ACIAD1839 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 7c8d1d53153ce8bcb35a782164f29228.TrEMBL.fasta
           12 sequences; 3,543 total letters



Query= ACIAD1839

Length=220
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FB91 Putative transcriptional regulator (AraC family) [Acinet...   429    5e-157
  A0A1Q3NBQ7 AraC family transcriptional regulator [Acinetobacter...   336    2e-119
  N8XM39 HTH araC/xylS-type domain-containing protein [Acinetobac...   234    3e-79 
  V2UXE5 HTH araC/xylS-type domain-containing protein [Acinetobac...   231    3e-78 
  N9R2S5 HTH araC/xylS-type domain-containing protein [Acinetobac...   228    4e-77 
  N9PNS7 HTH araC/xylS-type domain-containing protein [Acinetobac...   225    8e-76 
  S3TA52 AraC family transcriptional regulator [Acinetobacter col...   223    5e-75 
  N9P4G3 HTH araC/xylS-type domain-containing protein [Acinetobac...   222    1e-74 
  N9Q5E0 HTH araC/xylS-type domain-containing protein [Acinetobac...   219    1e-73 
  A0A1Y0B7R6 AraC-family transcriptional regulator [Pseudomonas a...  90.5    6e-25 
  A8KCK0 HTH AraC-type regulator [[Polyangium] brachysporum]          84.7    6e-23 
  B4XH84 AraC [Actinobacillus pleuropneumoniae]                       74.7    1e-19 


> Q6FB91 Putative transcriptional regulator (AraC family) [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=219

 Score =  429 bits (1102),  Expect = 5e-157
 Identities = 218/219 (99%), Positives = 219/219 (100%), Gaps = 0/219 (0%)

Query  1    LIPVSLTERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLV  60
            +IPVSLTERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLV
Sbjct  1    MIPVSLTERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLV  60

Query  61   LQGQKEVIIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVA  120
            LQGQKEVIIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVA
Sbjct  61   LQGQKEVIIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVA  120

Query  121  NLPVEAKTIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLL  180
            NLPVEAKTIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLL
Sbjct  121  NLPVEAKTIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLL  180

Query  181  NSSQGISFTPTGKVWFGKSKDSSNRELAKKQFRTTHPYG  219
            NSSQGISFTPTGKVWFGKSKDSSNRELAKKQFRTTHPYG
Sbjct  181  NSSQGISFTPTGKVWFGKSKDSSNRELAKKQFRTTHPYG  219


> A0A1Q3NBQ7 AraC family transcriptional regulator [Acinetobacter 
sp. 38-8]
Length=289

 Score =  336 bits (861),  Expect = 2e-119
 Identities = 170/185 (92%), Positives = 179/185 (97%), Gaps = 0/185 (0%)

Query  2    IPVSLTERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLVL  61
            +PVSLTERSKNLD+LIQKVSHLAETEGDHDSIISGL FHNRMSPTDS HCIYSMGLSLVL
Sbjct  1    MPVSLTERSKNLDQLIQKVSHLAETEGDHDSIISGLYFHNRMSPTDSIHCIYSMGLSLVL  60

Query  62   QGQKEVIIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVAN  121
            QGQKEVIIGD VYQCHEGHSMLTMMDLPVTSR++NASSQKPFLAVLLLLDIQ+VNELVAN
Sbjct  61   QGQKEVIIGDKVYQCHEGHSMLTMMDLPVTSRVVNASSQKPFLAVLLLLDIQIVNELVAN  120

Query  122  LPVEAKTIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLLN  181
            LPVEA  IISND+HESFSVE VDISLIDA++RLVKMLDEPK+IPHLADLVKKEIIIRLLN
Sbjct  121  LPVEAIPIISNDTHESFSVELVDISLIDAILRLVKMLDEPKLIPHLADLVKKEIIIRLLN  180

Query  182  SSQGI  186
            SSQGI
Sbjct  181  SSQGI  185


> N8XM39 HTH araC/xylS-type domain-containing protein [Acinetobacter 
sp. CIP 56.2]
Length=307

 Score =  234 bits (596),  Expect = 3e-79
 Identities = 113/178 (63%), Positives = 143/178 (80%), Gaps = 1/178 (1%)

Query  8    ERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLVLQGQKEV  67
            ER  N+D+L Q VSH AE  GDH S+I  LSFH+RM PTDSTHCIY++G+ ++LQGQK+V
Sbjct  11   ERHVNMDQLTQAVSHFAEQSGDHISVIPQLSFHSRMHPTDSTHCIYNLGIGIILQGQKQV  70

