ACIAD1900 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: f1c922cf82cb78144fa9a9cccd11b83a.SwissProt.fasta
           19 sequences; 5,185 total letters



Query= ACIAD1900

Length=228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P0AF02 Molybdenum transport system permease protein ModB [Esche...   228    8e-78
  P0AF01 Molybdenum transport system permease protein ModB [Esche...   228    8e-78
  P45322 Molybdenum transport system permease protein ModB [Haemo...   224    5e-76
  P0A625 Molybdenum transport system permease protein ModB [Mycob...   143    3e-44
  P9WG12 Molybdenum transport system permease protein ModB [Mycob...   143    3e-44
  P9WG13 Molybdenum transport system permease protein ModB [Mycob...   143    3e-44
  O32209 Putative molybdenum transport system permease protein Yv...   141    4e-44
  P37731 Molybdenum transport system permease protein ModB [Azoto...   137    2e-42
  P27367 Sulfate transport system permease protein CysT [Synechoc...   137    4e-42
  P41032 Sulfate transport system permease protein CysT [Salmonel...   133    2e-40
  Q9MUL9 Probable sulfate transport system permease protein cysT ...   132    3e-40
  Q9TKU8 Probable sulfate transport system permease protein cysT ...   132    5e-40
  A2CI71 Probable sulfate transport system permease protein cysT ...   132    5e-40
  Q08382 Molybdenum transport system permease protein ModB [Rhodo...   127    1e-38
  P26246 Probable sulfate transport system permease protein cysT ...   128    1e-38
  Q8RVC7 Sulfate permease 1, chloroplastic [Chlamydomonas reinhar...   130    2e-38
  P16701 Sulfate transport system permease protein CysT [Escheric...   125    1e-37
  Q01895 Sulfate transport system permease protein CysT [Synechoc...   125    2e-37
  Q6QJE2 Sulfate permease 2, chloroplastic [Chlamydomonas reinhar...   123    4e-36


> P0AF02 Molybdenum transport system permease protein ModB [Escherichia 
coli O157:H7]
Length=229

 Score =  228 bits (582),  Expect = 8e-78
 Identities = 115/225 (51%), Positives = 165/225 (73%), Gaps = 1/225 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            +L+  E  A+ LS KV   A L +LPF I  AW+L R  F  K  L+S+L LP++LPPVV
Sbjct  2    ILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKALLDSVLHLPLVLPPVV  61

Query  61   LGYFLLILFGNRGVIGQFLTEW-GIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQ  119
            +GY LL+  G RG IG+ L +W GI FAF+W+GAV+A+ V++FPLMV+ IRL+ + ++ +
Sbjct  62   VGYLLLVSMGRRGFIGERLYDWFGITFAFSWRGAVLAAAVMSFPLMVRAIRLALEGVDVK  121

Query  120  LEQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTV  179
            LEQ A+TLGA   + F++I+LPL +PGI++G++L F+RSLGEFGATITFV NIP ETRT+
Sbjct  122  LEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRTI  181

Query  180  PIAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQR  224
            P A+Y+L+Q P GES A RL ++S+ LA  +L+ +  + +  ++R
Sbjct  182  PSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARISRER  226


> P0AF01 Molybdenum transport system permease protein ModB [Escherichia 
coli (strain K12)]
Length=229

 Score =  228 bits (582),  Expect = 8e-78
 Identities = 115/225 (51%), Positives = 165/225 (73%), Gaps = 1/225 (0%)

Query  1    MLSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVV  60
            +L+  E  A+ LS KV   A L +LPF I  AW+L R  F  K  L+S+L LP++LPPVV
Sbjct  2    ILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKALLDSVLHLPLVLPPVV  61

Query  61   LGYFLLILFGNRGVIGQFLTEW-GIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQ  119
            +GY LL+  G RG IG+ L +W GI FAF+W+GAV+A+ V++FPLMV+ IRL+ + ++ +
Sbjct  62   VGYLLLVSMGRRGFIGERLYDWFGITFAFSWRGAVLAAAVMSFPLMVRAIRLALEGVDVK  121

