ACIAD1774 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 56204874c2cc668e36ad0d4bd05db0f7.TrEMBL.fasta
           21 sequences; 10,130 total letters



Query= ACIAD1774

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FBE9 Trehalose-6-phosphate synthase [Acinetobacter baylyi (st...   980    0.0   
  N9DBN2 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) [...   706    0.0   
  A0A009Z8X8 Glycosyltransferase 20 family protein [Acinetobacter...   704    0.0   
  N9QTA4 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) [...   704    0.0   
  C0VI89 Putative alpha,alpha-trehalose-phosphate synthase (UDP-f...   602    0.0   
  N9MAG0 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) [...   600    0.0   
  K9BCH0 Putative alpha,alpha-trehalose-phosphate synthase (UDP-f...   599    0.0   
  A0A1R7QGQ7 Alpha,alpha-trehalose-phosphate synthase [UDP-formin...   599    0.0   
  N9CSB5 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) [...   599    0.0   
  N9RGY7 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) [...   598    0.0   
  N8UVA7 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) [...   598    0.0   
  Q66Q98 Trehalose-6-phosphate synthase [Rhizobium etli]               345    4e-116
  A4GW42 Trehalose-6-phosphate synthase [Rhizobium leguminosarum ...   342    7e-115
  Q6PQ82 Trehalose-6-phosphate synthase [Escherichia coli]             326    1e-108
  Q689D9 Trehalose-6-phosphate synthase [Rhodobacter sphaeroides ...   296    5e-97 
  Q156F5 Trehalose-6-phosphate synthase [Botryotinia fuckeliana]       249    1e-78 
  C7EZF1 Trehalose-6-phosphate synthase [Arthrobacter alpinus]         244    5e-77 
  A1XGA8 Trehalose-6-phosphate synthase [Propionibacterium freude...   243    1e-76 
  Q875L7 Trehalose-6-phosphate synthase [Magnaporthe grisea]           242    8e-76 
  Q27V66 Trehalose-6-phosphate synthase [Saccharomycopsis fibulig...   239    3e-75 
  Q7WUI7 Trehalose-6-phosphate synthase [Thermus thermophilus]         238    3e-75 


> Q6FBE9 Trehalose-6-phosphate synthase [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=478

 Score =  980 bits (2533),  Expect = 0.0
 Identities = 478/478 (100%), Positives = 478/478 (100%), Gaps = 0/478 (0%)

Query  1    MSRLIILSNRVSLPQTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYKS  60
            MSRLIILSNRVSLPQTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYKS
Sbjct  1    MSRLIILSNRVSLPQTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYKS  60

Query  61   KITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIAE  120
            KITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIAE
Sbjct  61   KITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIAE  120

Query  121  FAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLCH  180
            FAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLCH
Sbjct  121  FAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLCH  180

Query  181  YNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLSN  240
            YNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLSN
Sbjct  181  YNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLSN  240

Query  241  LSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIASPCR  300
            LSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIASPCR
Sbjct  241  LSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIASPCR  300

Query  301  LEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWVTSLK  360
            LEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWVTSLK
Sbjct  301  LEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWVTSLK  360

Query  361  DGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLALNMSL  420
            DGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLALNMSL
Sbjct  361  DGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLALNMSL  420

Query  421  EERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDYNHRLSTVLFYPNYSSRI  478
            EERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDYNHRLSTVLFYPNYSSRI
Sbjct  421  EERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDYNHRLSTVLFYPNYSSRI  478


> N9DBN2 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) 
[Acinetobacter ursingii ANC 3649]
Length=482

 Score =  706 bits (1821),  Expect = 0.0
 Identities = 336/478 (70%), Positives = 408/478 (85%), Gaps = 2/478 (0%)

Query  1    MSRLIILSNRVSLPQTE-CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRLIILSNRVSLPQ+E CVAGGLAVAMQDALS++GG+WVGWNG+K+EQ   Q FDILYK
Sbjct  1    MSRLIILSNRVSLPQSEKCVAGGLAVAMQDALSKVGGIWVGWNGEKVEQQTNQRFDILYK  60

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
            SKITY+TC LTQ+QYQDYYCGF+NN+LWP MHDR DLI+Y   E++TYQ VN LFA KI+
Sbjct  61   SKITYITCPLTQKQYQDYYCGFANNSLWPMMHDRADLIDYQYDEYQTYQQVNALFAKKIS  120

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
            EFA PDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPF +LE+W+K+P A  L+ D+C
Sbjct  121  EFAAPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFPALELWKKLPVANTLLQDIC  180

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
            HYNL+GLQT QDQ+NC+ VC+ LL+AQKIQ N +SLNQR+  IQ YPIGVDVKGIQK+++
Sbjct  181  HYNLVGLQTQQDQKNCLQVCTQLLQAQKIQKNSLSLNQRLVSIQHYPIGVDVKGIQKSVA  240

Query  240  NLSD-QDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIASP  298
            +L++ + +  T   A+KTIIGVDRIDYSKGLFERFN+FA +L+++     ++QH+QIA P
Sbjct  241  DLANARSELQTKHLAMKTIIGVDRIDYSKGLFERFNSFAHYLEQHPERRGQIQHLQIACP  300

Query  299  CRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWVTS  358
            CRL+VATYKRLFERFKLK+++IN+EF +++W PIVC Y+SK H++LMQFYR+ADICW++S
Sbjct  301  CRLDVATYKRLFERFKLKMDIINNEFKREDWYPIVCSYESKAHNQLMQFYRDADICWISS  360

Query  359  LKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLALNM  418
            LKDGMNLVAKEYIAAQ+P NPGVLILS+FAGAAEQM DAL+V+P +R+AM  AL+ ALNM
Sbjct  361  LKDGMNLVAKEYIAAQDPQNPGVLILSKFAGAAEQMTDALVVDPTDREAMSTALETALNM  420

