ACIAD1900 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: acb43a7bfb7187f288914cbd46b44dfb.TrEMBL.fasta
           20 sequences; 5,172 total letters



Query= ACIAD1900

Length=228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FB35 Molybdenum transport system permease [Acinetobacter bayl...   439    2e-160
  A0A1P8EH35 Molybdenum transport system permease [Acinetobacter ...   408    2e-148
  N9BUF3 Molybdenum transport system permease [Acinetobacter soli...   408    2e-148
  A0A0M1I888 Molybdenum transport system permease [Acinetobacter ...   407    4e-148
  R9AZ26 Molybdenum transport system permease [Acinetobacter tand...   361    5e-130
  A0A2L0HYR0 Molybdenum transport system permease [Acinetobacter ...   360    1e-129
  N9CAH6 Molybdenum transport system permease [Acinetobacter bouv...   357    3e-128
  A0A0E2GNC6 Molybdenum transport system permease [Acinetobacter ...   354    3e-127
  A0A2T1IYL4 Molybdenum transport system permease [Acinetobacter ...   354    3e-127
  A0A062BWX3 Molybdenum transport system permease [Acinetobacter ...   354    3e-127
  Q8VRF6 Molybdenum transport system permease [Bradyrhizobium jap...   244    8e-84 
  Q93CJ2 Molybdenum transport protein [Trichormus variabilis (str...   161    6e-49 
  Q9ZIN6 Molybdenum transport system permease [Staphylococcus car...   143    1e-44 
  O31230 Molybdenum transport system permease [Paenarthrobacter n...   143    1e-44 
  A7L4W7 Molybdenum transport system permease [Herbaspirillum ser...   135    2e-41 
  Q8GLK6 Molybdenum transport system permease [Aquifex pyrophilus]     131    2e-40 
  Q9G4F6 ABC transmembrane type-1 domain-containing protein [Cucu...   133    2e-40 
  Q9G4F7 ABC transmembrane type-1 domain-containing protein [Cucu...   129    6e-39 
  Q5DL39 Putative sulfate permease [Acinetobacter baumannii]           120    5e-36 
  Q93DX9 CysW [Burkholderia cenocepacia]                               120    2e-35 


> Q6FB35 Molybdenum transport system permease [Acinetobacter baylyi 
(strain ATCC 33305 / BD413 / ADP1)]
Length=227

 Score =  439 bits (1128),  Expect = 2e-160
 Identities = 227/227 (100%), Positives = 227/227 (100%), Gaps = 0/227 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV
Sbjct  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL
Sbjct  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP
Sbjct  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRLTS  227
            IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRLTS
Sbjct  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRLTS  227


> A0A1P8EH35 Molybdenum transport system permease [Acinetobacter 
soli]
Length=227

 Score =  408 bits (1048),  Expect = 2e-148
 Identities = 207/226 (92%), Positives = 220/226 (97%), Gaps = 0/226 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            ML+PEEISALYLSAKVGLFATLVNLPFAI VAWILARYEFR KV LESLLQLPMILPPVV
Sbjct  1    MLTPEEISALYLSAKVGLFATLVNLPFAIFVAWILARYEFRLKVILESLLQLPMILPPVV  60

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            LGY LLILFGNRG++GQFL+EWGIQ AFNWKGAVIASMVVAFPLMVQPIRLSFQLIN+QL
Sbjct  61   LGYLLLILFGNRGIVGQFLSEWGIQLAFNWKGAVIASMVVAFPLMVQPIRLSFQLINQQL  120

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            EQ+AQTLGASPIQAF+S+SLPLA+PG+LIGSILCFSRSLGEFGATITFVGNIPDETRTVP
Sbjct  121  EQIAQTLGASPIQAFFSVSLPLALPGVLIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRLT  226
            IAIYSLLQQPDGESMAMRLV+LSV LAFAALVANH+IL+RYQQRLT
Sbjct  181  IAIYSLLQQPDGESMAMRLVLLSVGLAFAALVANHLILKRYQQRLT  226


