithin retinol acyltransferase [Bos taurus]                35.4    2e-06
  Q9HDD0 Phospholipase A and acyltransferase 1 [Homo sapiens]         34.7    4e-06


> Q9JI61 Lecithin retinol acyltransferase [Rattus norvegicus]
Length=231

 Score = 43.1 bits (100),  Expect = 6e-09
 Identities = 42/182 (23%), Positives = 70/182 (38%), Gaps = 41/182 (23%)

Query  16   GAHLVIYHLGYSHHGIYAGRGRVIHYSGFAHLF-----------------------KKKP  52
            G  L +    ++H+GIY G  RV H      L                        K   
Sbjct  48   GDVLEVSRTHFTHYGIYLGDNRVAHLMPDILLALTSDKERTQKVVSNKRLLPGVICKVAS  107

Query  53   IEITTLQKFSHGKKIHIRIYDQPKYK----GRTVVRRMRSRIHENHYHLIINNCEHLCSW  108
            I + T++ F++G  I +   D+   K       V RR   ++    Y L+ NNCEH  ++
Sbjct  108  IRVDTVEDFAYGADILVNHLDETLKKKSLLNEEVARRAEQQLGLTPYSLLWNNCEHFVTY  167

Query  109  AITG------VENSHQVVKMMNR-------LTTIGYLSSIMSYMNSLFLTIATTCFALVL  155
               G       E  H+ VK++ R          +G +S I + + S ++T+   C    L
Sbjct  168  CRYGSPISPQAEKFHETVKILIRDQRSCLASAVLGLVSIIYTGLAS-YMTLPAVCIPFCL  226

Query  156  YI  157
            ++
Sbjct  227  WM  228


 Score = 17.3 bits (33),  Expect = 2.1
 Identities = 21/83 (25%), Positives = 32/83 (39%), Gaps = 6/83 (7%)

Query  88   SRIHENHYHLII--NNCEHLCS---WAITGVENSHQVVKMMNRLTTIGYLSSIMSYMNSL  142
            SR H  HY + +  N   HL      A+T  +   Q V    RL   G +  + S     
Sbjct  54   SRTHFTHYGIYLGDNRVAHLMPDILLALTSDKERTQKVVSNKRLLP-GVICKVASIRVDT  112

Query  143  FLTIATTCFALVLYIKKKLRDKA  165
                A     LV ++ + L+ K+
Sbjct  113  VEDFAYGADILVNHLDETLKKKS  135


> Q9NWW9 Phospholipase A and acyltransferase 2 [Homo sapiens]
Length=162

 Score = 40.0 bits (92),  Expect = 5e-08
 Identities = 35/149 (23%), Positives = 60/149 (40%), Gaps = 19/149 (13%)

Query  15   IGAHLVIYHLGYSHHGIYAGRGRVIHY------------SGFAHLFKKKPIEITTLQKFS  62
            +G  + I   GY+H  IY G G V+H             S  + L  K  ++   L   +
Sbjct  10   LGDLIEISRFGYAHWAIYVGDGYVVHLAPASEIAGAGAASVLSALTNKAIVKKELLSVVA  69

Query  63   HGKKIHIRIYDQPKY---KGRTVVRRMRSRI-HENHYHLIINNCEHLCSWAITGVENSHQ  118
             G    +      +Y       +V+R    +  E  Y L  +NCEH  +    GV  S Q
Sbjct  70   GGDNYRVNNKHDDRYTPLPSNKIVKRAEELVGQELPYSLTSDNCEHFVNHLRYGVSRSDQ  129

Query  119  VVKMMNRLTTIGYLSSIMSYMNSLFLTIA  147
            V      +TT+G  + +++  + + + +A
Sbjct  130  VT---GAVTTVGVAAGLLAAASLVGILLA  155


> O95237 Lecithin retinol acyltransferase [Homo sapiens]
Length=230

 Score = 39.3 bits (90),  Expect = 1e-07
 Identities = 39/158 (25%), Positives = 58/158 (37%), Gaps = 30/158 (19%)