Query  419  SLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDYNHRLSTVLFYPNYSS  476
             L ER+ RY KLI  L  YDIN W  DFL DL  +QY+ NF+Y + LS+VLFYP+ SS
Sbjct  421  PLAERKSRYQKLIHGLSIYDINDWCQDFLNDLECTQYLHNFEYENILSSVLFYPDASS  478


> A0A009Z8X8 Glycosyltransferase 20 family protein [Acinetobacter 
sp. 479375]
Length=482

 Score =  704 bits (1818),  Expect = 0.0
 Identities = 336/478 (70%), Positives = 407/478 (85%), Gaps = 2/478 (0%)

Query  1    MSRLIILSNRVSLPQTE-CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRLIILSNRVSLPQ+E CVAGGLAVAMQDALS++GG+WVGWNG+K+EQ   Q FDILYK
Sbjct  1    MSRLIILSNRVSLPQSEKCVAGGLAVAMQDALSKVGGIWVGWNGEKVEQQTNQRFDILYK  60

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
            SKITY+TC LTQ+QYQDYYCGF+NN+LWP MHDR DLI+Y   E++ YQ VN LFA KI+
Sbjct  61   SKITYITCPLTQKQYQDYYCGFANNSLWPMMHDRADLIDYQHDEYQIYQQVNALFAKKIS  120

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
            EFA PDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPF +LE+W+K+P A  L+ D+C
Sbjct  121  EFAAPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFPALELWKKLPVANTLLQDIC  180

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
            HYNL+GLQT QDQ+NC+ VC+ LLKAQKIQ N +SLNQR+  IQ YPIGVDVKGIQK+++
Sbjct  181  HYNLVGLQTQQDQKNCLQVCTQLLKAQKIQKNSLSLNQRLVSIQHYPIGVDVKGIQKSVA  240

Query  240  NLSDQ-DQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIASP  298
            +L++   +  T  SA+KTIIGVDRIDYSKGLFERFN+FA +L+++     ++QH+QIA P
Sbjct  241  DLANACSEPHTTHSAMKTIIGVDRIDYSKGLFERFNSFAHYLEQHPERRGQIQHLQIACP  300

Query  299  CRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWVTS  358
            CRL+VATYKRLFERFKLK+++IN+EF +++W PIVC Y+SK H++LMQFYR+ADICW++S
Sbjct  301  CRLDVATYKRLFERFKLKMDIINNEFKREDWYPIVCSYESKAHNQLMQFYRDADICWISS  360

Query  359  LKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLALNM  418
            LKDGMNLVAKEYIAAQ+P NPGVLILS+FAGAAEQM DAL+V+P +R+AM  +L+ ALNM
Sbjct  361  LKDGMNLVAKEYIAAQDPQNPGVLILSKFAGAAEQMTDALVVDPTDREAMSTSLETALNM  420

Query  419  SLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDYNHRLSTVLFYPNYSS  476
             L ER+ RY KLI  L  YDIN W  DFL DL  +QY+ NF+Y + LS+VLFYP+ SS
Sbjct  421  PLAERKSRYQKLIHGLSIYDINDWCQDFLNDLECTQYLHNFEYENILSSVLFYPDASS  478


> N9QTA4 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) 
[Acinetobacter ursingii NIPH 706]
Length=482

 Score =  704 bits (1818),  Expect = 0.0
 Identities = 336/478 (70%), Positives = 407/478 (85%), Gaps = 2/478 (0%)

Query  1    MSRLIILSNRVSLPQTE-CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRLIILSNRVSLPQ+E CVAGGLAVAMQDALS++GG+WVGWNG+K+EQ   Q FDILYK
Sbjct  1    MSRLIILSNRVSLPQSEKCVAGGLAVAMQDALSKVGGIWVGWNGEKVEQQTNQRFDILYK  60

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
            SKITY+TC LTQ+QYQDYYCGF+NN+LWP MHDR DLI+Y   E++ YQ VN LFA KI+
Sbjct  61   SKITYITCPLTQKQYQDYYCGFANNSLWPMMHDRADLIDYQHDEYQIYQQVNALFAKKIS  120

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
            EFA PDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPF +LE+W+K+P A  L+ D+C
Sbjct  121  EFAAPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFPALELWKKLPVANTLLQDIC  180

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
            HYNL+GLQT QDQ+NC+ VC+ LLKAQKIQ N +SLNQR+  IQ YPIGVDVKGIQK+++
Sbjct  181  HYNLVGLQTQQDQKNCLQVCTQLLKAQKIQKNSLSLNQRLVSIQHYPIGVDVKGIQKSVA  240

Query  240  NLSDQ-DQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIASP  298
            +L++   +  T  SA+KTIIGVDRIDYSKGLFERFN+FA +L+++     ++QH+QIA P
Sbjct  241  DLANACSEPHTTHSAMKTIIGVDRIDYSKGLFERFNSFAHYLEQHPERRGQIQHLQIACP  300

Query  299  CRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWVTS  358
            CRL+VATYKRLFERFKLK+++IN+EF +++W PIVC Y+SK H++LMQFYR+ADICW++S
Sbjct  301  CRLDVATYKRLFERFKLKMDIINNEFKREDWYPIVCSYESKAHNQLMQFYRDADICWISS  360

Query  359  LKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLALNM  418
            LKDGMNLVAKEYIAAQ+P NPGVLILS+FAGAAEQM DAL+V+P +R+AM  +L+ ALNM
Sbjct  361  LKDGMNLVAKEYIAAQDPQNPGVLILSKFAGAAEQMTDALVVDPTDREAMSTSLETALNM  420