Query  68   IIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVANLPVEAK  127
            +IGD VYQC EG SMLT +DLPVTS I+ AS QKPFLAVLLLLD+Q+VN++VA +P +  
Sbjct  71   VIGDQVYQCVEGQSMLTTIDLPVTSHIVQASPQKPFLAVLLLLDLQMVNQVVAEMPTQNS  130

Query  128  TIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLLNSSQG  185
            TI+ +D H SF+VE VD  LIDA +RL+K+LDEP M+PHLA L++KEII+R+LN   G
Sbjct  131  TIV-DDIHHSFTVEAVDTPLIDAFLRLIKVLDEPLMLPHLAPLIQKEIIVRVLNGPHG  187


> V2UXE5 HTH araC/xylS-type domain-containing protein [Acinetobacter 
gyllenbergii NIPH 230]
Length=302

 Score =  231 bits (589),  Expect = 3e-78
 Identities = 111/179 (62%), Positives = 143/179 (80%), Gaps = 1/179 (1%)

Query  8    ERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLVLQGQKEV  67
            ER+ N+D+LIQ VS   E  GDH S+I  LSFH +M PTDSTHC+Y++G+ ++LQGQK+V
Sbjct  6    ERNLNMDQLIQVVSRCVEQSGDHISVIPQLSFHRQMHPTDSTHCVYNLGIGIILQGQKQV  65

Query  68   IIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVANLPVEAK  127
            +IGD VYQC EG SMLT +DLPVTS I+ AS+QKPFLAVLLLLD+Q+VN++VA +P++  
Sbjct  66   VIGDQVYQCLEGQSMLTTIDLPVTSHIVQASAQKPFLAVLLLLDLQMVNQVVAEMPIQNS  125

Query  128  TIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLLNSSQGI  186
            TI+ N  H SF+VE VD +LIDA  RLVK+LDEP M+PHL  L++KEII+R+LN   GI
Sbjct  126  TIVEN-IHHSFTVEAVDTALIDAFFRLVKVLDEPLMLPHLVPLIQKEIIVRILNGPHGI  183


> N9R2S5 HTH araC/xylS-type domain-containing protein [Acinetobacter 
sp. NIPH 1867]
Length=302

 Score =  228 bits (582),  Expect = 4e-77
 Identities = 109/178 (61%), Positives = 141/178 (79%), Gaps = 1/178 (1%)

Query  8    ERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLVLQGQKEV  67
            ER+ N+D+L Q VSH AE  GDH S+I  LSFH+RM PTDSTHCIY++G+ ++LQGQK+V
Sbjct  6    ERNVNMDQLTQAVSHFAEQSGDHISVIPQLSFHSRMHPTDSTHCIYNLGIGIILQGQKQV  65

Query  68   IIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVANLPVEAK  127
            +IG+ +YQC EG SMLT +DLPVTS I+ AS QKPFLAVLLLLD+Q+VN++VA +P +  
Sbjct  66   VIGNQIYQCFEGQSMLTTIDLPVTSHIVQASPQKPFLAVLLLLDLQMVNQVVAEMPTQNS  125

Query  128  TIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLLNSSQG  185
            T  + D H SF+VE VD  LIDA +RL+K+LDEP M+PHL  L++KEII+R+LN   G
Sbjct  126  T-AAEDIHHSFTVEAVDTPLIDAFLRLIKVLDEPLMLPHLVPLIQKEIIVRVLNGPHG  182


> N9PNS7 HTH araC/xylS-type domain-containing protein [Acinetobacter 
colistiniresistens]
Length=302

 Score =  225 bits (573),  Expect = 8e-76
 Identities = 110/178 (62%), Positives = 143/178 (80%), Gaps = 1/178 (1%)

Query  8    ERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLVLQGQKEV  67
            ER++N D+LIQ VS LA  +GDH S I  LSFH+RM PTDSTHCIY++G+ ++LQGQKEV
Sbjct  6    ERNRNTDQLIQAVSDLAVQQGDHISTIPQLSFHHRMRPTDSTHCIYNLGIGMILQGQKEV  65

Query  68   IIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVANLPVEAK  127
            +IGD  Y CHEG SMLT +DLPVTS I+ ASSQ+PFLA+LLLLD+Q+VN++ A +PV+  
Sbjct  66   VIGDRNYLCHEGQSMLTTIDLPVTSHIVKASSQQPFLALLLLLDLQMVNQVAAEMPVDVL  125