> N9BUF3 Molybdenum transport system permease [Acinetobacter soli 
NIPH 2899]
Length=227

 Score =  408 bits (1048),  Expect = 2e-148
 Identities = 208/226 (92%), Positives = 220/226 (97%), Gaps = 0/226 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            ML+PEEISALYLSAKVGLFATLVNLPFAI VAWILARYEFR KV LESLLQLPMILPPVV
Sbjct  1    MLTPEEISALYLSAKVGLFATLVNLPFAIFVAWILARYEFRLKVILESLLQLPMILPPVV  60

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            LGY LLILFGNRG++GQFL+EWGIQ AFNWKGAVIASMVVAFPLMVQPIRLSFQLIN+QL
Sbjct  61   LGYLLLILFGNRGILGQFLSEWGIQLAFNWKGAVIASMVVAFPLMVQPIRLSFQLINQQL  120

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            EQ+AQTLGASPIQAF+SISLPLA+PG+LIGSILCFSRSLGEFGATITFVGNIPDETRTVP
Sbjct  121  EQIAQTLGASPIQAFFSISLPLALPGVLIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRLT  226
            IAIYSLLQQPDGESMAMRLV+LSV LAFAALVANH+IL+RYQQRLT
Sbjct  181  IAIYSLLQQPDGESMAMRLVLLSVGLAFAALVANHLILKRYQQRLT  226


> A0A0M1I888 Molybdenum transport system permease [Acinetobacter 
sp. C15]
Length=227

 Score =  407 bits (1046),  Expect = 4e-148
 Identities = 207/226 (92%), Positives = 220/226 (97%), Gaps = 0/226 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            ML+PEEISALYLSAKVGLFATLVNLPFAI VAWILARYEFR KV LESLLQLPMILPPVV
Sbjct  1    MLTPEEISALYLSAKVGLFATLVNLPFAIFVAWILARYEFRLKVILESLLQLPMILPPVV  60

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            LGY LLILFGNRG++G+FL+EWGIQ AFNWKGAVIASMVVAFPLMVQPIRLSFQLIN+QL
Sbjct  61   LGYLLLILFGNRGIVGEFLSEWGIQLAFNWKGAVIASMVVAFPLMVQPIRLSFQLINQQL  120

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            EQ+AQTLGASPIQAF+SISLPLA+PG+LIGSILCFSRSLGEFGATITFVGNIPDETRTVP
Sbjct  121  EQIAQTLGASPIQAFFSISLPLALPGVLIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRLT  226
            IAIYSLLQQPDGESMAMRLV+LSV LAFAALVANH+IL+RYQQRLT
Sbjct  181  IAIYSLLQQPDGESMAMRLVLLSVGLAFAALVANHLILKRYQQRLT  226


> R9AZ26 Molybdenum transport system permease [Acinetobacter tandoii 
DSM 14970 = CIP 107469]
Length=227

 Score =  361 bits (927),  Expect = 5e-130
 Identities = 178/225 (79%), Positives = 208/225 (92%), Gaps = 0/225 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            MLSPEE+SALYLSAKV +FATL++LPFAIA+AW+LARYEFR K  LE++LQ+PM+LPPVV
Sbjct  1    MLSPEELSALYLSAKVAIFATLLSLPFAIALAWVLARYEFRLKFVLEAILQMPMVLPPVV  60

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            LGY LL+LFG +G IG++L E GIQ  FNWKGAV+ASM+VAFPLMVQPIRLSFQLIN+QL
Sbjct  61   LGYLLLVLFGQQGWIGRYLNELGIQVVFNWKGAVLASMIVAFPLMVQPIRLSFQLINQQL  120