Query  419  SLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDYNHRLSTVLFYPNYSS  476
             L ER+ RY KLI  L  YDIN W  DFL DL  +QY+ NF+Y + LS+VLFYP+ SS
Sbjct  421  PLAERKSRYQKLIHGLSIYDINDWCQDFLNDLECTQYLHNFEYENILSSVLFYPDASS  478


> C0VI89 Putative alpha,alpha-trehalose-phosphate synthase (UDP-forming) 
[Acinetobacter sp. ATCC 27244]
Length=478

 Score =  602 bits (1552),  Expect = 0.0
 Identities = 284/465 (61%), Positives = 360/465 (77%), Gaps = 4/465 (1%)

Query  1    MSRLIILSNRVSLPQTE-CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MS+LI+LSNRVS+P  +   AGGLAVA+QDAL  +GGVW+GWNG+++ +  E HF+IL K
Sbjct  1    MSKLIVLSNRVSIPNGQKTTAGGLAVAIQDALDDIGGVWLGWNGERVHKQDEVHFNILRK  60

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
             K+ Y+TC LT  QY DYY GF+NNTLWPAMH R DLIE+   E++ YQ VN LFA K+A
Sbjct  61   DKVEYVTCPLTNSQYSDYYAGFANNTLWPAMHYRSDLIEFKSSEYEGYQKVNYLFAQKLA  120

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
            E A PDD IWV DYHFLSVA++CRELGMQNKIGFFLHIPFA L IW+KIPCA+QL++DLC
Sbjct  121  EIADPDDTIWVHDYHFLSVAKYCRELGMQNKIGFFLHIPFAPLFIWQKIPCAQQLIEDLC  180

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+++GLQT +DQ+ C+ VC+ LLKAQKIQ  ++S +QR+T I+ YPIGV+   IQK   
Sbjct  181  QYDVVGLQTDKDQKVCMQVCTSLLKAQKIQQTLLSYHQRLTIIKCYPIGVNPTAIQKAAQ  240

Query  240  NLSDQDQYLTNP---SAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIA  296
               D   +LT P   +A KTIIGVDRIDYSKGL ERF ++AEFL++   + Q +QH+QIA
Sbjct  241  QFIDVQDFLTRPVELNAAKTIIGVDRIDYSKGLLERFLSYAEFLEKYPEYQQHIQHLQIA  300

Query  297  SPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWV  356
             PCRLEV  Y+RLFERFK+K+E+IN EF+QD+W P+ C YD+  HH LMQ YR AD+CW+
Sbjct  301  CPCRLEVPAYQRLFERFKIKIEMINQEFAQDDWQPVECIYDAMKHHHLMQIYRQADVCWI  360

Query  357  TSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLAL  416
            +S++DGMNLVAKEYIAAQNP NPGVLILS++AGAAE M +AL+V+P N+ AM+  LK AL
Sbjct  361  SSIRDGMNLVAKEYIAAQNPSNPGVLILSKYAGAAEHMSEALVVDPTNKTAMVDVLKTAL  420

Query  417  NMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDY  461
             M  +ER  RY  L+K L ++DIN WR+ FL DL +   +Q+F +
Sbjct  421  EMPRQERISRYKHLMKGLKDFDINDWRNAFLNDLQNKTAVQDFRF  465


> N9MAG0 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) 
[Acinetobacter sp. NIPH 1847]
Length=478

 Score =  600 bits (1546),  Expect = 0.0
 Identities = 282/465 (61%), Positives = 363/465 (78%), Gaps = 4/465 (1%)

Query  1    MSRLIILSNRVSLPQTE-CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MS+LIILSNRVS+P  +   AGGLAVA+QDAL  +GGVW+GWNG++++ P E  F++L K
Sbjct  1    MSKLIILSNRVSIPNGQKASAGGLAVAIQDALDDIGGVWLGWNGERVDTPDEVQFNLLRK  60

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              + Y+TC LT+ QY DYY GF+NNTLWPAMH R DLIEY   E++ YQ VN LFA K+A
Sbjct  61   DDVEYITCPLTESQYSDYYAGFANNTLWPAMHYRSDLIEYKSSEYEGYQQVNYLFAQKLA  120

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
            E A+PDD IWV DYHFLSVA++CRELGMQNKIGFFLHIPFA L IW+KIPCA+ L++DLC
Sbjct  121  EIAEPDDTIWVHDYHFLSVAKYCRELGMQNKIGFFLHIPFAPLFIWQKIPCAQVLIEDLC  180

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+++GLQT +DQ+ C+ VC+ LLKAQKIQ  ++S +QR+T I+ YPIGV+   IQKT  
Sbjct  181  QYDVVGLQTEKDQKVCMQVCTSLLKAQKIQQTLLSYHQRLTLIKCYPIGVNPTAIQKTAQ  240

Query  240  NLSDQDQYLTNP---SAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIA  296
               D   ++T P   +A KTIIGVDRIDYSKGL ERF ++AEFL++   +HQ +QH+QIA
Sbjct  241  QFIDVQDFITRPVELNAAKTIIGVDRIDYSKGLLERFLSYAEFLEQYPEYHQHIQHLQIA  300

Query  297  SPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWV  356
             PCRLEV  Y+RLFERFK+K+E+IN EF+Q++W P+ C YD+  HH LMQ YR AD+CW+
Sbjct  301  CPCRLEVPAYQRLFERFKIKIEMINQEFAQEDWQPVECIYDAMKHHHLMQIYRQADVCWI  360

Query  357  TSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLAL  416
            +S++DGMNLVAKEYIAAQNP NPGVLILS++AGAAE M +A++V+P ++ AM+ ALK AL
Sbjct  361  SSIRDGMNLVAKEYIAAQNPSNPGVLILSKYAGAAEHMSEAILVDPTDKTAMVNALKTAL  420

