ACIAD1840 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: af0850e2e6e9bb8fa6fd1c7191ff1b3a.SwissProt.fasta
           20 sequences; 5,541 total letters



Query= ACIAD1840

Length=89
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q46855 Uncharacterized HTH-type transcriptional regulator YqhC ...  81.6    4e-23
  P77379 RCS-specific HTH-type transcriptional activator RclR [Es...  54.7    2e-13
  B7LVD8 HTH-type transcriptional activator RhaS [Escherichia fer...  51.2    3e-12
  B6I4P8 HTH-type transcriptional activator RhaS [Escherichia col...  50.4    6e-12
  Q00753 Msm operon regulatory protein [Streptococcus mutans sero...  50.1    8e-12
  A7ZUB7 HTH-type transcriptional activator RhaS [Escherichia col...  50.1    8e-12
  G3XCU2 HTH-type transcriptional regulator ArgR [Pseudomonas aer...  49.7    1e-11
  Q32A70 HTH-type transcriptional activator RhaS [Shigella dysent...  49.3    2e-11
  Q0SZ95 HTH-type transcriptional activator RhaS [Shigella flexne...  49.3    2e-11
  Q83PE0 HTH-type transcriptional activator RhaS [Shigella flexneri]  49.3    2e-11
  Q3YV71 HTH-type transcriptional activator RhaS [Shigella sonnei...  49.3    2e-11
  P09377 HTH-type transcriptional activator RhaS [Escherichia col...  49.3    2e-11
  P76138 Putative HTH-type transcriptional regulator YneL [Escher...  46.6    2e-11
  P28809 MmsAB operon regulatory protein [Pseudomonas aeruginosa ...  49.3    2e-11
  O31249 HTH-type transcriptional regulator AlkR [Acinetobacter b...  48.9    2e-11
  Q9HTH5 HTH-type transcriptional regulator CdhR [Pseudomonas aer...  48.9    3e-11
  P26993 HTH-type transcriptional regulator ExsA [Pseudomonas aer...  48.5    3e-11
  Q51872 Probable transcriptional regulator LumQ [Photobacterium ...  47.8    5e-11
  P40883 Regulatory protein PchR [Pseudomonas aeruginosa (strain ...  47.8    6e-11
  P0A2S9 HTH-type transcriptional activator RhaS [Salmonella typh...  47.0    1e-10


> Q46855 Uncharacterized HTH-type transcriptional regulator YqhC 
[Escherichia coli (strain K12)]
Length=318

 Score = 81.6 bits (200),  Expect = 4e-23
 Identities = 40/85 (47%), Positives = 56/85 (66%), Gaps = 0/85 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            +++LA    MS S F  +F+ VT  SPLQY K  RL +AR ++++  + A  AA+ VGYE
Sbjct  229  VEQLAAEANMSVSAFHHNFKSVTSTSPLQYLKNYRLHKARMMIIHDGMKASAAAMRVGYE  288

Query  61   SASQFSREYSRLFGESPQRDIQRIK  85
            SASQFSRE+ R FG +P  D  R++
Sbjct  289  SASQFSREFKRYFGVTPGEDAARMR  313


> P77379 RCS-specific HTH-type transcriptional activator RclR [Escherichia 
coli (strain K12)]
Length=284

 Score = 54.7 bits (130),  Expect = 2e-13
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 0/86 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            ++ LA    MS ++F Q FR+V+G +PL    +LRLQ A  +     L     A SVGY 
Sbjct  196  VESLASIAHMSRASFAQLFRDVSGTTPLAVLTKLRLQIAAQMFSRETLPVVVIAESVGYA  255

Query  61   SASQFSREYSRLFGESPQRDIQRIKQ  86
            S S F + + R FG +P    +R++Q
Sbjct  256  SESSFHKAFVREFGCTPGEYRERVRQ  281


> B7LVD8 HTH-type transcriptional activator RhaS [Escherichia fergusonii 
(strain ATCC 35469 / DSM 13698 / CDC 0568-73)]
Length=278

 Score = 51.2 bits (121),  Expect = 3e-12
 Identities = 25/77 (32%), Positives = 45/77 (58%), Gaps = 0/77 (0%)

Query  2    DELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
            + +A+R  +S  T  +  ++ TG++P +Y  +LRL +ARHL+ + +      A S G+  
Sbjct  191  EAIADRFALSLRTLHRQLKQHTGLTPQRYLNRLRLVKARHLLRHSDDSVTHIAFSCGFAD  250