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            EQVA TLGASPI+ F SISLPLA+PGI+IGSILCFSRSLGEFGATITFVGNIPDETRT+P
Sbjct  121  EQVAATLGASPIRVFCSISLPLAIPGIIIGSILCFSRSLGEFGATITFVGNIPDETRTIP  180

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRL  225
            IAIYS LQQP+GE MAMRLV LS+LLAF+AL+AN++ILQ+YQ++L
Sbjct  181  IAIYSFLQQPNGEEMAMRLVALSMLLAFSALIANYMILQKYQKQL  225


> A0A2L0HYR0 Molybdenum transport system permease [Acinetobacter 
sp. ACNIH2]
Length=227

 Score =  360 bits (924),  Expect = 1e-129
 Identities = 177/225 (79%), Positives = 207/225 (92%), Gaps = 0/225 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            MLSPEE+SALYLSAKV +FATL++LPFAIA+AW+LARYEFR K  LE++LQ+PM+LPPVV
Sbjct  1    MLSPEELSALYLSAKVAIFATLLSLPFAIALAWVLARYEFRLKFLLEAILQMPMVLPPVV  60

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            LGY LL+LFG +G IG++L E GIQ  FNWKGAV+ASM+VAFPLMVQPIRLSFQLIN+QL
Sbjct  61   LGYLLLVLFGQQGWIGRYLNELGIQVVFNWKGAVLASMIVAFPLMVQPIRLSFQLINQQL  120

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            EQVA TLGASPI+ F SISLPLA+PGI+IGSILCFSRSLGEFGATITFVGNIPDETRT+P
Sbjct  121  EQVAATLGASPIRVFCSISLPLAIPGIIIGSILCFSRSLGEFGATITFVGNIPDETRTIP  180

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRL  225
            IAIYS LQQP+GE MAMRLV LS+LL F+AL+AN++ILQ+YQ++L
Sbjct  181  IAIYSFLQQPNGEEMAMRLVALSMLLTFSALIANYMILQKYQKQL  225


> N9CAH6 Molybdenum transport system permease [Acinetobacter bouvetii 
DSM 14964 = CIP 107468]
Length=227

 Score =  357 bits (915),  Expect = 3e-128
 Identities = 175/225 (78%), Positives = 205/225 (91%), Gaps = 0/225 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            M SPEE+SALYLSAKV LFATL+ LPFA+A+AW LARYEFR K  +E++LQLPM+LPPVV
Sbjct  1    MFSPEELSALYLSAKVALFATLMCLPFAVALAWYLARYEFRLKFLVEAILQLPMVLPPVV  60

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            LGY LL+LFGN+G IGQ+L++ GI+ AFNWKGAV+ASM+VAFPLMVQPIRLSFQLIN+QL
Sbjct  61   LGYLLLVLFGNKGWIGQYLSQIGIELAFNWKGAVLASMIVAFPLMVQPIRLSFQLINQQL  120

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            EQ+A +LGA+P + F SISLPLA+PGI+IGSILCFSRSLGEFGATITFVGNIPDETRT+P
Sbjct  121  EQIAGSLGANPFKVFCSISLPLALPGIVIGSILCFSRSLGEFGATITFVGNIPDETRTIP  180

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRL  225
            IAIYS LQQPDGE MAMRLV LS++LAF AL+AN+ ILQ+YQQ+L
Sbjct  181  IAIYSFLQQPDGEQMAMRLVALSLVLAFGALIANYFILQKYQQKL  225


> A0A0E2GNC6 Molybdenum transport system permease [Acinetobacter 
radioresistens DSM 6976 = NBRC 102413 = CIP 103788]
Length=227

 Score =  354 bits (909),  Expect = 3e-127
 Identities = 176/225 (78%), Positives = 205/225 (91%), Gaps = 0/225 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            M  PEE+SALYLSAKVGLFATLV LPFAIA+AW LARYEFR K  +E+LLQLPM+LPPVV
Sbjct  1    MFGPEELSALYLSAKVGLFATLVCLPFAIALAWYLARYEFRLKFMVEALLQLPMVLPPVV  60