Query  120  LEQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTV  179
            LEQ A+TLGA   + F++I+LPL +PGI++G++L F+RSLGEFGATITFV NIP ETRT+
Sbjct  122  LEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRTI  181

Query  180  PIAIYSLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQR  224
            P A+Y+L+Q P GES A RL ++S+ LA  +L+ +  + +  ++R
Sbjct  182  PSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARISRER  226


> P45322 Molybdenum transport system permease protein ModB [Haemophilus 
influenzae (strain ATCC 51907 / DSM 11121 / KW20 / 
Rd)]
Length=229

 Score =  224 bits (570),  Expect = 5e-76
 Identities = 111/221 (50%), Positives = 161/221 (73%), Gaps = 1/221 (0%)

Query  6    EISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLGYFL  65
            EISA+ LS  V + + L +LP AI VAW+LAR  F  K  +  ++ LP++LPPVV+GY L
Sbjct  2    EISAINLSLSVAVSSMLWSLPLAIFVAWLLARKNFYGKSLITGVIHLPLVLPPVVIGYLL  61

Query  66   LILFGNRGVIGQFLTEW-GIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQVA  124
            L+  G  G IG++L +W G+ F F+WKGAV++S VVAFPL+V+ IRLS + I+ +LEQ A
Sbjct  62   LVAMGRNGFIGKYLYQWFGLSFGFSWKGAVLSSAVVAFPLVVRAIRLSLENIDIKLEQAA  121

Query  125  QTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIAIY  184
            QTLGAS  + F++I+LPL++PG+L G +L F+RSLGEFGATITFV NI  ET+T+P+A+Y
Sbjct  122  QTLGASAWRVFFTITLPLSLPGVLAGLVLGFARSLGEFGATITFVSNIAGETQTIPLAMY  181

Query  185  SLLQQPDGESMAMRLVMLSVLLAFAALVANHIILQRYQQRL  225
            S +Q P  E    RL + +++L+  +L+ +  + +R Q++L
Sbjct  182  SFIQTPGAEEQTARLCLFAIILSLISLLLSEWLSKRMQKKL  222


> P0A625 Molybdenum transport system permease protein ModB [Mycobacterium 
bovis (strain ATCC BAA-935 / AF2122/97)]
Length=264

 Score =  143 bits (360),  Expect = 3e-44
 Identities = 82/205 (40%), Positives = 121/205 (59%), Gaps = 2/205 (1%)

Query  3    SPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLG  62
            +P   +AL LS K    +T++ +   + +A +LAR   R    L  L+ LP++LPPVV G
Sbjct  44   TPSSQTALLLSVKTAAASTVLCVLLGVPMALVLARSRGRLVRSLRPLILLPLVLPPVVGG  103

Query  63   YFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQ  122
              LL  FG  G+IG++L   GI  AF+    V+A   V+ P +V  +  + +      E 
Sbjct  104  IALLYAFGRLGLIGRYLEAAGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEV  163

Query  123  VAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIA  182
            VA TLGA P   +W ++LPL +PG++ GS+L F+RSLGEFGAT+TF G+    TRT+P+ 
Sbjct  164  VAATLGARPGTVWWRVTLPLLLPGVVSGSVLAFARSLGEFGATLTFAGSRQGVTRTLPLE  223

Query  183  IYSLLQQPDGESMAMRLVMLSVLLA  207
            IY  LQ+      A+ L +L V++A
Sbjct  224  IY--LQRVTDPDAAVALSLLLVVVA  246


> P9WG12 Molybdenum transport system permease protein ModB [Mycobacterium 
tuberculosis (strain CDC 1551 / Oshkosh)]
Length=264

