ACIAD1840 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: a9346ee39934b70d806da56c510a42b8.TrEMBL.fasta
           23 sequences; 6,538 total letters



Query= ACIAD1840

Length=89
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FB90 Putative transcriptional regulator (AraC family) [Acinet...   176    2e-61
  A0A2M8MDQ0 HTH araC/xylS-type domain-containing protein [Acinet...   165    6e-57
  N8WH64 HTH araC/xylS-type domain-containing protein [Acinetobac...   153    6e-50
  N9K2V9 HTH araC/xylS-type domain-containing protein [Acinetobac...   152    3e-49
  A0A0B0KM12 Transcriptional regulator, AraC family [Acinetobacte...   151    4e-49
  N9PZR8 HTH araC/xylS-type domain-containing protein [Acinetobac...   151    4e-49
  N9P4G3 HTH araC/xylS-type domain-containing protein [Acinetobac...   151    4e-49
  V2UXE5 HTH araC/xylS-type domain-containing protein [Acinetobac...   151    5e-49
  N8XM39 HTH araC/xylS-type domain-containing protein [Acinetobac...   150    8e-49
  N9R2S5 HTH araC/xylS-type domain-containing protein [Acinetobac...   150    1e-48
  N9PNS7 HTH araC/xylS-type domain-containing protein [Acinetobac...   149    2e-48
  S3TA52 AraC family transcriptional regulator [Acinetobacter col...   149    2e-48
  N9Q5E0 HTH araC/xylS-type domain-containing protein [Acinetobac...   148    8e-48
  A8KCK0 HTH AraC-type regulator [[Polyangium] brachysporum]           103    4e-31
  A0A1Y0B7R6 AraC-family transcriptional regulator [Pseudomonas a...   100    5e-30
  E2D2R1 AraC family transcriptional regulator [Escherichia coli]     81.6    4e-23
  B4XH84 AraC [Actinobacillus pleuropneumoniae]                       79.3    2e-22
  Q9X950 HTH araC/xylS-type domain-containing protein [Streptomyc...  58.2    7e-15
  Q9AQK3 Transcription regulator [Acinetobacter sp. M-1]              55.1    2e-13
  Q08G08 AraC family transcriptional regulator [Acinetobacter hae...  51.6    3e-12
  O30507 ArgR [Pseudomonas aeruginosa]                                49.7    2e-11
  F8TW81 Putative AraC-type transcription regulator [Sphingomonas...  48.5    4e-11
  Q84H26 DarR [Pseudomonas chlororaphis subsp. aurantiaca]            48.5    4e-11


> Q6FB90 Putative transcriptional regulator (AraC family) [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=88

 Score =  176 bits (447),  Expect = 2e-61
 Identities = 88/88 (100%), Positives = 88/88 (100%), Gaps = 0/88 (0%)

Query  1   MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
           MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE
Sbjct  1   MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60

Query  61  SASQFSREYSRLFGESPQRDIQRIKQNT  88
           SASQFSREYSRLFGESPQRDIQRIKQNT
Sbjct  61  SASQFSREYSRLFGESPQRDIQRIKQNT  88


> A0A2M8MDQ0 HTH araC/xylS-type domain-containing protein [Acinetobacter 
seifertii]
Length=88

 Score =  165 bits (417),  Expect = 6e-57
 Identities = 82/88 (93%), Positives = 84/88 (95%), Gaps = 0/88 (0%)

Query  1   MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
           MD+LAER FMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLN NLDAGRAA  VGYE
Sbjct  1   MDDLAERAFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNQNLDAGRAASLVGYE  60

Query  61  SASQFSREYSRLFGESPQRDIQRIKQNT  88
           SASQFSREYSRLFGESPQRDIQR+KQNT
Sbjct  61  SASQFSREYSRLFGESPQRDIQRMKQNT  88


> N8WH64 HTH araC/xylS-type domain-containing protein [Acinetobacter 
sp. NIPH 758]
Length=302