Query  27   SHHGIYAGRGRVIHYSG-----------------------FAHLFKKKPIEITTLQKFSH  63
            +H+GIY G  RV H                             + K   I + T++ F++
Sbjct  59   THYGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILGVIVKVASIRVDTVEDFAY  118

Query  64   GKKIHIRIYDQPKYK----GRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQV  119
            G  I +   D+   K       V RR    +    Y L+ NNCEH  ++   G   S Q 
Sbjct  119  GANILVNHLDESLQKKALLNEEVARRAEKLLGFTPYSLLWNNCEHFVTYCRYGTPISPQS  178

Query  120  VKMMNRLTTIGYLSSIMSYMNSLFLTIAT-TCFALVLY  156
             K    +  I  +    S + S  L +A+  C  LV Y
Sbjct  179  DKFCETVKII--IRDQRSVLASAVLGLASIVCTGLVSY  214


 Score = 15.8 bits (29),  Expect = 6.8
 Identities = 19/82 (23%), Positives = 32/82 (39%), Gaps = 6/82 (7%)

Query  89   RIHENHYHLII--NNCEHLCS---WAITGVENSHQVVKMMNRLTTIGYLSSIMSYMNSLF  143
            R H  HY + +  N   H+      A+T      Q V + N+   +G +  + S      
Sbjct  55   RTHLTHYGIYLGDNRVAHMMPDILLALTDDMGRTQKV-VSNKRLILGVIVKVASIRVDTV  113

Query  144  LTIATTCFALVLYIKKKLRDKA  165
               A     LV ++ + L+ KA
Sbjct  114  EDFAYGANILVNHLDESLQKKA  135


> Q6DC39 Deubiquitinase DESI2 [Danio rerio]
Length=196

 Score = 38.9 bits (89),  Expect = 2e-07
 Identities = 34/123 (28%), Positives = 55/123 (45%), Gaps = 10/123 (8%)

Query  24   LGYSHHGIYAGRGRVIHYSG----FAHLFKKKPIEITTL-QKFSHGKKIHIRIYDQPKYK  78
            +G  H GI    GR   Y G    F+ +F+  P + T L + F   + I +   D  +  
Sbjct  25   IGVFHSGIEI-YGREFAYGGHPYPFSGIFEITPGDATELGETFKFKEAIVLGSTDFTEED  83

Query  79   GRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNRLTTIGYLSSIMSY  138
               +V  M      N YHL+  NC H  S A++ +    ++ + +NRL    Y SS + +
Sbjct  84   VERIVEEMGKEYKGNAYHLMHKNCNHFSS-ALSEILCGREIPRWVNRL---AYFSSCVPF  139

Query  139  MNS  141
            + S
Sbjct  140  LQS  142


> Q5PQ09 Deubiquitinase DESI2 [Xenopus laevis]
Length=192

 Score = 38.5 bits (88),  Expect = 2e-07
 Identities = 37/146 (25%), Positives = 64/146 (44%), Gaps = 10/146 (7%)

Query  24   LGYSHHGIYAGRGRVIHYSG----FAHLFKKKPIEITTL-QKFSHGKKIHIRIYDQPKYK  78
            +G  H GI    GR   Y G    F+ +F+  P + T L   F   + I +   D  +  
Sbjct  25   IGVFHSGIQV-YGREFAYGGHPYPFSGVFEISPGDSTELGDTFKFKEAIALGSTDFTEND  83

Query  79   GRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNRLTTIGYLSSIMSY  138
               ++  +      N YHL+  NC H  S A++ +    ++ + +NRL    Y S+ + +
Sbjct  84   IEKIIEELGKEYKGNAYHLMHKNCNHFSS-ALSEILCGKEIPRWVNRL---AYFSTCVPF  139

Query  139  MNSLFLTIATTCFALVLYIKKKLRDK  164
            + S       T  AL   I ++L+D+
Sbjct  140  LQSCLPKEWLTPAALQSSISQELQDE  165


> Q9JI60 Lecithin retinol acyltransferase [Mus musculus]
Length=231

 Score = 38.1 bits (87),  Expect = 3e-07
 Identities = 34/147 (23%), Positives = 52/147 (35%), Gaps = 27/147 (18%)