Query  62   ASQFSREYSRLFGESPQ  78
            ++ FS  + R FG SP+
Sbjct  251  SNHFSTLFRREFGWSPR  267


> B6I4P8 HTH-type transcriptional activator RhaS [Escherichia coli 
(strain SE11)]
Length=278

 Score = 50.4 bits (119),  Expect = 6e-12
 Identities = 27/82 (33%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query  2    DELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
            D +AE+  +S  T  +  ++ TG++P +Y  +LRL +ARHL+ +        A   G+  
Sbjct  191  DAVAEQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYRCGFSD  250

Query  62   ASQFSREYSRLFGESPQRDIQR  83
            ++ FS  + R F  SP RDI++
Sbjct  251  SNHFSTLFRREFNWSP-RDIRQ  271


 Score = 16.2 bits (30),  Expect = 4.0
 Identities = 22/79 (28%), Positives = 34/79 (43%), Gaps = 13/79 (16%)

Query  20   REVTGMSPLQYQKQLRLQE-----ARHLMLNHNLDAGRAAISVGYES-ASQFS-------  66
            RE+  M  L   ++  LQE     A  L L         A  V +++ A QFS       
Sbjct  146  REILFMQLLLLLRKSSLQENLENSASRLNLLLAWLEDHFADEVNWDAVAEQFSLSLRTLH  205

Query  67   REYSRLFGESPQRDIQRIK  85
            R+  +  G +PQR + R++
Sbjct  206  RQLKQQTGLTPQRYLNRLR  224


> Q00753 Msm operon regulatory protein [Streptococcus mutans serotype 
c (strain ATCC 700610 / UA159)]
Length=278

 Score = 50.1 bits (118),  Expect = 8e-12
 Identities = 24/87 (28%), Positives = 52/87 (60%), Gaps = 0/87 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            ++++A+++ +S S   + FR+ T +S  +Y  Q+R++ +++L+ N  L     + SVG+ 
Sbjct  192  VNDIAKKLNLSRSYLYKIFRKSTNLSIKEYILQVRMKRSQYLLENPKLSIAEISNSVGFS  251

Query  61   SASQFSREYSRLFGESPQRDIQRIKQN  87
             +  FS+ +   FG+SP +  + I+ N
Sbjct  252  DSLAFSKAFKNYFGKSPSKFRKEIQNN  278


> A7ZUB7 HTH-type transcriptional activator RhaS [Escherichia coli 
O139:H28 (strain E24377A / ETEC)]
Length=278

 Score = 50.1 bits (118),  Expect = 8e-12
 Identities = 27/82 (33%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query  2    DELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
            D +AE+  +S  T  +  ++ TG++P +Y  +LRL +ARHL+ +        A   G+  
Sbjct  191  DAVAEQFSLSLRTLHRQLKQQTGVTPQRYLNRLRLMKARHLLRHSEASVTDIAYRCGFSD  250

Query  62   ASQFSREYSRLFGESPQRDIQR  83
            ++ FS  + R F  SP RDI++
Sbjct  251  SNHFSTLFRREFNWSP-RDIRQ  271


 Score = 16.5 bits (31),  Expect = 3.0
 Identities = 22/79 (28%), Positives = 34/79 (43%), Gaps = 13/79 (16%)

Query  20   REVTGMSPLQYQKQLRLQE-----ARHLMLNHNLDAGRAAISVGYES-ASQFS-------  66
            RE+  M  L   ++  LQE     A  L L         A  V +++ A QFS       
Sbjct  146  REILFMQLLLLLRKSSLQENLENSASRLNLLLAWLEDHFADEVNWDAVAEQFSLSLRTLH  205

Query  67   REYSRLFGESPQRDIQRIK  85
            R+  +  G +PQR + R++
Sbjct  206  RQLKQQTGVTPQRYLNRLR  224


> G3XCU2 HTH-type transcriptional regulator ArgR [Pseudomonas aeruginosa 
(strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 
14847 / LMG 12228 / 1C / PRS 101 / PAO1)]
Length=329

 Score = 49.7 bits (117),  Expect = 1e-11
 Identities = 24/79 (30%), Positives = 40/79 (51%), Gaps = 0/79 (0%)

Query  2    DELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
            DE+A+ V +S     + F++     P QY  +LRL  AR +++  +    +  +S G+ S
Sbjct  231  DEIAQHVCVSRRQLERIFKQYLNRVPSQYYLELRLNRARQMLMQTSKSIIQIGLSCGFSS  290

Query  62   ASQFSREYSRLFGESPQRD  80
               FS  Y   FG +P+ D
Sbjct  291  GPHFSSAYRNFFGVTPRED  309


> Q32A70 HTH-type transcriptional activator RhaS [Shigella dysenteriae 
serotype 1 (strain Sd197)]
Length=278