 Score =  153 bits (387),  Expect = 6e-50
 Identities = 74/87 (85%), Positives = 81/87 (93%), Gaps = 0/87 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            MD+LA++ FMSPSTFRQHFR VTGMSPLQYQKQLRLQEARHLM N N+DAGRAA  VGYE
Sbjct  215  MDDLADKAFMSPSTFRQHFRAVTGMSPLQYQKQLRLQEARHLMFNQNIDAGRAAALVGYE  274

Query  61   SASQFSREYSRLFGESPQRDIQRIKQN  87
            SASQFSREYSRLFGESPQRDIQR++Q+
Sbjct  275  SASQFSREYSRLFGESPQRDIQRMRQS  301


> N9K2V9 HTH araC/xylS-type domain-containing protein [Acinetobacter 
sp. ANC 3929]
Length=302

 Score =  152 bits (383),  Expect = 3e-49
 Identities = 74/86 (86%), Positives = 80/86 (93%), Gaps = 0/86 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            MD+LA++ FMSPSTFRQHFR VTGMSPLQYQKQLRLQEARHLM N N+DAGRAA  VGYE
Sbjct  215  MDDLADKAFMSPSTFRQHFRAVTGMSPLQYQKQLRLQEARHLMFNQNIDAGRAAGLVGYE  274

Query  61   SASQFSREYSRLFGESPQRDIQRIKQ  86
            SASQFSREYSRLFGESPQRDIQR++Q
Sbjct  275  SASQFSREYSRLFGESPQRDIQRMRQ  300


> A0A0B0KM12 Transcriptional regulator, AraC family [Acinetobacter 
sp. neg1]
Length=302

 Score =  151 bits (382),  Expect = 4e-49
 Identities = 74/86 (86%), Positives = 80/86 (93%), Gaps = 0/86 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            MD+LA++ FMSPSTFRQHFR VTGMSPLQYQKQLRLQEARHLM N N+DAGRAA  VGYE
Sbjct  215  MDDLADKAFMSPSTFRQHFRAVTGMSPLQYQKQLRLQEARHLMFNQNVDAGRAAGLVGYE  274

Query  61   SASQFSREYSRLFGESPQRDIQRIKQ  86
            SASQFSREYSRLFGESPQRDIQR++Q
Sbjct  275  SASQFSREYSRLFGESPQRDIQRMRQ  300


> N9PZR8 HTH araC/xylS-type domain-containing protein [Acinetobacter 
sp. NIPH 2168]
Length=302

 Score =  151 bits (382),  Expect = 4e-49
 Identities = 74/86 (86%), Positives = 80/86 (93%), Gaps = 0/86 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            MD+LA++ FMSPSTFRQHFR VTGMSPLQYQKQLRLQEARHLM N N+DAGRAA  VGYE
Sbjct  215  MDDLADKAFMSPSTFRQHFRAVTGMSPLQYQKQLRLQEARHLMFNQNVDAGRAAGLVGYE  274

Query  61   SASQFSREYSRLFGESPQRDIQRIKQ  86
            SASQFSREYSRLFGESPQRDIQR++Q
Sbjct  275  SASQFSREYSRLFGESPQRDIQRMRQ  300


> N9P4G3 HTH araC/xylS-type domain-containing protein [Acinetobacter 
sp. CIP 64.2]
Length=302

 Score =  151 bits (382),  Expect = 4e-49
 Identities = 74/86 (86%), Positives = 80/86 (93%), Gaps = 0/86 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            MD+LA++ FMSPSTFRQHFR VTGMSPLQYQKQLRLQEARHLM N N+DAGRAA  VGYE
Sbjct  215  MDDLADKAFMSPSTFRQHFRAVTGMSPLQYQKQLRLQEARHLMFNQNVDAGRAAGLVGYE  274