 Score =  143 bits (360),  Expect = 3e-44
 Identities = 82/205 (40%), Positives = 121/205 (59%), Gaps = 2/205 (1%)

Query  3    SPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLG  62
            +P   +AL LS K    +T++ +   + +A +LAR   R    L  L+ LP++LPPVV G
Sbjct  44   TPSSQTALLLSVKTAAASTVLCVLLGVPMALVLARSRGRLVRSLRPLILLPLVLPPVVGG  103

Query  63   YFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQ  122
              LL  FG  G+IG++L   GI  AF+    V+A   V+ P +V  +  + +      E 
Sbjct  104  IALLYAFGRLGLIGRYLEAAGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEV  163

Query  123  VAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIA  182
            VA TLGA P   +W ++LPL +PG++ GS+L F+RSLGEFGAT+TF G+    TRT+P+ 
Sbjct  164  VAATLGARPGTVWWRVTLPLLLPGVVSGSVLAFARSLGEFGATLTFAGSRQGVTRTLPLE  223

Query  183  IYSLLQQPDGESMAMRLVMLSVLLA  207
            IY  LQ+      A+ L +L V++A
Sbjct  224  IY--LQRVTDPDAAVALSLLLVVVA  246


> P9WG13 Molybdenum transport system permease protein ModB [Mycobacterium 
tuberculosis (strain ATCC 25618 / H37Rv)]
Length=264

 Score =  143 bits (360),  Expect = 3e-44
 Identities = 82/205 (40%), Positives = 121/205 (59%), Gaps = 2/205 (1%)

Query  3    SPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLG  62
            +P   +AL LS K    +T++ +   + +A +LAR   R    L  L+ LP++LPPVV G
Sbjct  44   TPSSQTALLLSVKTAAASTVLCVLLGVPMALVLARSRGRLVRSLRPLILLPLVLPPVVGG  103

Query  63   YFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQ  122
              LL  FG  G+IG++L   GI  AF+    V+A   V+ P +V  +  + +      E 
Sbjct  104  IALLYAFGRLGLIGRYLEAAGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEV  163

Query  123  VAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIA  182
            VA TLGA P   +W ++LPL +PG++ GS+L F+RSLGEFGAT+TF G+    TRT+P+ 
Sbjct  164  VAATLGARPGTVWWRVTLPLLLPGVVSGSVLAFARSLGEFGATLTFAGSRQGVTRTLPLE  223

Query  183  IYSLLQQPDGESMAMRLVMLSVLLA  207
            IY  LQ+      A+ L +L V++A
Sbjct  224  IY--LQRVTDPDAAVALSLLLVVVA  246


> O32209 Putative molybdenum transport system permease protein 
YvgM [Bacillus subtilis (strain 168)]
Length=227

 Score =  141 bits (356),  Expect = 4e-44
 Identities = 92/219 (42%), Positives = 126/219 (58%), Gaps = 12/219 (5%)

Query  2    LSPEEISA------LYLSAKVGLFATLVNLPFA-IAVAWILARYEFRFKVFLESLLQLPM  54
            L P  ISA      + LS +V   A +V +    +A AW ++R  F  K  LE+   LP+
Sbjct  3    LLPSSISASEFFTPVVLSFQVAAVAGIVVIILGTLAGAW-MSRASFFGKTALETCFMLPL  61

Query  55   ILPPVVLGYFLLILFGNRGVIGQFLTEWGIQ--FAFNWKGAVIASMVVAFPLMVQPIRLS  112
            +LPP V+G+ L+++FG    IGQ + EW  Q    F W  AVIAS VVAFPLM Q  +  
Sbjct  62   VLPPTVVGFILIVIFGKHSFIGQAI-EWIFQQPVIFTWWAAVIASAVVAFPLMYQSAKTG  120