 Score = 49.3 bits (116),  Expect = 2e-11
 Identities = 26/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query  2    DELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
            D +A++  +S  T  +  ++ TG++P +Y  +LRL +ARHL+ +        A   G+  
Sbjct  191  DAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYRCGFSD  250

Query  62   ASQFSREYSRLFGESPQRDIQR  83
            ++ FS  + R F  SP RDI++
Sbjct  251  SNHFSTLFRREFNWSP-RDIRQ  271


 Score = 16.2 bits (30),  Expect = 4.0
 Identities = 22/79 (28%), Positives = 34/79 (43%), Gaps = 13/79 (16%)

Query  20   REVTGMSPLQYQKQLRLQE-----ARHLMLNHNLDAGRAAISVGYES-ASQFS-------  66
            RE+  M  L   ++  LQE     A  L L         A  V +++ A QFS       
Sbjct  146  REILFMQLLLLLRKSSLQENLENSASRLNLLLAWLEDHFADEVNWDAVADQFSLSLRTLH  205

Query  67   REYSRLFGESPQRDIQRIK  85
            R+  +  G +PQR + R++
Sbjct  206  RQLKQQTGLTPQRYLNRLR  224


> Q0SZ95 HTH-type transcriptional activator RhaS [Shigella flexneri 
serotype 5b (strain 8401)]
Length=278

 Score = 49.3 bits (116),  Expect = 2e-11
 Identities = 26/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query  2    DELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
            D +A++  +S  T  +  ++ TG++P +Y  +LRL +ARHL+ +        A   G+  
Sbjct  191  DAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYRCGFSD  250

Query  62   ASQFSREYSRLFGESPQRDIQR  83
            ++ FS  + R F  SP RDI++
Sbjct  251  SNHFSTLFRREFNWSP-RDIRQ  271


 Score = 16.2 bits (30),  Expect = 4.0
 Identities = 22/79 (28%), Positives = 34/79 (43%), Gaps = 13/79 (16%)

Query  20   REVTGMSPLQYQKQLRLQE-----ARHLMLNHNLDAGRAAISVGYES-ASQFS-------  66
            RE+  M  L   ++  LQE     A  L L         A  V +++ A QFS       
Sbjct  146  REILFMQLLLLLRKSSLQENLENSASRLNLLLAWLEDHFADEVNWDAVADQFSLSLRTLH  205

Query  67   REYSRLFGESPQRDIQRIK  85
            R+  +  G +PQR + R++
Sbjct  206  RQLKQQTGLTPQRYLNRLR  224


> Q83PE0 HTH-type transcriptional activator RhaS [Shigella flexneri]
Length=278

 Score = 49.3 bits (116),  Expect = 2e-11
 Identities = 26/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query  2    DELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
            D +A++  +S  T  +  ++ TG++P +Y  +LRL +ARHL+ +        A   G+  
Sbjct  191  DAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYRCGFSD  250

Query  62   ASQFSREYSRLFGESPQRDIQR  83
            ++ FS  + R F  SP RDI++
Sbjct  251  SNHFSTLFRREFNWSP-RDIRQ  271


 Score = 16.2 bits (30),  Expect = 4.0
 Identities = 22/79 (28%), Positives = 34/79 (43%), Gaps = 13/79 (16%)

Query  20   REVTGMSPLQYQKQLRLQE-----ARHLMLNHNLDAGRAAISVGYES-ASQFS-------  66
            RE+  M  L   ++  LQE     A  L L         A  V +++ A QFS       
Sbjct  146  REILFMQLLLLLRKSSLQENLENSASRLNLLLAWLEDHFADEVNWDAVADQFSLSLRTLH  205

Query  67   REYSRLFGESPQRDIQRIK  85
            R+  +  G +PQR + R++
Sbjct  206  RQLKQQTGLTPQRYLNRLR  224


> Q3YV71 HTH-type transcriptional activator RhaS [Shigella sonnei 
(strain Ss046)]
Length=278

 Score = 49.3 bits (116),  Expect = 2e-11
 Identities = 26/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query  2    DELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
            D +A++  +S  T  +  ++ TG++P +Y  +LRL +ARHL+ +        A   G+  
Sbjct  191  DAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYRCGFSD  250

Query  62   ASQFSREYSRLFGESPQRDIQR  83
            ++ FS  + R F  SP RDI++
Sbjct  251  SNHFSTLFRREFNWSP-RDIRQ  271


 Score = 16.2 bits (30),  Expect = 4.0
 Identities = 22/79 (28%), Positives = 34/79 (43%), Gaps = 13/79 (16%)