Query  61   SASQFSREYSRLFGESPQRDIQRIKQ  86
            SASQFSREYSRLFGESPQRDIQR++Q
Sbjct  275  SASQFSREYSRLFGESPQRDIQRMRQ  300


> V2UXE5 HTH araC/xylS-type domain-containing protein [Acinetobacter 
gyllenbergii NIPH 230]
Length=302

 Score =  151 bits (381),  Expect = 5e-49
 Identities = 74/86 (86%), Positives = 80/86 (93%), Gaps = 0/86 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            MD+LA++ FMSPSTFRQHFR VTGMSPLQYQKQLRLQEARHLM N N+DAGRAA  VGYE
Sbjct  215  MDDLADQAFMSPSTFRQHFRAVTGMSPLQYQKQLRLQEARHLMFNQNVDAGRAAGLVGYE  274

Query  61   SASQFSREYSRLFGESPQRDIQRIKQ  86
            SASQFSREYSRLFGESPQRDIQR++Q
Sbjct  275  SASQFSREYSRLFGESPQRDIQRMRQ  300


> N8XM39 HTH araC/xylS-type domain-containing protein [Acinetobacter 
sp. CIP 56.2]
Length=307

 Score =  150 bits (380),  Expect = 8e-49
 Identities = 74/86 (86%), Positives = 79/86 (92%), Gaps = 0/86 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            MD+LA + FMSPSTFRQHFR VTGMSPLQYQKQLRLQEARHLM N N+DAGRAA  VGYE
Sbjct  220  MDDLANQAFMSPSTFRQHFRAVTGMSPLQYQKQLRLQEARHLMFNQNIDAGRAAGLVGYE  279

Query  61   SASQFSREYSRLFGESPQRDIQRIKQ  86
            SASQFSREYSRLFGESPQRDIQR++Q
Sbjct  280  SASQFSREYSRLFGESPQRDIQRMRQ  305


> N9R2S5 HTH araC/xylS-type domain-containing protein [Acinetobacter 
sp. NIPH 1867]
Length=302

 Score =  150 bits (379),  Expect = 1e-48
 Identities = 74/86 (86%), Positives = 79/86 (92%), Gaps = 0/86 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            MD+LA + FMSPSTFRQHFR VTGMSPLQYQKQLRLQEARHLM N N+DAGRAA  VGYE
Sbjct  215  MDDLANQAFMSPSTFRQHFRAVTGMSPLQYQKQLRLQEARHLMFNQNVDAGRAAGLVGYE  274

Query  61   SASQFSREYSRLFGESPQRDIQRIKQ  86
            SASQFSREYSRLFGESPQRDIQR++Q
Sbjct  275  SASQFSREYSRLFGESPQRDIQRMRQ  300


> N9PNS7 HTH araC/xylS-type domain-containing protein [Acinetobacter 
colistiniresistens]
Length=302

 Score =  149 bits (377),  Expect = 2e-48
 Identities = 73/86 (85%), Positives = 79/86 (92%), Gaps = 0/86 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            MD+LA++ FMSPSTFRQHFR VTGMSPLQYQKQLRLQEARHLM N N+DAG AA  VGYE
Sbjct  215  MDDLADKAFMSPSTFRQHFRAVTGMSPLQYQKQLRLQEARHLMFNQNVDAGHAAGLVGYE  274

Query  61   SASQFSREYSRLFGESPQRDIQRIKQ  86
            SASQFSREYSRLFGESPQRDIQR++Q
Sbjct  275  SASQFSREYSRLFGESPQRDIQRMRQ  300


> S3TA52 AraC family transcriptional regulator [Acinetobacter colistiniresistens]
Length=302

 Score =  149 bits (377),  Expect = 2e-48
 Identities = 73/86 (85%), Positives = 79/86 (92%), Gaps = 0/86 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            MD+LA++ FMSPSTFRQHFR VTGMSPLQYQKQLRLQEARHLM N N+DAG AA  VGYE
Sbjct  215  MDDLADKAFMSPSTFRQHFRAVTGMSPLQYQKQLRLQEARHLMFNQNVDAGHAAGLVGYE  274