Query  417  NMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDY  461
             M  +ER  RY +L+K L ++DIN WR+ FL DL     +Q+F +
Sbjct  421  EMPRQERISRYKQLMKGLKDFDINDWRNAFLSDLLYKTALQDFRF  465


> K9BCH0 Putative alpha,alpha-trehalose-phosphate synthase (UDP-forming) 
[Acinetobacter sp. WC-323]
Length=478

 Score =  599 bits (1545),  Expect = 0.0
 Identities = 281/465 (60%), Positives = 362/465 (78%), Gaps = 4/465 (1%)

Query  1    MSRLIILSNRVSLPQTE-CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MS+LIILSNRVS+P  +   AGGLAVA+QDAL  +GGVW+GWNG++++ P E  F++L K
Sbjct  1    MSKLIILSNRVSIPNGQKASAGGLAVAIQDALDDIGGVWLGWNGERVDTPDEVQFNLLRK  60

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              + Y+TC LT+ QY DYY GF+NNTLWPAMH R DLIEY   E++ YQ VN LFA K+A
Sbjct  61   DDVEYITCPLTESQYSDYYAGFANNTLWPAMHYRSDLIEYKSSEYEGYQQVNFLFAQKLA  120

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
            E A+PDD IWV DYHFLSVA++CRELGMQNKIGFFLHIPFA L IW+KIPCA+ L++DLC
Sbjct  121  EIAEPDDTIWVHDYHFLSVAKYCRELGMQNKIGFFLHIPFAPLFIWQKIPCAQALIEDLC  180

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+++GLQT +DQ+ C+ VC+ LLKAQKIQ  ++S +QR+T I+ YPIGV+   IQK   
Sbjct  181  QYDVVGLQTEKDQKVCMQVCTSLLKAQKIQQTLLSYHQRLTMIKCYPIGVNPTAIQKAAQ  240

Query  240  NLSDQDQYLTNP---SAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIA  296
               D   ++T P   +A KTIIGVDRIDYSKGL ERF ++AEFL++   +HQ +QH+QIA
Sbjct  241  QFIDVQDFITRPVELNAAKTIIGVDRIDYSKGLLERFLSYAEFLEQYPEYHQHIQHLQIA  300

Query  297  SPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWV  356
             PCRLEV  Y+RLFERFK+K+E+IN EF+Q++W P+ C YD+  HH LMQ YR AD+CW+
Sbjct  301  CPCRLEVPAYQRLFERFKIKIEMINQEFAQEDWQPVECIYDAMKHHHLMQIYRQADVCWI  360

Query  357  TSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLAL  416
            +S++DGMNLVAKEYIAAQNP NPGVLILS++AGAAE M +A++V+P ++ AM+ ALK AL
Sbjct  361  SSIRDGMNLVAKEYIAAQNPSNPGVLILSKYAGAAEHMSEAILVDPTDKTAMVTALKTAL  420

Query  417  NMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDY  461
             M  +ER  RY +L+K L ++DIN WR+ FL DL     +Q+F +
Sbjct  421  EMPRQERISRYKQLMKGLKDFDINDWRNAFLSDLQYKTALQDFRF  465


> A0A1R7QGQ7 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
[Acinetobacter johnsonii]
Length=478

 Score =  599 bits (1544),  Expect = 0.0
 Identities = 283/465 (61%), Positives = 361/465 (78%), Gaps = 4/465 (1%)

Query  1    MSRLIILSNRVSLPQTE-CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MS+LIILSNRVS+P  +   AGGLAVA+QDAL  +GGVW+GWNG+++ +  E HF+IL K
Sbjct  1    MSKLIILSNRVSIPNGQKTTAGGLAVAIQDALDDIGGVWLGWNGERVHKQEEVHFNILRK  60

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
             K+ Y+TC LT  QY DYY GF+NN+LWPAMH R DLIE+   E++ YQ VN LFA K+A
Sbjct  61   DKVDYVTCPLTNSQYSDYYAGFANNSLWPAMHYRSDLIEFKTSEYEGYQKVNYLFAQKLA  120

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
            E A PDD IWV DYHFLSVA++CRELGMQNKIGFFLHIPFA L IW+KIPCA+QL++DLC
Sbjct  121  EIADPDDTIWVHDYHFLSVAKYCRELGMQNKIGFFLHIPFAPLFIWQKIPCAQQLIEDLC  180

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+++GLQT +DQ+ C+ VC+ LLKAQKIQ  ++S +QR+T I+ YPIGV+   IQK   
Sbjct  181  QYDVVGLQTDKDQKVCMQVCTSLLKAQKIQQTLLSYHQRLTIIKCYPIGVNPTAIQKAAQ  240

Query  240  NLSDQDQYLTNP---SAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIA  296
               D   +LT P   +A KTIIGVDRIDYSKGL ERF ++AEFL++   + Q +QH+QIA
Sbjct  241  QFIDVQDFLTRPVELNAAKTIIGVDRIDYSKGLLERFLSYAEFLEKYPEYQQHIQHLQIA  300

Query  297  SPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWV  356
             PCRLEV  Y+RLFERFK+K+E+IN EF+Q++W P+ C YD+  HH LMQ YR AD+CW+
Sbjct  301  CPCRLEVPAYQRLFERFKIKIEMINQEFAQEDWQPVECIYDAMKHHHLMQIYRQADVCWI  360

Query  357  TSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLAL  416
            +S++DGMNLVAKEYIAAQNP NPGVLILS++AGAAE M +AL+V+P ++ AM+  LK AL
Sbjct  361  SSIRDGMNLVAKEYIAAQNPSNPGVLILSKYAGAAEHMSEALLVDPTDKTAMVDVLKTAL  420