Query  113  FQLINRQLEQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNI  172
            F  I+  ++  A   GAS  + F  IS+PLA P +L GSIL  +R+LGEFGAT+ F GNI
Sbjct  121  FADIDPDIQGAAMVDGASRWKVFIHISVPLAYPSLLTGSILSLARALGEFGATLMFAGNI  180

Query  173  PDETRTVPIAIYSLLQQPDGESMAMRLVMLSVLLAFAAL  211
            P  T+T+P AIY  L      ++A   V+  V+++F  L
Sbjct  181  PGVTQTLPTAIYVALDS-GNNTLAWAWVVCIVVISFLML  218


 Score = 18.5 bits (36),  Expect = 2.2
 Identities = 9/27 (33%), Positives = 15/27 (56%), Gaps = 0/27 (0%)

Query  191  DGESMAMRLVMLSVLLAFAALVANHII  217
            DG S     + +SV LA+ +L+   I+
Sbjct  135  DGASRWKVFIHISVPLAYPSLLTGSIL  161


> P37731 Molybdenum transport system permease protein ModB [Azotobacter 
vinelandii]
Length=226

 Score =  137 bits (345),  Expect = 2e-42
 Identities = 74/212 (35%), Positives = 125/212 (59%), Gaps = 4/212 (2%)

Query  2    LSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVL  61
            LS  +++A+ L+ ++    T++ L     +AW LAR   R K  + +++ LP++LPP VL
Sbjct  3    LSEHDLAAIRLTLELASLTTVLLLVVGTPIAWWLARTRSRLKGAIGAVVALPLVLPPTVL  62

Query  62   GYFLLILFGNRGVIGQFLTEWGI-QFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQL  120
            G++LL+  G  G IGQ     G+    F + G V+AS+  + P +VQP++ +F+ I  + 
Sbjct  63   GFYLLVTMGPHGPIGQLTQFLGLGTLPFTFAGLVVASVFYSLPFVVQPLQNAFEAIGERP  122

Query  121  EQVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVP  180
             +VA TL A P   F+++ +PLA PG +  +IL F+ ++GEFG  +   GNIP++TRTV 
Sbjct  123  LEVASTLRAGPWDTFFTVVVPLARPGFITAAILGFAHTVGEFGVVLMIGGNIPEKTRTVA  182

Query  181  IAIY---SLLQQPDGESMAMRLVMLSVLLAFA  209
            + I+     ++      +A  +V+ S L+ FA
Sbjct  183  VQIFDHVEAMEYAQAHWLAGGMVLFSFLVLFA  214


> P27367 Sulfate transport system permease protein CysT [Synechococcus 
elongatus (strain PCC 7942 / FACHB-805)]
Length=278

 Score =  137 bits (346),  Expect = 4e-42
 Identities = 71/209 (34%), Positives = 119/209 (57%), Gaps = 3/209 (1%)

Query  4    PEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLGY  63
            P  ++A  ++  + L A  +N  F + +AW+L RY+F  K   +S + LP  LP  V G 
Sbjct  57   PVAVAAYEVTFGLSLAAAALNGVFGVIIAWVLTRYDFPGKKLFDSFIDLPFALPTAVAGL  116

Query  64   FLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQV  123
             L  ++ ++G IGQF+  +G+Q AF   G ++A + ++ P +V+ +      +  + E+ 
Sbjct  117  TLATVYSDKGWIGQFIAPFGVQIAFTRWGVLLAMVFISLPFVVRTVEPLLLELEVEAEEA  176

Query  124  AQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIAI  183
            A +LGASP + FW + LP  +PG+L G    FSR++GEFG+ +   GN+P +    P+ I
Sbjct  177  AASLGASPSETFWRVILPPILPGVLAGVAQGFSRAVGEFGSVVIISGNLPFDDLIAPVLI  236

Query  184  YSLLQQPDGESMAMRLVMLSVLLAFAALV  212
            +  L+Q D    A   V+ SVLL F+ ++
Sbjct  237  FERLEQYD---YAGATVIGSVLLLFSLVI  262