Query  61   SASQFSREYSRLFGESPQRDIQRIKQ  86
            SASQFSREYSRLFGESPQRDIQR++Q
Sbjct  275  SASQFSREYSRLFGESPQRDIQRMRQ  300


> N9Q5E0 HTH araC/xylS-type domain-containing protein [Acinetobacter 
sp. NIPH 2100]
Length=302

 Score =  148 bits (373),  Expect = 8e-48
 Identities = 73/87 (84%), Positives = 79/87 (91%), Gaps = 0/87 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            MD+LA + FMSPSTFRQHFR VTGMSPLQYQKQLRLQEARHLM N N++AGRAA  VGYE
Sbjct  215  MDDLANQAFMSPSTFRQHFRAVTGMSPLQYQKQLRLQEARHLMFNQNIEAGRAAGLVGYE  274

Query  61   SASQFSREYSRLFGESPQRDIQRIKQN  87
            SASQFSREYSRLFGESPQRDIQR +Q+
Sbjct  275  SASQFSREYSRLFGESPQRDIQRRRQD  301


> A8KCK0 HTH AraC-type regulator [[Polyangium] brachysporum]
Length=322

 Score =  103 bits (258),  Expect = 4e-31
 Identities = 51/80 (64%), Positives = 62/80 (78%), Gaps = 0/80 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            +DELA    MS S+   HFR +T MSPLQYQKQLRLQEAR LML+  ++  +AA +VGYE
Sbjct  232  VDELARCCCMSTSSLHHHFRVLTSMSPLQYQKQLRLQEARRLMLSEGIEVSKAAYTVGYE  291

Query  61   SASQFSREYSRLFGESPQRD  80
            SASQFSREYSRL+G +P +D
Sbjct  292  SASQFSREYSRLYGIAPSKD  311


> A0A1Y0B7R6 AraC-family transcriptional regulator [Pseudomonas 
aeruginosa]
Length=310

 Score =  100 bits (250),  Expect = 5e-30
 Identities = 50/85 (59%), Positives = 61/85 (72%), Gaps = 0/85 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            +++LA+ V +SPST    F+ VT MSPLQYQKQLRLQEAR L+ +  L+   A   VGYE
Sbjct  223  IEQLAQVVNLSPSTLHHRFKAVTAMSPLQYQKQLRLQEARRLIFSEGLEVAAAGYRVGYE  282

Query  61   SASQFSREYSRLFGESPQRDIQRIK  85
            S SQFSREYSRLFG  P RD+ R +
Sbjct  283  SPSQFSREYSRLFGAPPLRDLARAR  307


> E2D2R1 AraC family transcriptional regulator [Escherichia coli]
Length=318

 Score = 81.6 bits (200),  Expect = 4e-23
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 0/85 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            +++LA    MS S F  +F+ VT  SPLQY K  RL +AR ++++  + A  AA+ VGYE
Sbjct  229  VEQLAAEANMSVSAFHHNFKSVTSTSPLQYLKNYRLHKARMMIIHDGMKASAAAMRVGYE  288

Query  61   SASQFSREYSRLFGESPQRDIQRIK  85
            SASQFSRE+ R FG +P  D  R++
Sbjct  289  SASQFSREFKRYFGVTPGEDAARMR  313


 Score = 16.2 bits (30),  Expect = 4.8
 Identities = 6/23 (26%), Positives = 12/23 (52%), Gaps = 0/23 (0%)

Query  55  ISVGYESASQFSREYSRLFGESP  77
           + +   S S+   +   L+GE+P
Sbjct  36  LKIKENSLSELLPDVRLLYGETP  58


> B4XH84 AraC [Actinobacillus pleuropneumoniae]
Length=284

 Score = 79.3 bits (194),  Expect = 2e-22
 Identities = 41/80 (51%), Positives = 52/80 (65%), Gaps = 0/80 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            +D+LA++  MS S F  HF+++T MSPLQYQK  RL  A+ L+     +    A  VGYE
Sbjct  203  VDDLAKQAGMSVSGFHSHFKKMTNMSPLQYQKSHRLLAAQRLIQAKQSNIASVAFQVGYE  262