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            LGY LLILFG +G+IGQ+L   G++ AFNWKGAV+ASMVVAFPLMVQPIRLSFQL+NRQL
Sbjct  61   LGYLLLILFGQQGLIGQYLHILGLELAFNWKGAVLASMVVAFPLMVQPIRLSFQLMNRQL  120

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            E VA TLGA+P+Q F+SISLPLA+PG++IGSILCFSRSLGEFGATITFVGNIP ETRT+P
Sbjct  121  EHVAGTLGATPVQVFYSISLPLALPGMIIGSILCFSRSLGEFGATITFVGNIPGETRTMP  180

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRL  225
            IAIYS LQQP+GE MA+RLVMLS++LAF+AL+AN+ ILQ+YQ++L
Sbjct  181  IAIYSFLQQPNGEEMALRLVMLSLVLAFSALIANYFILQKYQKKL  225


> A0A2T1IYL4 Molybdenum transport system permease [Acinetobacter 
radioresistens]
Length=227

 Score =  354 bits (909),  Expect = 3e-127
 Identities = 176/225 (78%), Positives = 205/225 (91%), Gaps = 0/225 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            M  PEE+SALYLSAKVGLFATLV LPFAIA+AW LARYEFR K  +E+LLQLPM+LPPVV
Sbjct  1    MFGPEELSALYLSAKVGLFATLVCLPFAIALAWYLARYEFRLKFMVEALLQLPMVLPPVV  60

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            LGY LLILFG +G+IGQ+L   G++ AFNWKGAV+ASMVVAFPLMVQPIRLSFQL+NRQL
Sbjct  61   LGYLLLILFGQQGLIGQYLHILGLELAFNWKGAVLASMVVAFPLMVQPIRLSFQLMNRQL  120

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            E VA TLGA+P+Q F+SISLPLA+PG++IGSILCFSRSLGEFGATITFVGNIP ETRT+P
Sbjct  121  EHVAGTLGATPVQVFYSISLPLALPGMIIGSILCFSRSLGEFGATITFVGNIPGETRTMP  180

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRL  225
            IAIYS LQQP+GE MA+RLVMLS++LAF+AL+AN+ ILQ+YQ++L
Sbjct  181  IAIYSFLQQPNGEEMALRLVMLSLVLAFSALIANYFILQKYQKKL  225


> A0A062BWX3 Molybdenum transport system permease [Acinetobacter 
sp. 263903-1]
Length=227

 Score =  354 bits (909),  Expect = 3e-127
 Identities = 176/225 (78%), Positives = 205/225 (91%), Gaps = 0/225 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            M  PEE+SALYLSAKVGLFATLV LPFAIA+AW LARYEFR K  +E+LLQLPM+LPPVV
Sbjct  1    MFGPEELSALYLSAKVGLFATLVCLPFAIALAWYLARYEFRLKFMVEALLQLPMVLPPVV  60

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            LGY LLILFG +G+IGQ+L   G++ AFNWKGAV+ASMVVAFPLMVQPIRLSFQL+NRQL
Sbjct  61   LGYLLLILFGQQGLIGQYLHILGLELAFNWKGAVLASMVVAFPLMVQPIRLSFQLMNRQL  120

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            E VA TLGA+P+Q F+SISLPLA+PG++IGSILCFSRSLGEFGATITFVGNIP ETRT+P
Sbjct  121  EHVAGTLGATPVQVFYSISLPLALPGMIIGSILCFSRSLGEFGATITFVGNIPGETRTMP  180

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRL  225
            IAIYS LQQP+GE MA+RLVMLS++LAF+AL+AN+ ILQ+YQ++L
Sbjct  181  IAIYSFLQQPNGEEMALRLVMLSLVLAFSALIANYFILQKYQKKL  225


> Q8VRF6 Molybdenum transport system permease [Bradyrhizobium japonicum]
Length=231