Query  417  NMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDY  461
             M  +ER  RY +L+K L ++DIN WR+ FL DL +   +QNF +
Sbjct  421  EMPRQERISRYKQLMKGLKDFDINDWRNAFLNDLQNKTAMQNFRF  465


> N9CSB5 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) 
[Acinetobacter johnsonii ANC 3681]
Length=478

 Score =  599 bits (1544),  Expect = 0.0
 Identities = 283/465 (61%), Positives = 361/465 (78%), Gaps = 4/465 (1%)

Query  1    MSRLIILSNRVSLPQTE-CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MS+LIILSNRVS+P  +   AGGLAVA+QDAL  +GGVW+GWNG+++ +  E HF+IL K
Sbjct  1    MSKLIILSNRVSIPNGQKTTAGGLAVAIQDALDDIGGVWLGWNGERVHKQEEVHFNILRK  60

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
             K+ Y+TC LT  QY DYY GF+NN+LWPAMH R DLIE+   E++ YQ VN LFA K+A
Sbjct  61   DKVDYVTCPLTNSQYSDYYAGFANNSLWPAMHYRSDLIEFKTSEYEGYQKVNYLFAQKLA  120

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
            E A PDD IWV DYHFLSVA++CRELGMQNKIGFFLHIPFA L IW+KIPCA+QL++DLC
Sbjct  121  EIADPDDTIWVHDYHFLSVAKYCRELGMQNKIGFFLHIPFAPLFIWQKIPCAQQLIEDLC  180

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+++GLQT +DQ+ C+ VC+ LLKAQKIQ  ++S +QR+T I+ YPIGV+   IQK   
Sbjct  181  QYDVVGLQTDKDQKVCMQVCTSLLKAQKIQQTLLSYHQRLTIIKCYPIGVNPTAIQKAAQ  240

Query  240  NLSDQDQYLTNP---SAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIA  296
               D   +LT P   +A KTIIGVDRIDYSKGL ERF ++AEFL++   + Q +QH+QIA
Sbjct  241  QFIDVQDFLTRPVELNAAKTIIGVDRIDYSKGLLERFLSYAEFLEKYPEYQQHIQHLQIA  300

Query  297  SPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWV  356
             PCRLEV  Y+RLFERFK+K+E+IN EF+Q++W P+ C YD+  HH LMQ YR AD+CW+
Sbjct  301  CPCRLEVPAYQRLFERFKIKIEMINQEFAQEDWQPVECIYDAMKHHHLMQIYRQADVCWI  360

Query  357  TSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLAL  416
            +S++DGMNLVAKEYIAAQNP NPGVLILS++AGAAE M +AL+V+P ++ AM+  LK AL
Sbjct  361  SSIRDGMNLVAKEYIAAQNPSNPGVLILSKYAGAAEHMSEALLVDPTDKTAMVDVLKTAL  420

Query  417  NMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDY  461
             M  +ER  RY +L+K L ++DIN WR+ FL DL +   +QNF +
Sbjct  421  EMPRQERISRYKQLMKGLKDFDINDWRNAFLNDLQNKTAMQNFRF  465


> N9RGY7 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) 
[Acinetobacter sp. NIPH 3623]
Length=478

 Score =  598 bits (1543),  Expect = 0.0
 Identities = 279/465 (60%), Positives = 362/465 (78%), Gaps = 4/465 (1%)

Query  1    MSRLIILSNRVSLPQTE-CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MS+LIILSNRVS+P  +   AGGLAVA+QDAL  +GGVW+GWNG++++ P E  F++L K
Sbjct  1    MSKLIILSNRVSIPNGQKASAGGLAVAIQDALDDIGGVWLGWNGERVDTPDEVQFNLLRK  60

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              + Y+TC LT+ QY DYY GF+NNTLWPAMH R DLIEY   E++ YQ VN LFA K+A
Sbjct  61   DDVEYITCPLTESQYSDYYAGFANNTLWPAMHYRSDLIEYKSSEYEGYQQVNYLFAQKLA  120

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
            E A+PDD IWV DYHFLSVA++CRELGMQNKIGFFLHIPFA L IW+KIPCA+ L++DLC
Sbjct  121  EIAEPDDTIWVHDYHFLSVAKYCRELGMQNKIGFFLHIPFAPLFIWQKIPCAQALIEDLC  180

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+++GLQT +DQ+ C+ VC+ LLK QKIQ  ++S +QR+T I+ YPIG++   IQK   
Sbjct  181  QYDVVGLQTEKDQKVCMQVCTSLLKVQKIQQTLLSYHQRLTMIKCYPIGINPTAIQKAAQ  240

Query  240  NLSDQDQYLTNP---SAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIA  296
               D   ++T P   +A KTIIGVDRIDYSKGL ERF ++AEFL++   +HQ +QH+QIA
Sbjct  241  QFIDVQDFITRPVELNAAKTIIGVDRIDYSKGLLERFLSYAEFLEQYPEYHQHIQHLQIA  300

Query  297  SPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWV  356
             PCRLEV  Y+RLFERFK+K+E+IN EF+Q++W P+ C YD+  HH LMQ YR AD+CW+
Sbjct  301  CPCRLEVPAYQRLFERFKIKIEMINQEFAQEDWQPVECIYDAMKHHHLMQIYRQADVCWI  360

Query  357  TSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLAL  416
            +S++DGMNLVAKEYIAAQNP NPGVLILS++AGAAE M +A++V+P ++ AM+ ALK AL
Sbjct  361  SSIRDGMNLVAKEYIAAQNPSNPGVLILSKYAGAAEHMSEAILVDPTDKTAMVNALKTAL  420