Query  10   IKRYPIGAHLVIYHLGYSHHGIYAGRGRVIHYSG-----------------------FAH  46
            I  +  G  L +    + H+GIY G  RV H                             
Sbjct  42   ISSFVRGDVLEVSRTHFIHYGIYLGENRVAHLMPDILLALTNDKERTQKVVSNKRLLLGV  101

Query  47   LFKKKPIEITTLQKFSHGKKIHIRIYDQPKYK----GRTVVRRMRSRIHENHYHLIINNC  102
            + K   I + T++ F++G  I +   D    K       V RR   ++    Y L+ NNC
Sbjct  102  ICKVASIRVDTVEDFAYGADILVNHLDGTLKKKSLLNEEVARRAEQQLGLTPYSLLWNNC  161

Query  103  EHLCSWAITGVENSHQVVKMMNRLTTI  129
            EH  ++   G   S Q  K  + +  I
Sbjct  162  EHFVTYCRYGSRISPQAEKFYDTVKII  188


 Score = 17.7 bits (34),  Expect = 1.6
 Identities = 17/82 (21%), Positives = 32/82 (39%), Gaps = 4/82 (5%)

Query  88   SRIHENHYHLII--NNCEHLCSWAITGVENSHQVVK--MMNRLTTIGYLSSIMSYMNSLF  143
            SR H  HY + +  N   HL    +  + N  +  +  + N+   +G +  + S      
Sbjct  54   SRTHFIHYGIYLGENRVAHLMPDILLALTNDKERTQKVVSNKRLLLGVICKVASIRVDTV  113

Query  144  LTIATTCFALVLYIKKKLRDKA  165
               A     LV ++   L+ K+
Sbjct  114  EDFAYGADILVNHLDGTLKKKS  135


> Q5ZIV7 Deubiquitinase DESI2 [Gallus gallus]
Length=193

 Score = 37.4 bits (85),  Expect = 5e-07
 Identities = 36/146 (25%), Positives = 64/146 (44%), Gaps = 10/146 (7%)

Query  24   LGYSHHGIYAGRGRVIHYSG----FAHLFKKKPIEITTL-QKFSHGKKIHIRIYDQPKYK  78
            +G  H GI    GR   Y G    F+ +F+  P   + L + F   + + +   D  +  
Sbjct  25   IGVFHSGIEV-YGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFMEDD  83

Query  79   GRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNRLTTIGYLSSIMSY  138
               +V  +      N YHL+  NC H  S A++ +    ++ + +NRL    Y SS + +
Sbjct  84   IEKIVEELGKEFKGNAYHLMHKNCNHFSS-ALSEILCGKEIPRWVNRL---AYFSSCIPF  139

Query  139  MNSLFLTIATTCFALVLYIKKKLRDK  164
            + S       T  AL   + ++L+D+
Sbjct  140  LQSCLPKEWLTPAALQSSVSQELQDE  165


> A3QRX8 Deubiquitinase DESI2 [Sus scrofa]
Length=194

 Score = 36.6 bits (83),  Expect = 9e-07
 Identities = 36/146 (25%), Positives = 64/146 (44%), Gaps = 10/146 (7%)

Query  24   LGYSHHGIYAGRGRVIHYSG----FAHLFKKKPIEITTL-QKFSHGKKIHIRIYDQPKYK  78
            +G  H GI    GR   Y G    F+ +F+  P   + L + F   + + +   D  +  
Sbjct  26   IGVFHSGIEV-YGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDD  84

Query  79   GRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNRLTTIGYLSSIMSY  138
               +V  +      N YHL+  NC H  S A++ +    ++ + +NRL    Y SS + +
Sbjct  85   IEKIVEELGKEYKGNAYHLMHKNCNHFSS-ALSEILCGKEIPRWINRL---AYFSSCIPF  140

Query  139  MNSLFLTIATTCFALVLYIKKKLRDK  164
            + S       T  AL   + ++L+D+
Sbjct  141  LQSCLPKEWLTPAALQSSVSQELQDE  166