 Score =  244 bits (622),  Expect = 8e-84
 Identities = 121/225 (54%), Positives = 171/225 (76%), Gaps = 1/225 (0%)

Query  2    LSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVL  61
            +SP E +A+ LS +V + ATLV  PF IA+AW+LAR +F  K  L++L+ LP++LPPVV 
Sbjct  4    ISPAEWTAILLSLRVAVIATLVATPFGIALAWLLARRDFWGKSLLDALVHLPLVLPPVVT  63

Query  62   GYFLLILFGNRGVIGQFLTEW-GIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            GY LL+ FG RG++G FL +  GI FAF W GA +A  V++FPL+V+P+RLS + I+R+L
Sbjct  64   GYLLLLTFGRRGLVGGFLADHLGIVFAFRWTGAALACGVMSFPLLVRPMRLSIEAIDRKL  123

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            EQ A+TLGA+P + F++++LPLA+PG+L G +L F++++GEFGATITFV NIP ET+T+ 
Sbjct  124  EQAAETLGAAPWKVFFTVTLPLALPGVLAGMVLGFAKAIGEFGATITFVSNIPGETQTIS  183

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRL  225
             AIYSL+Q PDG++ A RLV++SV+LA  AL+A     +R   RL
Sbjct  184  SAIYSLIQTPDGDAAAARLVIVSVILALGALIAAEWFARRATARL  228


> Q93CJ2 Molybdenum transport protein [Trichormus variabilis (strain 
ATCC 29413 / PCC 7937)]
Length=599

 Score =  161 bits (407),  Expect = 6e-49
 Identities = 83/211 (39%), Positives = 124/211 (59%), Gaps = 0/211 (0%)

Query  4    PEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLGY  63
            P ++S L++S K  L AT +     IA A+ +  Y  + K  +E +   P+ILPP V+G+
Sbjct  2    PLDLSPLWISLKTSLLATFITFFLGIAAAYWMLSYRGKGKSLIEGIFVAPLILPPTVVGF  61

Query  64   FLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQV  123
             LL+ FG  G +G+ +  +     F W GA IA+ +V+FPLM +    +F  I+  L +V
Sbjct  62   LLLLFFGKNGPMGKLMGLFDFSIVFTWYGAAIAATIVSFPLMYKTSLGAFAQIDGNLLRV  121

Query  124  AQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIAI  183
            A+TLGAS    FW ISLPLA PGI+  ++L F+R+LGEFGAT+   GNIP +T+T+P+AI
Sbjct  122  ARTLGASESTIFWRISLPLAFPGIVAATMLSFARALGEFGATLMLAGNIPGQTQTIPMAI  181

Query  184  YSLLQQPDGESMAMRLVMLSVLLAFAALVAN  214
            Y  ++           +M+ V+     L  N
Sbjct  182  YFAVEAGATNEAWFWAIMIMVISLSGILAVN  212


> Q9ZIN6 Molybdenum transport system permease [Staphylococcus carnosus]
Length=223

 Score =  143 bits (360),  Expect = 1e-44
 Identities = 83/212 (39%), Positives = 131/212 (62%), Gaps = 4/212 (2%)

Query  6    EISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLGYFL  65
            +++  ++S KV + +T++     I ++ +L RY  R    LES++ LP++LPP V+G+ L
Sbjct  3    DLTPFWISIKVAVISTIIVSILGIIISRLLYRYRGRIVTLLESIIILPIVLPPTVMGFLL  62

Query  66   LILFGNRGVIGQFLTE-WGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQVA  124
            LI+F  +  +G F T    +   F   GAVIAS+VV+FPLM Q     F+ IN ++   A
Sbjct  63   LIVFSPKSPVGAFFTNVLHLPVVFTLTGAVIASVVVSFPLMYQHTIQGFRGINNKMLNTA  122