Query  20   REVTGMSPLQYQKQLRLQE-----ARHLMLNHNLDAGRAAISVGYES-ASQFS-------  66
            RE+  M  L   ++  LQE     A  L L         A  V +++ A QFS       
Sbjct  146  REILFMQLLLLLRKSSLQENLENSASRLNLLLAWLEDHFADEVNWDAVADQFSLSLRTLH  205

Query  67   REYSRLFGESPQRDIQRIK  85
            R+  +  G +PQR + R++
Sbjct  206  RQLKQQTGLTPQRYLNRLR  224


> P09377 HTH-type transcriptional activator RhaS [Escherichia coli 
(strain K12)]
Length=278

 Score = 49.3 bits (116),  Expect = 2e-11
 Identities = 26/82 (32%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query  2    DELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
            D +A++  +S  T  +  ++ TG++P +Y  +LRL +ARHL+ +        A   G+  
Sbjct  191  DAVADQFSLSLRTLHRQLKQQTGLTPQRYLNRLRLMKARHLLRHSEASVTDIAYRCGFSD  250

Query  62   ASQFSREYSRLFGESPQRDIQR  83
            ++ FS  + R F  SP RDI++
Sbjct  251  SNHFSTLFRREFNWSP-RDIRQ  271


 Score = 16.2 bits (30),  Expect = 4.0
 Identities = 22/79 (28%), Positives = 34/79 (43%), Gaps = 13/79 (16%)

Query  20   REVTGMSPLQYQKQLRLQE-----ARHLMLNHNLDAGRAAISVGYES-ASQFS-------  66
            RE+  M  L   ++  LQE     A  L L         A  V +++ A QFS       
Sbjct  146  REILFMQLLLLLRKSSLQENLENSASRLNLLLAWLEDHFADEVNWDAVADQFSLSLRTLH  205

Query  67   REYSRLFGESPQRDIQRIK  85
            R+  +  G +PQR + R++
Sbjct  206  RQLKQQTGLTPQRYLNRLR  224


> P76138 Putative HTH-type transcriptional regulator YneL [Escherichia 
coli (strain K12)]
Length=59

 Score = 46.6 bits (109),  Expect = 2e-11
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)

Query  25  MSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
           MSPL+YQK LRL E R  MLN + D   AA +VGYES
Sbjct  1   MSPLRYQKWLRLNEVRRQMLNEHYDVTTAAYAVGYES  37


> P28809 MmsAB operon regulatory protein [Pseudomonas aeruginosa 
(strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / 
LMG 12228 / 1C / PRS 101 / PAO1)]
Length=307

 Score = 49.3 bits (116),  Expect = 2e-11
 Identities = 25/86 (29%), Positives = 48/86 (56%), Gaps = 0/86 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            ++ LA    +S   F   ++ +TG +P+Q+   L+++ A  L+ + +    R   +VGY+
Sbjct  217  LERLAAFCNLSKFHFVSRYKAITGRTPIQHFLHLKIEYACQLLDSSDQSVARVGQAVGYD  276

Query  61   SASQFSREYSRLFGESPQRDIQRIKQ  86
             +  FSR +S++ G SP    QR++Q
Sbjct  277  DSYYFSRLFSKVMGLSPSAYRQRVRQ  302


 Score = 19.2 bits (38),  Expect = 0.37
 Identities = 7/15 (47%), Positives = 10/15 (67%), Gaps = 0/15 (0%)

Query  10   MSPSTFRQHFREVTG  24
            +SPS +RQ  R+  G
Sbjct  291  LSPSAYRQRVRQGEG  305


 Score = 15.8 bits (29),  Expect = 5.5
 Identities = 9/24 (38%), Positives = 10/24 (42%), Gaps = 0/24 (0%)

Query  28   LQYQKQLRLQEARHLMLNHNLDAG  51
            LQ+    R    RH  L H L  G
Sbjct  133  LQHSAGYRDTPLRHWGLQHALLGG  156


> O31249 HTH-type transcriptional regulator AlkR [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=306

 Score = 48.9 bits (115),  Expect = 2e-11
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 0/78 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            ++ LA++  MS S F   F+ +   +PL Y +Q RL+ A  L+    L+  + A  VGY 
Sbjct  223  VESLADQCCMSRSKFATLFQSIVHETPLAYLQQHRLRLAVQLLKTSQLNIQQIANKVGYS  282