Query  417  NMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDY  461
             M  +ER  RY +L+K L ++DIN WR+ FL DL+    +Q+F +
Sbjct  421  EMPRQERISRYKQLMKGLKDFDINDWRNAFLSDLHYKTALQDFRF  465


> N8UVA7 Alpha,alpha-trehalose-phosphate synthase (UDP-forming) 
[Acinetobacter sp. NIPH 758]
Length=478

 Score =  598 bits (1543),  Expect = 0.0
 Identities = 284/465 (61%), Positives = 359/465 (77%), Gaps = 4/465 (1%)

Query  1    MSRLIILSNRVSLPQTEC-VAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MS+LIILSNRVS+P  +   AGGLAVA+QDAL  +GGVW+GWNG+K++   E HF+IL K
Sbjct  1    MSKLIILSNRVSIPNGQKPAAGGLAVAIQDALDDIGGVWLGWNGEKVDTQEEVHFNILRK  60

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              + Y+TC LT  QY DYY GF+NNTLWPAMH R DLIEY   E++ YQ VN LFA K+A
Sbjct  61   DNVEYITCPLTHTQYSDYYAGFANNTLWPAMHYRSDLIEYKSSEYEGYQQVNYLFAQKLA  120

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
            E AQPDD IWV DYHFLSVA++CRELGMQNKIGFFLHIPFA L IW++IPCA+QL++DLC
Sbjct  121  EIAQPDDTIWVHDYHFLSVAKYCRELGMQNKIGFFLHIPFAPLFIWQRIPCAQQLIEDLC  180

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+++GLQT +DQ+ C+ VC+ LLKAQKIQ  ++S +QR+T I+ YPIGV+   IQK   
Sbjct  181  QYDVVGLQTDKDQKVCMQVCTSLLKAQKIQQTLVSYHQRLTMIKCYPIGVNPAAIQKAAQ  240

Query  240  NLSDQDQYLTNP---SAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIA  296
               D    LT P   +A KTIIGVDRIDYSKGL ERF ++AEFL++   + Q +QH+QIA
Sbjct  241  QFIDVQDLLTRPVELNAAKTIIGVDRIDYSKGLLERFLSYAEFLEKYPEYQQHIQHLQIA  300

Query  297  SPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWV  356
             PCRLEV  Y+RLFERFK+K+E+IN EF+Q++W P+ C YD+  HH LMQ YR AD+CW+
Sbjct  301  CPCRLEVPAYQRLFERFKIKIEMINQEFAQEDWQPVECIYDAMKHHHLMQIYRQADVCWI  360

Query  357  TSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLAL  416
            +S++DGMNLVAKEYIAAQNP NPGVLILS++AGAAE M +AL+V+P ++ AM+  LK AL
Sbjct  361  SSIRDGMNLVAKEYIAAQNPSNPGVLILSKYAGAAEHMSEALLVDPTDKTAMVDTLKTAL  420

Query  417  NMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDY  461
             M  +ER  RY +L+K L ++DIN WR+ FL DL     +Q+F +
Sbjct  421  EMPRQERISRYKQLMKGLKDFDINDWRNAFLNDLQYKTALQDFRF  465


> Q66Q98 Trehalose-6-phosphate synthase [Rhizobium etli]
Length=468

 Score =  345 bits (885),  Expect = 4e-116
 Identities = 184/455 (40%), Positives = 263/455 (58%), Gaps = 5/455 (1%)

Query  1    MSRLIILSNRVSLPQTE--CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILY  58
            MSRLI++SNRV +P  +    AGGLAVA+Q AL + GG+W+GW+G+   +       +  
Sbjct  1    MSRLIVVSNRVPVPSKDGGAAAGGLAVALQAALQERGGIWMGWSGESSGEREPGALSLQQ  60

Query  59   KSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKI  118
            K  ITY    LT    ++YY GF+N  LWP  H R DL EY  KE   Y  VNR FA ++
Sbjct  61   KGNITYALTDLTDTDVEEYYRGFANRVLWPICHYRLDLAEYGRKEMAGYFRVNRFFAHRL  120

Query  119  AEFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDL  178
            A   +PDD+IWV DYH + +A   R++G++N+IGFFLHIP+   +I   +P  E++M  L
Sbjct  121  APMIEPDDIIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWPPADILVTMPVHEEIMRGL  180

Query  179  CHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTL  238
             HY+L+G QT  D +N             + N +   + R  +   YPIG++     +  
Sbjct  181  SHYDLVGFQTDYDLQNFAGYLRREGIGDDLGNGLFDSHGRTFKAGAYPIGIETAAFAEFA  240

Query  239  SNLSDQDQYLTNPSAIK---TIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQI  295
               +D         +I+    IIGVDR+DYSKG+ +R  AF  FL  N A+  KV ++Q+
Sbjct  241  ERAADNVMVQKTRRSIEGRDMIIGVDRLDYSKGIIQRLEAFERFLTSNPAYQNKVTYLQV  300

Query  296  ASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICW  355
                R EV  Y+ + +    +   +N      +W+PI     S   + L   YR A I  
Sbjct  301  TPKSRSEVPEYEHMQKMVAEQAGRVNGAIGTVDWVPIRYVNRSISRNVLAGLYRLATIGL  360

Query  356  VTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLA  415
            VT L+DGMNLVAKEY+AAQ+PD PGVL+LS FAGAA +++ AL+VNP + +    AL   
Sbjct  361  VTPLRDGMNLVAKEYVAAQDPDRPGVLVLSRFAGAARELKGALLVNPYDVEGTANALARG  420

Query  416  LNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L MSLEER+ R+  +++ L+ +D++ W  DFL+DL
Sbjct  421  LAMSLEERRDRWSMMMEHLLSHDVSLWCKDFLRDL  455