Query  125  QTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIAIY  184
            +T+GAS  + F+ + LPL+   IL G ++ F+R++GEFGAT+   G IP++T T+P+ IY
Sbjct  123  RTMGASENKIFFRLILPLSKRSILSGIMMAFARAIGEFGATLMVAGYIPNKTNTLPLEIY  182

Query  185  SLLQQPDGESMAMRLVMLSVLLAFAALVANHI  216
             L++Q   E+ A   V+  VL+AFA  V   I
Sbjct  183  FLVEQ-GKENEAWLWVL--VLVAFAITVIGTI  211


> O31230 Molybdenum transport system permease [Paenarthrobacter 
nicotinovorans]
Length=239

 Score =  143 bits (360),  Expect = 1e-44
 Identities = 82/209 (39%), Positives = 123/209 (59%), Gaps = 2/209 (1%)

Query  3    SPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLG  62
            S   ++AL LS +     T++ + F + +A++LAR  F  +  L + + LP++LPPVV G
Sbjct  16   SESSLTALGLSLRTSAAGTVLCIVFGVPLAFVLARASFPGQRLLRAFVLLPLVLPPVVGG  75

Query  63   YFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQ  122
              LL  FG +G++G+ L   G+Q AF+    V+A   VA P +V  +  + +    + E 
Sbjct  76   NPLLYTFGRQGLLGRTLELAGMQIAFSTTAVVLAQTFVALPFLVVSLEGALRTAGIKYEA  135

Query  123  VAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIA  182
            VA TLGA P      +S+PL +PGI  GS+L F+R LGEFGAT+TF G++   TRT+P+ 
Sbjct  136  VAATLGAHPTTVLRRVSIPLVLPGIASGSVLSFARCLGEFGATLTFAGSLQGVTRTLPLE  195

Query  183  IYSLLQQPDGESMAMRLVMLSVLLAFAAL  211
            IY  LQ+      A RL +L V +A A +
Sbjct  196  IY--LQRETDADAARRLSLLLVAVAVAVV  222


> A7L4W7 Molybdenum transport system permease [Herbaspirillum seropedicae 
(strain SmR1)]
Length=250

 Score =  135 bits (339),  Expect = 2e-41
 Identities = 72/212 (34%), Positives = 131/212 (62%), Gaps = 2/212 (1%)

Query  2    LSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVL  61
            L+ E+ SA+ L+  +    T++ L     +AW LAR    ++  + +++ LP++LPP VL
Sbjct  3    LTAEDWSAVRLTLSLASIVTVLLLLLGTPLAWWLARTRSGWRHGVAAVVALPLVLPPAVL  62

Query  62   GYFLLILFGNRGVIGQFLTEWGIQFA-FNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            G++LL+L G +G +GQ     G+    F++ G V+AS++ + P +VQP++ +F+ +  + 
Sbjct  63   GFYLLVLMGPQGPVGQLTQALGLGLLPFSFGGLVLASLLYSMPFVVQPLQNAFEAVGERP  122

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
             +VA TL ASP+ AF+++++PLA PG L  ++L F+ ++GEFG  +   GNIP +TR + 
Sbjct  123  MEVAATLRASPLDAFFTVAVPLAGPGFLTAAVLGFAHTVGEFGVVLMIGGNIPGKTRVLS  182

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALV  212
            + IY  ++  +  + A RL    ++ +F  L+
Sbjct  183  MQIYDHVEAFE-YAQAHRLAGAMLVFSFLVLL  213


> Q8GLK6 Molybdenum transport system permease [Aquifex pyrophilus]
Length=220

 Score =  131 bits (330),  Expect = 2e-40
 Identities = 71/206 (34%), Positives = 122/206 (59%), Gaps = 2/206 (1%)

Query  9    ALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLGYFLLIL  68
            AL +S K+    T++ +  ++ ++ +++  EFR K FL SL  LP++LPP VLG++L++L
Sbjct  4    ALIVSLKLAFLTTIILMLLSLIISPLISFKEFRGKGFLLSLFTLPLVLPPTVLGFYLILL  63