Query  128  TIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLLNSSQG  185
            + +S++S  SFSVE  D  LIDA +RLV++LDEP M+PHLA L++KEII+R+LN   G
Sbjct  126  S-MSDESQHSFSVEIADPPLIDAFLRLVRVLDEPLMLPHLAPLIQKEIIVRVLNGPHG  182


> S3TA52 AraC family transcriptional regulator [Acinetobacter colistiniresistens]
Length=302

 Score =  223 bits (568),  Expect = 5e-75
 Identities = 109/178 (61%), Positives = 142/178 (80%), Gaps = 1/178 (1%)

Query  8    ERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLVLQGQKEV  67
            ER++N D+LIQ VS LA  +GDH S I  LSFH+RM PTDSTHCIY++G+ ++LQGQKEV
Sbjct  6    ERNRNTDQLIQAVSDLAMQQGDHISTIPQLSFHHRMRPTDSTHCIYNLGIGMILQGQKEV  65

Query  68   IIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVANLPVEAK  127
            +IGD  Y CHEG SMLT +DLPVTS I+ AS Q+PFLA+LLLLD+Q+VN++ A +PV+  
Sbjct  66   VIGDRNYLCHEGQSMLTTIDLPVTSHIVKASPQQPFLALLLLLDLQMVNQVAAEMPVDVL  125

Query  128  TIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLLNSSQG  185
            + +S++S  SFSVE  D  LIDA +RLV++LDEP M+PHLA L++KEII+R+LN   G
Sbjct  126  S-MSDESQHSFSVEIADPPLIDAFLRLVRVLDEPLMLPHLAPLIQKEIIVRVLNGPHG  182


> N9P4G3 HTH araC/xylS-type domain-containing protein [Acinetobacter 
sp. CIP 64.2]
Length=302

 Score =  222 bits (565),  Expect = 1e-74
 Identities = 108/178 (61%), Positives = 145/178 (81%), Gaps = 1/178 (1%)

Query  8    ERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLVLQGQKEV  67
            ER+++ D+LIQ VS LA  +GDH S I  LSFH+RM PTDSTHCIY++G+ ++LQGQKEV
Sbjct  6    ERNRDTDQLIQAVSDLAVQQGDHISAIPQLSFHHRMHPTDSTHCIYNLGVGMILQGQKEV  65

Query  68   IIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVANLPVEAK  127
            +IGD  Y C EG S+LT +DLPVTS ++ AS Q+PFLA+LLLLD+Q+VN++VA++PVEA 
Sbjct  66   VIGDEHYLCREGQSILTTIDLPVTSHVVKASPQQPFLALLLLLDLQMVNQMVADMPVEAL  125

Query  128  TIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLLNSSQG  185
            + +S++S  SFSV+  D SLIDA +RLV++LDEP M+PHLA L++KEII+R+LN   G
Sbjct  126  S-VSDESQHSFSVQVADPSLIDAFLRLVRVLDEPLMLPHLAPLIQKEIIVRVLNGPHG  182


> N9Q5E0 HTH araC/xylS-type domain-containing protein [Acinetobacter 
sp. NIPH 2100]
Length=302

 Score =  219 bits (558),  Expect = 1e-73
 Identities = 108/178 (61%), Positives = 139/178 (78%), Gaps = 1/178 (1%)

Query  8    ERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLVLQGQKEV  67
            ER+ ++++LI  VS  AE  GDH S+I  LSFH RM PTDSTHCIY++G+ ++LQGQKEV
Sbjct  6    ERNVHMEQLIHAVSGFAEQSGDHISVIPQLSFHRRMRPTDSTHCIYNLGIGIILQGQKEV  65

Query  68   IIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVANLPVEAK  127
            +IGD V+QC EG SMLT +DLPVTS I+ AS QKPFLAVLLLLD+Q+VN++VA +P  A 
Sbjct  66   VIGDQVHQCFEGQSMLTTIDLPVTSHIVQASPQKPFLAVLLLLDLQMVNQVVAEMPTGAL  125

Query  128  TIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLLNSSQG  185
            +  S++   SFSVE VD  LIDA  RL+K+LDEP+M+PHL  L++KEII+R+LN   G
Sbjct  126  S-ASDEIQHSFSVETVDTPLIDAFFRLIKVLDEPQMLPHLVPLIQKEIIVRVLNGPHG  182