Query  61   SASQFSREYSRLFGESPQ  78
            S + FS+ + R F +SP+
Sbjct  283  SETAFSQAFKRQFEQSPK  300


> Q9HTH5 HTH-type transcriptional regulator CdhR [Pseudomonas aeruginosa 
(strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 
14847 / LMG 12228 / 1C / PRS 101 / PAO1)]
Length=336

 Score = 48.9 bits (115),  Expect = 3e-11
 Identities = 27/78 (35%), Positives = 42/78 (54%), Gaps = 0/78 (0%)

Query  3    ELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYESA  62
            ELAER+ ++     + FR     +P  +   LRL +AR L+   +L   + +++ G+ES 
Sbjct  231  ELAERIQVTRRQLERLFRVHLDDTPSNFYLGLRLDKARQLLRQTDLSVLQVSLACGFESP  290

Query  63   SQFSREYSRLFGESPQRD  80
            S FSR Y   F  SP +D
Sbjct  291  SYFSRSYRARFAASPSQD  308


> P26993 HTH-type transcriptional regulator ExsA [Pseudomonas aeruginosa 
(strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 
14847 / LMG 12228 / 1C / PRS 101 / PAO1)]
Length=278

 Score = 48.5 bits (114),  Expect = 3e-11
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 0/82 (0%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            + + +    M  +TF++ F  V G+SP  +  + R+  A  L+LN ++     A+  G+ 
Sbjct  187  LSDFSREFGMGLTTFKELFGSVYGVSPRAWISERRILYAHQLLLNSDMSIVDIAMEAGFS  246

Query  61   SASQFSREYSRLFGESPQRDIQ  82
            S S F++ Y R FG +P R  Q
Sbjct  247  SQSYFTQSYRRRFGCTPSRSRQ  268


> Q51872 Probable transcriptional regulator LumQ [Photobacterium 
leiognathi]
Length=248

 Score = 47.8 bits (112),  Expect = 5e-11
 Identities = 26/77 (34%), Positives = 40/77 (52%), Gaps = 0/77 (0%)

Query  3    ELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYESA  62
            EL+   F++ S F   F+   G++P QY  + RL  A+ L+        + A   G+ S 
Sbjct  166  ELSSVAFLAQSQFYALFKSQMGITPHQYVLRKRLDLAKQLIAERQKPLSQVAQLCGFSSQ  225

Query  63   SQFSREYSRLFGESPQR  79
            S FS+ + RL+G SP R
Sbjct  226  SSFSQAFRRLYGMSPTR  242


 Score = 30.0 bits (66),  Expect = 6e-05
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  9    FMSPSTFRQHFREVTGMSPLQYQKQLR  35
            F S S+F Q FR + GMSP +YQ  +R
Sbjct  222  FSSQSSFSQAFRRLYGMSPTRYQFFIR  248


> P40883 Regulatory protein PchR [Pseudomonas aeruginosa (strain 
ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 
/ 1C / PRS 101 / PAO1)]
Length=296

 Score = 47.8 bits (112),  Expect = 6e-11
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query  1    MDELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYE  60
            +D LA RV M+P      FR+V G S   Y ++ RL+EA  ++ +   +    A  VGY 
Sbjct  217  LDTLASRVGMNPRKLTAGFRKVFGASVFGYLQEYRLREAHRMLCDEEANVSTVAYRVGY-  275

Query  61   SASQFSREYSRLFGESP  77
            S + FS  + + +G SP
Sbjct  276  SPAHFSIAFRKRYGISP  292


> P0A2S9 HTH-type transcriptional activator RhaS [Salmonella typhimurium 
(strain LT2 / SGSC1412 / ATCC 700720)]
Length=278

 Score = 47.0 bits (110),  Expect = 1e-10
 Identities = 26/82 (32%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query  2    DELAERVFMSPSTFRQHFREVTGMSPLQYQKQLRLQEARHLMLNHNLDAGRAAISVGYES  61
            + +AE+  +S  T  +  ++ TG++P +Y  +LRL +ARHL+ + +      A   G+  
Sbjct  191  EAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYRCGFGD  250

Query  62   ASQFSREYSRLFGESPQRDIQR  83
            ++ FS  + R F  SP RDI++
Sbjct  251  SNHFSTLFRREFNWSP-RDIRQ  271



Lambda      K        H        a         alpha
   0.327    0.135    0.385    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 261414


  Database: af0850e2e6e9bb8fa6fd1c7191ff1b3a.SwissProt.fasta
    Posted date:  Sep 26, 2020  7:49 PM
  Number of letters in database: 5,541
  Number of sequences in database:  20



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40