> Q5R456 Deubiquitinase DESI2 [Pongo abelii]
Length=194

 Score = 36.6 bits (83),  Expect = 9e-07
 Identities = 36/146 (25%), Positives = 64/146 (44%), Gaps = 10/146 (7%)

Query  24   LGYSHHGIYAGRGRVIHYSG----FAHLFKKKPIEITTL-QKFSHGKKIHIRIYDQPKYK  78
            +G  H GI    GR   Y G    F+ +F+  P   + L + F   + + +   D  +  
Sbjct  26   IGVFHSGIEV-YGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDD  84

Query  79   GRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNRLTTIGYLSSIMSY  138
               +V  +      N YHL+  NC H  S A++ +    ++ + +NRL    Y SS + +
Sbjct  85   IEKIVEELGKEYKGNAYHLMHKNCNHFSS-ALSEILCGKEIPRWINRL---AYFSSCIPF  140

Query  139  MNSLFLTIATTCFALVLYIKKKLRDK  164
            + S       T  AL   + ++L+D+
Sbjct  141  LQSCLPKEWLTPAALQSSVSQELQDE  166


> Q9BSY9 Deubiquitinase DESI2 [Homo sapiens]
Length=194

 Score = 36.6 bits (83),  Expect = 9e-07
 Identities = 36/146 (25%), Positives = 64/146 (44%), Gaps = 10/146 (7%)

Query  24   LGYSHHGIYAGRGRVIHYSG----FAHLFKKKPIEITTL-QKFSHGKKIHIRIYDQPKYK  78
            +G  H GI    GR   Y G    F+ +F+  P   + L + F   + + +   D  +  
Sbjct  26   IGVFHSGIEV-YGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDD  84

Query  79   GRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNRLTTIGYLSSIMSY  138
               +V  +      N YHL+  NC H  S A++ +    ++ + +NRL    Y SS + +
Sbjct  85   IEKIVEELGKEYKGNAYHLMHKNCNHFSS-ALSEILCGKEIPRWINRL---AYFSSCIPF  140

Query  139  MNSLFLTIATTCFALVLYIKKKLRDK  164
            + S       T  AL   + ++L+D+
Sbjct  141  LQSCLPKEWLTPAALQSSVSQELQDE  166


> Q9D291 Deubiquitinase DESI2 [Mus musculus]
Length=194

 Score = 36.6 bits (83),  Expect = 9e-07
 Identities = 36/146 (25%), Positives = 64/146 (44%), Gaps = 10/146 (7%)

Query  24   LGYSHHGIYAGRGRVIHYSG----FAHLFKKKPIEITTL-QKFSHGKKIHIRIYDQPKYK  78
            +G  H GI    GR   Y G    F+ +F+  P   + L + F   + + +   D  +  
Sbjct  26   IGVFHSGIEV-YGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDD  84

Query  79   GRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNRLTTIGYLSSIMSY  138
               +V  +      N YHL+  NC H  S A++ +    ++ + +NRL    Y SS + +
Sbjct  85   IEKIVEELGKEYKGNAYHLMHKNCNHFSS-ALSEILCGKEIPRWINRL---AYFSSCIPF  140

Query  139  MNSLFLTIATTCFALVLYIKKKLRDK  164
            + S       T  AL   + ++L+D+
Sbjct  141  LQSCLPKEWLTPAALQSSVSQELQDE  166


> Q5XIT6 Deubiquitinase DESI2 [Rattus norvegicus]
Length=194

 Score = 36.2 bits (82),  Expect = 1e-06
 Identities = 36/146 (25%), Positives = 63/146 (43%), Gaps = 10/146 (7%)

Query  24   LGYSHHGIYAGRGRVIHYSG----FAHLFKKKPIEITTL-QKFSHGKKIHIRIYDQPKYK  78
            +G  H GI    GR   Y G    F+ +F+  P     L + F   + + +   D  +  
Sbjct  26   IGVFHSGIEV-YGREFAYGGHPYPFSGIFEISPGNAAELGETFKFKEAVVLGSTDFLEDD  84