> P41032 Sulfate transport system permease protein CysT [Salmonella 
typhimurium (strain LT2 / SGSC1412 / ATCC 700720)]
Length=277

 Score =  133 bits (334),  Expect = 2e-40
 Identities = 71/210 (34%), Positives = 116/210 (55%), Gaps = 3/210 (1%)

Query  3    SPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLG  62
            +P+ ++A  ++      A++ N  F + +AWIL RY F  +  L++L+ LP  LP  V G
Sbjct  53   NPQVVAAYKVTLLAAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPFALPTAVAG  112

Query  63   YFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQ  122
              L  LF   G  GQFL ++ I+  + W G  +A    + P +V+ ++   + +  + E+
Sbjct  113  LTLASLFSVNGFYGQFLAQFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVLEELGPEYEE  172

Query  123  VAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIA  182
             AQTLGA+ +Q+F  + LP   P ++ G  L F+RSLGEFGA I   GNI  +T    + 
Sbjct  173  AAQTLGATRLQSFRKVVLPELSPALIAGVALSFTRSLGEFGAVIFIAGNIAWKTEVTSLM  232

Query  183  IYSLLQQ---PDGESMAMRLVMLSVLLAFA  209
            I+  LQ+   P   ++A  ++  S+LL F+
Sbjct  233  IFVRLQEFDYPAASAIASVILAASLLLLFS  262


> Q9MUL9 Probable sulfate transport system permease protein cysT 
[Mesostigma viride]
Length=269

 Score =  132 bits (333),  Expect = 3e-40
 Identities = 68/190 (36%), Positives = 106/190 (56%), Gaps = 0/190 (0%)

Query  2    LSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVL  61
            + P  I A  ++  + L A++VN  F I +AWIL RY F  K  +++ + LP  LP  V 
Sbjct  46   MEPAAIYAYSITLSMALIASIVNGIFGIFIAWILVRYNFPGKRIVDAAIDLPFALPTSVA  105

Query  62   GYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLE  121
            G  L  ++  +G IG FL    I+  F   G  +A + V+FP +V+ ++   Q I ++LE
Sbjct  106  GLTLATVYSEKGWIGHFLQSLSIKVVFTKLGVGVAMIFVSFPFVVRTLQPVLQDIEKELE  165

Query  122  QVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPI  181
            + A +LGAS    FW +  P  +P +L G  L FSR++GE+G+ +    NIP +  T P+
Sbjct  166  EAAWSLGASSWTTFWKVIFPSLIPSLLTGIALAFSRAVGEYGSVVIIASNIPFKDLTAPV  225

Query  182  AIYSLLQQPD  191
             I+  L+Q D
Sbjct  226  LIFQKLEQYD  235


> Q9TKU8 Probable sulfate transport system permease protein cysT 
[Nephroselmis olivacea]
Length=284

 Score =  132 bits (332),  Expect = 5e-40
 Identities = 73/218 (33%), Positives = 123/218 (56%), Gaps = 5/218 (2%)

Query  3    SPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLG  62
            +P  +SA  ++    L A L+N  F + +AW+L RYEF  +  L++ + LP  LP  V G
Sbjct  62   APVAMSAYAVTLSSALIAALLNGVFGLLIAWVLVRYEFPGRRLLDAAVDLPFALPTSVAG  121

Query  63   YFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQ  122
              L  ++ ++G IG +L+   IQ AF   G ++A + V+FP +V+ ++   Q + R+LE+
Sbjct  122  LTLATVYSDQGWIGTWLSSLNIQVAFTRLGVMLAMLFVSFPFVVRTLQPVLQDMERELEE  181

Query  123  VAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIA  182
             A +LGASP   F  +  P  +P ++ G  L FSR++GE+G+ +   GNIP +    P+ 
Sbjct  182  AAWSLGASPFNTFLRVLCPPLMPAMMTGIALAFSRAVGEYGSVVIVSGNIPFQDLIAPVL  241