Query  61   SASQFSREYSRLFGESPQRD  80
            S SQFSREY R FG SP+ D
Sbjct  263  SPSQFSREYKRHFGVSPKGD  282


 Score = 15.4 bits (28),  Expect = 8.8
 Identities = 9/33 (27%), Positives = 13/33 (39%), Gaps = 0/33 (0%)

Query  17  QHFREVTGMSPLQYQKQLRLQEARHLMLNHNLD  49
           QHF       PL  +      E  +LM+   +D
Sbjct  66  QHFMFCPVNVPLSVEVVEASPEKPYLMMTMKID  98


> Q9X950 HTH araC/xylS-type domain-containing protein [Streptomyces 
coelicolor]
Length=233

 Score = 58.2 bits (139),  Expect = 7e-15
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 0/77 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            +DELA    MS  TF + FRE TG+SP ++  Q RL+ ARHL+ + +L   R A  VG+ 
Sbjct  145  LDELAAHAAMSTRTFARRFREETGLSPGRWLTQQRLRRARHLLESSDLPVERVAHEVGFA  204

Query  61   SASQFSREYSRLFGESP  77
            +A+   R  +   G +P
Sbjct  205  TATSLRRHLAAEAGVAP  221


> Q9AQK3 Transcription regulator [Acinetobacter sp. M-1]
Length=318

 Score = 55.1 bits (131),  Expect = 2e-13
 Identities = 30/79 (38%), Positives = 43/79 (54%), Gaps = 0/79 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            ++ LAE+  MS S F   F EV G SPL Y +Q R++ A   +   N    + A  VGY 
Sbjct  230  VESLAEQCCMSRSKFASLFHEVIGESPLAYLQQHRMRLASQYLRKSNFSVQQIANKVGYS  289

Query  61   SASQFSREYSRLFGESPQR  79
            S + FS+ + R F  SP++
Sbjct  290  SETAFSQAFKRTFEHSPKQ  308


 Score = 24.6 bits (52),  Expect = 0.006
 Identities = 13/40 (33%), Positives = 23/40 (58%), Gaps = 1/40 (3%)

Query  1    MDELAERV-FMSPSTFRQHFREVTGMSPLQYQKQLRLQEA  39
            + ++A +V + S + F Q F+     SP QY++Q   QE+
Sbjct  279  VQQIANKVGYSSETAFSQAFKRTFEHSPKQYRQQFVEQES  318


 Score = 19.2 bits (38),  Expect = 0.44
 Identities = 8/23 (35%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  61   SASQFSREYSRLFGESPQRDIQR  83
            S S+F+  +  + GESP   +Q+
Sbjct  240  SRSKFASLFHEVIGESPLAYLQQ  262


> Q08G08 AraC family transcriptional regulator [Acinetobacter haemolyticus]
Length=310

 Score = 51.6 bits (122),  Expect = 3e-12
 Identities = 30/79 (38%), Positives = 42/79 (53%), Gaps = 0/79 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            ++ LAE+  MS S F   F EV G SPL Y +Q R++ A   +   N      A  VGY 
Sbjct  222  VESLAEQCCMSRSKFASLFHEVIGESPLAYLQQHRMRLASQYLRKSNYSIQVIANKVGYS  281

Query  61   SASQFSREYSRLFGESPQR  79
            S + FS+ + R F  SP++
Sbjct  282  SETAFSQAFKRTFELSPKQ  300


 Score = 23.1 bits (48),  Expect = 0.020
 Identities = 9/25 (36%), Positives = 15/25 (60%), Gaps = 0/25 (0%)