Query  69   FGNRGVIGQFLTE-WGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQVAQTL  127
                 ++G+   + +G    F ++G ++AS+V +FPL V P+    + + ++  + A   
Sbjct  64   LSPESLLGRLAKKLFGTSLLFTFEGILLASLVYSFPLAVLPVINVMEKVKKEYMETAYIF  123

Query  128  GASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIAIYSLL  187
            G SPI+ +  + LPL++ GI+   IL F  +LGEFG  +   GNIP ET+T+ I +Y  +
Sbjct  124  GYSPIETYVKVVLPLSLEGIITACILVFVHTLGEFGVILMVGGNIPGETQTLSIYVYDSV  183

Query  188  QQPDGESMAM-RLVMLSVLLAFAALV  212
            Q  D  S  +  L++LS+ L    LV
Sbjct  184  QALDYRSAHIASLILLSIALISTILV  209


> Q9G4F6 ABC transmembrane type-1 domain-containing protein [Cucumis 
sativus]
Length=299

 Score =  133 bits (335),  Expect = 2e-40
 Identities = 77/217 (35%), Positives = 120/217 (55%), Gaps = 1/217 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            ++ P+  SA+ L+  V   A  VNL F +A AW + +++FR K FL +L+ LP  + PVV
Sbjct  55   IVEPDAWSAIKLTFVVAAIALPVNLVFGVAAAWAITKFQFRGKQFLITLIDLPFSVSPVV  114

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
             G   ++LFG +G  G +L +  I+  +   G ++A++ V FP + + +    Q    + 
Sbjct  115  AGLVFVLLFGTQGWFGGWLQDNDIKIVYAVPGIILATLFVTFPFVARELIPLMQAQGSEE  174

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            EQ A TLGAS  Q FW ++LP    G+L G+ILC +R++GEFGA     G I   T T+ 
Sbjct  175  EQAALTLGASGWQIFWRVTLPNIKWGLLYGAILCNARAMGEFGAVSVVSGQIRGLTNTMT  234

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHII  217
            + +  +L      S A  +  L  LLA   LVA +++
Sbjct  235  LHV-EILYNEYQYSAAFAVASLLALLALVTLVAKNVV  270


 Score = 18.1 bits (35),  Expect = 3.1
 Identities = 11/33 (33%), Positives = 14/33 (42%), Gaps = 0/33 (0%)

Query  6    EISALYLSAKVGLFATLVNLPFAIAVAWILARY  38
            + SA +  A +     LV L     V W  ARY
Sbjct  245  QYSAAFAVASLLALLALVTLVAKNVVEWRNARY  277


> Q9G4F7 ABC transmembrane type-1 domain-containing protein [Cucumis 
sativus]
Length=296

 Score =  129 bits (325),  Expect = 6e-39
 Identities = 74/223 (33%), Positives = 120/223 (54%), Gaps = 3/223 (1%)

Query  3    SPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLG  62
            +P  +++  L+    L A LVNL F   VAW+L RY F  K  L++L+ LP  LP  V G
Sbjct  69   APRVVASYQLTFGASLLAALVNLVFGTIVAWVLVRYRFPGKKILDALVDLPFALPTAVAG  128

Query  63   YFLLILFGNRGVIGQFLTEW-GIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLE  121
              L  L+  +G +G  L +W G++ AF   G VIA + +  P +V+ ++   + + R++E
Sbjct  129  IALTALYSEKGWLGAPLADWFGLKVAFTPLGIVIALIFIGVPFVVRTVQPVLEDVEREIE  188

Query  122  QVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPI  181
            + A +LGA   Q    + LP  +P ++ G  L F+R++GE+G+ +   GN+P  +   P+
Sbjct  189  EAAASLGADRWQTIRRVLLPTILPALMTGFALAFARAVGEYGSVVFIAGNMPMVSEITPL  248