Query  79   GRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQVVKMMNRLTTIGYLSSIMSY  138
               +V  +      N YHL+  NC H  S A++ +    ++ + +NRL    Y SS + +
Sbjct  85   IEKIVEELGKEYKGNAYHLMHKNCNHFSS-ALSEILCGKEIPRWINRL---AYFSSCIPF  140

Query  139  MNSLFLTIATTCFALVLYIKKKLRDK  164
            + S       T  AL   + ++L+D+
Sbjct  141  LQSCLPKEWLTPAALQSSVSQELQDE  166


> Q9BGL2 Lecithin retinol acyltransferase [Bos taurus]
Length=230

 Score = 35.4 bits (80),  Expect = 2e-06
 Identities = 36/158 (23%), Positives = 58/158 (37%), Gaps = 30/158 (19%)

Query  27   SHHGIYAGRGRVIHYSG-----------------------FAHLFKKKPIEITTLQKFSH  63
            +H+GIY G  RV H                             + +   I + T++ F++
Sbjct  59   THYGIYLGDNRVAHMMPDILLALTDDKGRTQKVVSNKRLILGVIGRVASIRVDTVEDFAY  118

Query  64   GKKIHIRIYDQPKYK----GRTVVRRMRSRIHENHYHLIINNCEHLCSWAITGVENSHQV  119
            G +I +   D+   K       V +R    +    Y L+ NNCEH  ++   G   S Q 
Sbjct  119  GAEILVNHLDRSLKKKALLNEEVAQRAEKLLGITPYSLLWNNCEHFVTYCRYGTPISPQA  178

Query  120  VKMMNRLTTIGYLSSIMSYMNSLFLTIATT-CFALVLY  156
             K    +  I  +    S + S  L +A+  C  L  Y
Sbjct  179  DKFCENVKII--IRDQRSVLASAVLGLASIFCLGLTSY  214


 Score = 18.1 bits (35),  Expect = 1.2
 Identities = 19/82 (23%), Positives = 33/82 (40%), Gaps = 6/82 (7%)

Query  89   RIHENHYHLII--NNCEHLCS---WAITGVENSHQVVKMMNRLTTIGYLSSIMSYMNSLF  143
            R H  HY + +  N   H+      A+T  +   Q V + N+   +G +  + S      
Sbjct  55   RTHLTHYGIYLGDNRVAHMMPDILLALTDDKGRTQKV-VSNKRLILGVIGRVASIRVDTV  113

Query  144  LTIATTCFALVLYIKKKLRDKA  165
               A     LV ++ + L+ KA
Sbjct  114  EDFAYGAEILVNHLDRSLKKKA  135


> Q9HDD0 Phospholipase A and acyltransferase 1 [Homo sapiens]
Length=168

 Score = 34.7 bits (78),  Expect = 4e-06
 Identities = 33/140 (24%), Positives = 59/140 (42%), Gaps = 17/140 (12%)

Query  16   GAHLVIYHLGYSHHGIYAGRGRVIH----------YSGFAHLFKKKPIEITTLQKFSHGK  65
            G  + ++  GY H  +Y G G VI+          ++    +F  K +    L K   G 
Sbjct  18   GDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVVGN  77

Query  66   KIHIRI---YDQ--PKYKGRTVVRRMRSRI-HENHYHLIINNCEHLCSWAITGVENSHQV  119
              + RI   YD+  P      +++R    I  E  Y+L++NNCEH  +    G   S Q 
Sbjct  78   DTY-RINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQA  136

Query  120  VKMMNRLTTIGYLSSIMSYM  139
             + ++ +  +     + S++
Sbjct  137  NRAISTVEFVTAAVGVFSFL  156



Lambda      K        H        a         alpha
   0.330    0.141    0.440    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 331325


  Database: da121e5bb9ee124a591a156f32f80b2d.SwissProt.fasta
    Posted date:  Sep 21, 2020  5:22 AM
  Number of letters in database: 2,803
  Number of sequences in database:  14



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40