Query  9    FMSPSTFRQHFREVTGMSPLQYQKQ  33
            + S + F Q F+    +SP QY++Q
Sbjct  280  YSSETAFSQAFKRTFELSPKQYRQQ  304


 Score = 19.2 bits (38),  Expect = 0.44
 Identities = 8/23 (35%), Positives = 14/23 (61%), Gaps = 0/23 (0%)

Query  61   SASQFSREYSRLFGESPQRDIQR  83
            S S+F+  +  + GESP   +Q+
Sbjct  232  SRSKFASLFHEVIGESPLAYLQQ  254


 Score = 17.7 bits (34),  Expect = 1.4
 Identities = 6/13 (46%), Positives = 9/13 (69%), Gaps = 0/13 (0%)

Query  10   MSPSTFRQHFREV  22
            +SP  +RQ + EV
Sbjct  296  LSPKQYRQQYVEV  308


> O30507 ArgR [Pseudomonas aeruginosa]
Length=329

 Score = 49.7 bits (117),  Expect = 2e-11
 Identities = 24/79 (30%), Positives = 40/79 (51%), Gaps = 0/79 (0%)

Query  2    DELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
            DE+A+ V +S     + F++     P QY  +LRL  AR +++  +    +  +S G+ S
Sbjct  231  DEIAQHVCVSRRQLERIFKQYLNRVPSQYYLELRLNRARQMLMQTSKSIIQIGLSCGFSS  290

Query  62   ASQFSREYSRLFGESPQRD  80
               FS  Y   FG +P+ D
Sbjct  291  GPHFSSAYRNFFGVTPRED  309


> F8TW81 Putative AraC-type transcription regulator [Sphingomonas 
sp. TTNP3]
Length=281

 Score = 48.5 bits (114),  Expect = 4e-11
 Identities = 26/77 (34%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            +D+LAE V +SP  F + F+  TG +P QY  ++R+  ARHL+   +L     A   G+ 
Sbjct  197  IDDLAEAVGLSPIHFARQFKRSTGKAPHQYLIEMRVSRARHLLAG-DLPIAEIAYRCGFS  255

Query  61   SASQFSREYSRLFGESP  77
                 +R + R  G +P
Sbjct  256  HQEHLTRLFGRQQGTTP  272


 Score = 15.8 bits (29),  Expect = 6.5
 Identities = 6/13 (46%), Positives = 8/13 (62%), Gaps = 0/13 (0%)

Query  61  SASQFSREYSRLF  73
           ++ QF R YS  F
Sbjct  21  ASHQFERPYSDRF  33


> Q84H26 DarR [Pseudomonas chlororaphis subsp. aurantiaca]
Length=330

 Score = 48.5 bits (114),  Expect = 4e-11
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 0/75 (0%)

Query  4    LAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYESAS  63
            LA +V MS  +F +H+R  TG +P +  +Q+R++ AR L+ +  +   R A+  G+ S  
Sbjct  241  LAAQVGMSERSFVRHYRADTGQTPARVIEQIRVENARRLLGDSCVPIKRIAVQCGFGSEE  300

Query  64   QFSREYSRLFGESPQ  78
               R + R  G +PQ
Sbjct  301  TLRRSFLRAMGVTPQ  315


 Score = 22.3 bits (46),  Expect = 0.038
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query  44   LNHNLDAGRAAISVGYESASQFSREYSRLFGESPQRDIQRIK  85
            L  +L+    A  VG    S F R Y    G++P R I++I+
Sbjct  232  LGRDLNIPTLAAQVGMSERS-FVRHYRADTGQTPARVIEQIR  272



Lambda      K        H        a         alpha
   0.327    0.135    0.385    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 302630


  Database: a9346ee39934b70d806da56c510a42b8.TrEMBL.fasta
    Posted date:  Sep 25, 2020  11:56 AM
  Number of letters in database: 6,538
  Number of sequences in database:  23



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40