> A4GW42 Trehalose-6-phosphate synthase [Rhizobium leguminosarum 
bv. trifolii]
Length=471

 Score =  342 bits (877),  Expect = 7e-115
 Identities = 181/455 (40%), Positives = 264/455 (58%), Gaps = 5/455 (1%)

Query  1    MSRLIILSNRVSLPQTE--CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILY  58
            MSRL+++SNRV +P  +    AGGLAVA+Q AL + GG+W+GW+G+            L 
Sbjct  1    MSRLVVVSNRVPMPAKDGSAAAGGLAVALQAALQERGGIWMGWSGESSGDREPGPLSQLQ  60

Query  59   KSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKI  118
            K  ITY    LT    ++YY GF+N  LWP  H R DL EY  KE   Y  VNR FA ++
Sbjct  61   KGNITYALTDLTDTDVEEYYRGFANRVLWPICHYRLDLAEYGRKEMAGYFRVNRFFAHRL  120

Query  119  AEFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDL  178
            A   +PDD+IWV DYH + +A   R++G++N+IGFFLHIP+   +I   +P  E++M  L
Sbjct  121  APMIEPDDIIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWPPADILVTMPVHEEIMRGL  180

Query  179  CHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTL  238
             HY+L+G QT  D +N             + N +   + R+ +   YPIG++  G  +  
Sbjct  181  SHYDLVGFQTDYDLQNFAGYLRREGIGDDLGNGLFDSHGRIFKAGAYPIGIETAGFAEFA  240

Query  239  SNLSDQDQYLTNPSAIK---TIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQI  295
               ++         +++    IIGVDR+DYSKG+ +R  AF  FL  N A+  KV ++Q+
Sbjct  241  ERAANHIMVQKTRRSVEGRDMIIGVDRLDYSKGIIQRLEAFETFLTSNPAYQNKVTYLQV  300

Query  296  ASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICW  355
                R EV  Y+ + +    +   +N      +W+PI     S   + L   YR A I  
Sbjct  301  TPKSRSEVPEYEHMQKMVAEQAGRVNGAIGTVDWVPIRYVNRSISRNVLAGLYRLATIGL  360

Query  356  VTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLA  415
            VT L+DGMNLVAKEY+AAQ+PD PGVL+LS FAGAA +++ AL+VNP + +    A+   
Sbjct  361  VTPLRDGMNLVAKEYVAAQDPDRPGVLVLSRFAGAARELKGALLVNPYDVEGTANAIAKG  420

Query  416  LNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L MSLEER+ R+  +++ L+ +D++ W ++FL DL
Sbjct  421  LAMSLEERRNRWSMMMEHLLTHDVSLWCENFLGDL  455


> Q6PQ82 Trehalose-6-phosphate synthase [Escherichia coli]
Length=474

 Score =  326 bits (836),  Expect = 1e-108
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  DYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> Q689D9 Trehalose-6-phosphate synthase [Rhodobacter sphaeroides 
f. sp. denitrificans]
Length=470

 Score =  296 bits (757),  Expect = 5e-97
 Identities = 172/460 (37%), Positives = 251/460 (55%), Gaps = 9/460 (2%)

Query  1    MSRLIILSNRVSLPQTEC--VAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILY  58
            MSRL+++SNRV LP        GGLAVA+  AL + GG+W+GW+G+   +   Q    L 
Sbjct  1    MSRLVVVSNRVPLPDENGNPPPGGLAVAVHVALRKNGGIWMGWSGRSTGEEEPQGLTTLE  60

Query  59   KSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKI  118
            + KI+Y+   L+Q    +YY GF+N  LWP  H R DL EY  +E   Y  VNRLFA ++
Sbjct  61   QDKISYVLTDLSQADLDEYYNGFANRVLWPIFHCRLDLAEYARQEMAGYFRVNRLFADRL  120

Query  119  AEFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDL  178
                +PDD+IWV DYH + +A+  R+ G++N+IGFFLHIP+   +I   +P  E +M  L
Sbjct  121  VPMLEPDDVIWVHDYHLIPLAQELRKRGVRNRIGFFLHIPWPPADIVTALPVYEIIMRGL  180

Query  179  CHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTL  238
              Y+L+G QT  D +N +                +    +      +PIG++     +  
Sbjct  181  AAYDLVGFQTDYDLDNFVGCLRREGWGDWSTPGWLRAFDKEVAAAAFPIGIETGDFARLA  240

Query  239  SNLSDQD-----QYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHV  293
            +     D     Q   + SA+  IIGVDR+DYSKG+  R +AF  +L RN     KV  +
Sbjct  241  AKTDGLDLVTDMQQSLHGSAL--IIGVDRLDYSKGIAARIDAFERYLMRNPDQAGKVTLL  298

Query  294  QIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADI  353
            Q+A   R +V  Y  +  + +     +N       W+PI     S     L   YR A +
Sbjct  299  QVAPHSRSDVPEYLEMQGQVESHCGRVNGAHGTIEWVPIRYVNQSLTRPVLAGLYRLAKV  358

Query  354  CWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALK  413
              VT L+DGMNLVAKEY+A+Q+P +PGVLILS FAGAA ++  A+ +NP + +    A+ 
Sbjct  359  GLVTPLRDGMNLVAKEYVASQDPADPGVLILSRFAGAARELDGAIFINPYDTEQTAGAIG  418

Query  414  LALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSS  453
             AL+M L+ER  R+ +++  L  +D+  W   FL  LN +
Sbjct  419  RALSMPLDERIARWRRMMDHLESHDVLWWCRTFLAALNEA  458