Query  183  IYSLLQQPDGE-----SMAMRLVMLSVLLAFAALVANH  215
            I+  L+Q D          + L+ L++LLA   + A++
Sbjct  242  IFQRLEQYDYSGATVIGTVVLLISLTLLLAINWIQASN  279


> A2CI71 Probable sulfate transport system permease protein cysT 
[Chlorokybus atmophyticus]
Length=286

 Score =  132 bits (332),  Expect = 5e-40
 Identities = 67/188 (36%), Positives = 106/188 (56%), Gaps = 0/188 (0%)

Query  4    PEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLGY  63
            P  IS   ++    LFATL+N  F + +AW+L RY F  K  +++ + LP  LP  V G 
Sbjct  65   PVAISTYVVTLMTALFATLINGFFGVIIAWVLVRYNFPGKRIIDAAIDLPFALPTSVAGL  124

Query  64   FLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQV  123
             L  ++ ++G IG      GI+ AF   G  +A + V+FP +V+ ++     I+++LE+ 
Sbjct  125  TLATVYSDQGWIGHLFESIGIKVAFTRVGVAVAMIFVSFPFVVRTLQPVLVEIDQELEEA  184

Query  124  AQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIAI  183
            A +LGAS  + FW +  P   P I+ G  L FSR++GE+G+ +    NIP +  T P+ I
Sbjct  185  AWSLGASTWRTFWRVIFPPLTPAIVTGVALAFSRAIGEYGSVVIVASNIPFKDLTAPVLI  244

Query  184  YSLLQQPD  191
            +  L+Q D
Sbjct  245  FQRLEQYD  252


 Score = 18.5 bits (36),  Expect = 2.3
 Identities = 18/66 (27%), Positives = 29/66 (44%), Gaps = 9/66 (14%)

Query  9    ALYLSAKVGLFATLV----NLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLGYF  64
            AL  S  +G + ++V    N+PF    A +L      F+   +       I+  V+L   
Sbjct  213  ALAFSRAIGEYGSVVIVASNIPFKDLTAPVLI-----FQRLEQYDYTGATIIGTVILSIS  267

Query  65   LLILFG  70
            L +LFG
Sbjct  268  LFLLFG  273


> Q08382 Molybdenum transport system permease protein ModB [Rhodobacter 
capsulatus]
Length=228

 Score =  127 bits (319),  Expect = 1e-38
 Identities = 69/215 (32%), Positives = 125/215 (58%), Gaps = 4/215 (2%)

Query  7    ISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLGYFLL  66
            ++ L L+ K+    T++ L     +AW L+R    +K  + +L+ LP++LPP VLG++LL
Sbjct  12   LTTLALTLKLATVTTVLLLALGTPLAWWLSRGGGLWKEIVATLVSLPIVLPPTVLGFYLL  71

Query  67   ILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQVAQT  126
            I  G    +   L   G + +F + G V+ S++ + P +V PIR +F  +  +  +VA T
Sbjct  72   IAMGPNSPLTDLL---GFKLSFTFAGLVVGSVIYSLPFVVNPIRNAFVAMGPRPMEVAAT  128

Query  127  LGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIAIYSL  186
            L ASP+ AF++++LP A PG++ G+IL F+ ++GEFG  +   G IP  T+ + + I+  
Sbjct  129  LRASPLDAFFTVALPQAAPGLITGAILGFAHTVGEFGVVLMIGGGIPGRTKVLSVTIFDY  188

Query  187  LQQPDGESMAMRLVMLSVLLAFAALVANHIILQRY  221
            ++  + +  A  L    + ++F  ++A  +I +RY
Sbjct  189  VETLEWDK-AHVLAGGMLAMSFVVILAMMLIERRY  222


> P26246 Probable sulfate transport system permease protein cysT 
[Marchantia polymorpha]
Length=288