Query  182  AIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQR  224
             I + L+Q D    A    ++  L     LV N  +LQ +Q R
Sbjct  249  LIIAKLEQFDYAGAAAIATVMLALSFVLLLVIN--LLQGWQAR  289


 Score = 17.3 bits (33),  Expect = 5.4
 Identities = 13/59 (22%), Positives = 26/59 (44%), Gaps = 0/59 (0%)

Query  97   SMVVAFPLMVQPIRLSFQLINRQLEQVAQTLGASPIQAFWSISLPLAVPGILIGSILCF  155
            S++V  PL   PI+ +        + V      +  Q  +  SL  A+  ++ G+I+ +
Sbjct  41   SVLVLIPLAALPIKSASLGWQGFWDAVTAPRVVASYQLTFGASLLAALVNLVFGTIVAW  99


> Q5DL39 Putative sulfate permease [Acinetobacter baumannii]
Length=231

 Score =  120 bits (301),  Expect = 5e-36
 Identities = 64/212 (30%), Positives = 117/212 (55%), Gaps = 4/212 (2%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            ++ P+ +SA+ L+      A  +N+ F +A AW +++++F+ K  L +++ +P  + PV+
Sbjct  2    LIDPDTLSAVKLTLLTAAIAVPINVIFGVAAAWAVSKFQFKGKAILTTIIDMPFSVSPVI  61

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
             G  ++++FG +G +G +L E  I+  +     V+A++ +  P + + +    +    + 
Sbjct  62   AGLMIVLIFGAQGWLGGWLMEHDIKILYAVPAIVLATIFITVPFVARELIPLMEAQGTEE  121

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            E+ A  LGAS  Q FW ++LP    G++ G ILC +R++GEFGA     G+I  ET T+P
Sbjct  122  EEAAIVLGASGWQTFWKVTLPNIKWGLIYGVILCNARAMGEFGAVSVVSGHIRGETNTLP  181

Query  181  IAIYSLLQQPDGESMAMRLVMLSVLLAFAALV  212
            + +  L      E        +S LLAF AL+
Sbjct  182  LHVEILY----NEYTFSAAFAVSSLLAFLALL  209


> Q93DX9 CysW [Burkholderia cenocepacia]
Length=314

 Score =  120 bits (301),  Expect = 2e-35
 Identities = 73/220 (33%), Positives = 119/220 (54%), Gaps = 4/220 (2%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            +  P+  SA+ L+  V + A  +NL F +  +W +A++EFR K  L +L+ LP  + PV+
Sbjct  70   LADPDAWSAIKLTLTVAVIAVPLNLVFGVCASWAIAKFEFRGKALLTTLIDLPFSVSPVI  129

Query  61   LGYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
             G   ++LFG +G +G +L    +Q  F   G V+A++ V FP + + +    Q      
Sbjct  130  SGLVYVLLFGAQGWLGPWLQGHDVQIIFAVPGIVLATIFVTFPFVARELIPLMQAQGTDE  189

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
            E+ A+ LGAS  Q F  ++LP    G+L G ILC +R++GEFGA     G+I   T T+P
Sbjct  190  EEAARVLGASGWQIFRRVTLPNVKWGLLYGVILCNARAMGEFGAVSVVSGHIRGVTDTMP  249

Query  181  IAIYSLLQQPD---GESMAMRLVMLS-VLLAFAALVANHI  216
            + +  L  + +     ++A  L +L+ V LA   L   H+
Sbjct  250  LHVEILYNEYNFAAAFAVASVLALLALVTLALKLLAERHL  289



Lambda      K        H        a         alpha
   0.332    0.144    0.431    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 797720


  Database: acb43a7bfb7187f288914cbd46b44dfb.TrEMBL.fasta
    Posted date:  Sep 21, 2020  5:36 AM
  Number of letters in database: 5,172
  Number of sequences in database:  20



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40