> A0A1Y0B7R6 AraC-family transcriptional regulator [Pseudomonas 
aeruginosa]
Length=310

 Score = 90.5 bits (223),  Expect = 6e-25
 Identities = 56/185 (30%), Positives = 96/185 (52%), Gaps = 7/185 (4%)

Query  2    IPVSLTERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLVL  61
            +P  L +R   L    Q +      +G + + +  L+      PT     ++   L ++ 
Sbjct  12   LPAELRQRQSEL---AQSLLRHCPRDGIYGTAVEPLALIRADGPTLPARGMHKPALCIIA  68

Query  62   QGQKEVIIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVAN  121
            QG+KEV + +  Y     H ++  + LP+  ++I+AS   P+L V L +D   + +L+++
Sbjct  69   QGRKEVQLAEERYIYDPLHYLVVSVTLPLAGQVIDASPDAPYLCVRLDIDPAEITQLISD  128

Query  122  L-PVEAKTIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLL  180
              P+E   + S        V+ +D SL+DAV+RL+ +LD P+ IP LA L+ +EI  RLL
Sbjct  129  AGPME---VASRRGDRGLYVDRIDASLLDAVLRLIHLLDSPRDIPMLAPLILREIFYRLL  185

Query  181  NSSQG  185
             S QG
Sbjct  186  RSGQG  190


> A8KCK0 HTH AraC-type regulator [[Polyangium] brachysporum]
Length=322

 Score = 84.7 bits (208),  Expect = 6e-23
 Identities = 51/185 (28%), Positives = 98/185 (53%), Gaps = 3/185 (2%)

Query  2    IPVSLTERSKNLDRLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDS-THCIYSMGLSLV  60
            + V+  + +  +  L + ++  A  +G   + I  LS     +P+D   H ++   + ++
Sbjct  17   LEVNAVKDNVRVSELARLLNQHAPRKGVGATAIPRLSVIKLSTPSDELVHALHEPAVCII  76

Query  61   LQGQKEVIIGDNVYQCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVA  120
             QG K V++ D VY       ++   DLP+++++ +A+ ++P+L   L LD + V+ELV 
Sbjct  77   AQGAKRVMLRDEVYCYDTSRFLVFSTDLPISAQVTDATFERPYLCFRLDLDPKEVSELVL  136

Query  121  NLPVEAKTIISNDSHESFSVEFVDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLL  180
             L     T   N +     +     +++DA +RL+++LD P+ +P LA L  +E++ RLL
Sbjct  137  QLGAPPAT--RNATSRGLFLSAATDAMLDAAVRLLRLLDTPEDVPALAPLATRELVYRLL  194

Query  181  NSSQG  185
             S QG
Sbjct  195  KSEQG  199


> B4XH84 AraC [Actinobacillus pleuropneumoniae]
Length=284

 Score = 74.7 bits (182),  Expect = 1e-19
 Identities = 46/172 (27%), Positives = 91/172 (53%), Gaps = 4/172 (2%)

Query  15   RLIQKVSHLAETEGDHDSIISGLSFHNRMSPTDSTHCIYSMGLSLVLQGQKEVIIGDNVY  74
            ++I K+  L        + I GL   +   PT   + I    + +VLQG++++ IGD   
Sbjct  2    QIIDKLLPLIPKNQIWQTPIDGLVIQHADRPTPVANTILEPRICIVLQGERKICIGDQCT  61

Query  75   QCHEGHSMLTMMDLPVTSRIINASSQKPFLAVLLLLDIQVVNELVANLPVEAKTIISNDS  134
                 H M   +++P++  ++ AS +KP+L + + +D+++V  +V ++P   KTI  N  
Sbjct  62   LFSNQHFMFCPVNVPLSVEVVEASPEKPYLMMTMKIDLKMVASIVPHIP---KTIAKNQP  118

Query  135  HESFSVEF-VDISLIDAVMRLVKMLDEPKMIPHLADLVKKEIIIRLLNSSQG  185
              +  +++ ++ +L+     L+ +L  P+ I  LA L++++I   LL S QG
Sbjct  119  KSTAFLQWQLEENLLAQFEHLIDLLKTPEDIDFLAPLIQQQIYYVLLKSDQG  170



Lambda      K        H        a         alpha
   0.321    0.136    0.384    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 546129


  Database: 7c8d1d53153ce8bcb35a782164f29228.TrEMBL.fasta
    Posted date:  Sep 24, 2020  2:58 AM
  Number of letters in database: 3,543
  Number of sequences in database:  12



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40