 Score =  128 bits (322),  Expect = 1e-38
 Identities = 72/210 (34%), Positives = 115/210 (55%), Gaps = 1/210 (0%)

Query  2    LSPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVL  61
            L P  +SA   +    L AT++N  F + +AW+L RYEF  K  L++ + LP  LP  V 
Sbjct  65   LEPVVLSAYGFTFLTALLATIINAIFGLILAWVLVRYEFPGKKLLDATVDLPFALPTSVG  124

Query  62   GYFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLE  121
            G  L+ +F ++G I    +   I+  FN  G ++A + V+ P +V+ I+   Q +   LE
Sbjct  125  GLTLMTVFNDKGWIKPICSWLNIKIVFNPIGVLLAMIFVSLPFVVRTIQPVLQNMEEDLE  184

Query  122  QVAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPI  181
            + A  LGASP   FW I  P   P +L G+ L FSR+LGE+G+ +    NIP +   + +
Sbjct  185  EAAWCLGASPWTTFWHILFPPLTPSLLTGTTLGFSRALGEYGSIVLIASNIPMKDLVISV  244

Query  182  AIYSLLQQPDGESMAMRLVMLSVLLAFAAL  211
             ++  L+Q D +S A  +    ++++F AL
Sbjct  245  LLFQKLEQYDYKS-ATIIASFVLIISFTAL  273


> Q8RVC7 Sulfate permease 1, chloroplastic [Chlamydomonas reinhardtii]
Length=411

 Score =  130 bits (327),  Expect = 2e-38
 Identities = 72/210 (34%), Positives = 115/210 (55%), Gaps = 2/210 (1%)

Query  4    PEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLGY  63
            P  + A Y++    L A  +N  F   +AW+L RY F  K  L++ + LP  LP  V G 
Sbjct  193  PVAMHAYYVTFSCSLIAAAINCVFGFVLAWVLVRYNFAGKKILDAAVDLPFALPTSVAGL  252

Query  64   FLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQV  123
             L  ++G+   IGQFL   G+Q  F   G VIA + V+FP +V+ ++   Q I +++E+ 
Sbjct  253  TLATVYGDEFFIGQFLQAQGVQVVFTRLGVVIAMIFVSFPFVVRTMQPVMQEIQKEMEEA  312

Query  124  AQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIAI  183
            A +LGAS  + F  + LP  +P +L G+ L FSR+LGEFG+ +    N   +    P+ I
Sbjct  313  AWSLGASQWRTFTDVVLPPLLPALLTGTALAFSRALGEFGSIVIVSSNFAFKDLIAPVLI  372

Query  184  YSLLQQPD--GESMAMRLVMLSVLLAFAAL  211
            +  L+Q D  G ++   +++L  L+   A+
Sbjct  373  FQCLEQYDYVGATVIGTVLLLISLVMMLAV  402


> P16701 Sulfate transport system permease protein CysT [Escherichia 
coli (strain K12)]
Length=277

 Score =  125 bits (315),  Expect = 1e-37
 Identities = 68/210 (32%), Positives = 115/210 (55%), Gaps = 3/210 (1%)

Query  3    SPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLG  62
            +P+ ++A  ++      A++ N  F + +AWIL RY F  +  L++L+ LP  LP  V G
Sbjct  53   NPQVVAAYKVTLLSAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPFALPTAVAG  112

Query  63   YFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQ  122
              L  LF   G  G++L ++ I+  + W G  +A    + P +V+ ++   + +  + E+
Sbjct  113  LTLASLFSVNGFYGEWLAKFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVLEELGPEYEE  172

Query  123  VAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIA  182
             A+TLGA+  Q+F  + LP   P ++ G  L F+RSLGEFGA I   GNI  +T    + 
Sbjct  173  AAETLGATRWQSFCKVVLPELSPALVAGVALSFTRSLGEFGAVIFIAGNIAWKTEVTSLM  232

Query  183  IYSLLQQ---PDGESMAMRLVMLSVLLAFA  209
            I+  LQ+   P   ++A  ++  S+LL F+
Sbjct  233  IFVRLQEFDYPAASAIASVILAASLLLLFS  262


> Q01895 Sulfate transport system permease protein CysT [Synechocystis 
sp. (strain PCC 6803 / Kazusa)]
Length=286

 Score =  125 bits (314),  Expect = 2e-37
 Identities = 71/223 (32%), Positives = 120/223 (54%), Gaps = 4/223 (2%)

Query  3    SPEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLG  62
            +P  IS   ++    L A LVN      VAW+L R +F  K  +++++ LP  LP  V G
Sbjct  63   TPIAISTYNVTFITALAAGLVNGVMGTLVAWVLVRCQFPGKKIVDAMVDLPFALPTSVAG  122

Query  63   YFLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQ  122
              L  L+   G +G+F   +GIQ AF+  G  +A + ++ P +V+ ++   Q +  + E+
Sbjct  123  LVLATLYSQTGWVGRFFAPFGIQIAFSRLGVFVAMVFISLPFIVRTLQPVLQELEEEAEE  182

Query  123  VAQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIA  182
             A +LGA+  Q FW +  P  +P IL G  L FSR++GE+G+ +    NIP +    P+ 
Sbjct  183  AAWSLGATEFQTFWRVIFPPLIPPILTGIALGFSRAVGEYGSVVLIASNIPFKDLIAPVL  242

Query  183  IYSLLQQPD-GESMAMRLVMLSVLLAFAALVANHIILQRYQQR  224
            ++  L+Q D   +  +  V+LSV L    ++    +LQ++ +R
Sbjct  243  VFERLEQYDYPAATVIGAVLLSVSLILLLIIN---LLQQWGRR  282


> Q6QJE2 Sulfate permease 2, chloroplastic [Chlamydomonas reinhardtii]
Length=369

 Score =  123 bits (309),  Expect = 4e-36
 Identities = 72/202 (36%), Positives = 109/202 (54%), Gaps = 0/202 (0%)

Query  4    PEEISALYLSAKVGLFATLVNLPFAIAVAWILARYEFRFKVFLESLLQLPMILPPVVLGY  63
            P+ + AL ++  +      +N  F    A  L R EF  KVFL SLL LP  + PVV G 
Sbjct  147  PDFLHALKMTLMLAFVTVPLNTVFGTVAAINLTRNEFPGKVFLMSLLDLPFSISPVVTGL  206

Query  64   FLLILFGNRGVIGQFLTEWGIQFAFNWKGAVIASMVVAFPLMVQPIRLSFQLINRQLEQV  123
             L +L+G  G     L E GI   F + G  +A+M V  P +V+ +    + ++   E+ 
Sbjct  207  MLTLLYGRTGWFAALLRETGINVVFAFTGMALATMFVTLPFVVRELIPILENMDLSQEEA  266

Query  124  AQTLGASPIQAFWSISLPLAVPGILIGSILCFSRSLGEFGATITFVGNIPDETRTVPIAI  183
            A+TLGA+  Q FW+++LP    G+L G ILC +R++GEFGA     GNI   T+T+ + +
Sbjct  267  ARTLGANDWQVFWNVTLPNIRWGLLYGVILCNARAMGEFGAVSVISGNIIGRTQTLTLFV  326

Query  184  YSLLQQPDGESMAMRLVMLSVL  205
             S  ++ + E+     V+LS L
Sbjct  327  ESAYKEYNTEAAFAAAVLLSAL  348



Lambda      K        H        a         alpha
   0.332    0.144    0.431    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 808080


  Database: f1c922cf82cb78144fa9a9cccd11b83a.SwissProt.fasta
    Posted date:  Sep 26, 2020  6:56 PM
  Number of letters in database: 5,185
  Number of sequences in database:  19



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40