> Q156F5 Trehalose-6-phosphate synthase [Botryotinia fuckeliana]
Length=523

 Score =  249 bits (636),  Expect = 1e-78
 Identities = 161/465 (35%), Positives = 242/465 (52%), Gaps = 18/465 (4%)

Query  2    SRLIILSNR--VSLPQTEC-------VAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQ  52
            SRL+++SNR  +++ +TE         +GGL   +          W GW G ++     +
Sbjct  13   SRLLLVSNRLPITIKRTEDGQYDFTGSSGGLVTGLSGLAKTTTFQWYGWPGLEVPDAEAK  72

Query  53   HFDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNR  112
                  K +       +  +    +Y GFSN+ LWP  H     I ++  ++  Y++VNR
Sbjct  73   PLVKRLKDEHGAHPVFVDDELADKHYNGFSNSILWPLFHYHPGEITFDESQWMAYKEVNR  132

Query  113  LFATKIAEFAQPDDLIWVQDYHFLSVARHCR-ELGMQNK---IGFFLHIPFASLEIWRKI  168
            LFA  IA+  Q  DLIWV DYH + +    R E+G   K   IGFFLH PF S EI+R +
Sbjct  133  LFAKTIAKDVQDGDLIWVHDYHLMLLPEMLRDEIGTSKKNVKIGFFLHTPFPSSEIYRIL  192

Query  169  PCAEQLMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIG  228
            P  E L+  + H +LIG  T     + +S CS +L+ Q   N +    + VT +  +PIG
Sbjct  193  PVRESLLLSVLHCDLIGFHTYDYARHFLSSCSRILETQTTPNGVEFRGKYVT-VAAFPIG  251

Query  229  VDVKGIQKTLSNLSDQD---QYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTA  285
            +D +   +TL     ++   Q       +K I+GVDR+DY KG+ ++ +A   FL  +  
Sbjct  252  IDPEKFIETLKKPKVEERIAQLERKFEGVKLIVGVDRLDYIKGVPQKLHALEVFLTEHPE  311

Query  286  FHQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELM  345
            +  KV  VQ+A P R +V  Y+ L       V  IN  F    ++PI   + S    EL 
Sbjct  312  WIGKVVLVQVAVPSRQDVEEYQNLRAVVNELVGRINGRFGTVEFMPIHFLHQSVNFDELT  371

Query  346  QFYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNR  405
              Y  +D C V+S +DGMNLV+ EYIA Q   + GV+ILSEF GAA+ +  ALIVNP N 
Sbjct  372  ALYAVSDACLVSSTRDGMNLVSYEYIATQRKRH-GVMILSEFTGAAQSLNGALIVNPWNT  430

Query  406  DAMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            + +  A+  A+ MS E+R+  + KL K + +Y  + W + F+ +L
Sbjct  431  EELADAIHDAVTMSPEQREINFKKLEKYVFKYTSSWWGESFVSEL  475


> C7EZF1 Trehalose-6-phosphate synthase [Arthrobacter alpinus]
Length=495

 Score =  244 bits (623),  Expect = 5e-77
 Identities = 154/469 (33%), Positives = 242/469 (52%), Gaps = 28/469 (6%)

Query  2    SRLIILSNRVSLPQTECV---------AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQ  52
            S  I++SNR+ + +T             GGL  A+   ++   G WVGW+G       + 
Sbjct  28   SDFIVVSNRLPVDRTSTEDSDAGWRRSPGGLVTALAPVMATRDGAWVGWHGAA-----DG  82

Query  53   HFDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNR  112
              +  +   +  +   L+  + + YY GFSN +LWP  HD     E++   +  Y+ VNR
Sbjct  83   ELEPFHHEGMDLIPVPLSADEVELYYEGFSNASLWPLYHDVIAPPEFHRTWWDAYRTVNR  142

Query  113  LFATKIAEFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAE  172
             FA   A  A P+  +WVQDY    V R+ R+L    +IGFF HIPF   EI+ ++P   
Sbjct  143  RFAAAAAGAAAPNATVWVQDYQLQLVPRYLRQLRPDLRIGFFNHIPFPPPEIFAQLPWRR  202

Query  173  QLMDDLCHYNLIGLQTAQDQENCISVCSVLLKA--QKIQNNMISLNQRVTQIQ---DYPI  227
            +++  L   +LIG Q   D  N +      + A  +  Q  +  L+ +V  I     +PI
Sbjct  203  EIISGLLEADLIGFQRPSDSANFLRSARRFVGAGVKAAQVQIKDLDGKVVHISRAAPFPI  262

Query  228  GVDVKGIQK------TLSNLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLD  281
             +DV  IQ+       ++      + L NP  I  ++GVDR+DY+KG+  R  A+ E L 
Sbjct  263  SIDVAKIQELAVRPDVIARSKQIREDLGNPETI--LLGVDRLDYTKGITHRLKAYGELLT  320

Query  282  RNTAFHQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPH  341
                  +    +Q+ASP R  V +Y+ L +     V  IN +F   +   I   + S P 
Sbjct  321  DGAITVEDAALIQVASPSRERVESYRLLRDEVDGMVGRINGQFDTTSNTAIRYLHHSYPV  380

Query  342  HELMQFYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVN  401
             E++  Y  +D+  VTSL+DGMNLVAKEY+AA+  +N G L+LSEF GAA+Q++ AL+VN
Sbjct  381  EEMVALYLASDVMLVTSLRDGMNLVAKEYVAARG-NNTGALVLSEFTGAADQLKSALLVN  439

Query  402  PKNRDAMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            P + D +  A+  A+ +S  E   R   + +Q++ +D+ +W ++FL  L
Sbjct  440  PHDIDGLKTAIMRAVRLSPGESSRRMRAMRRQVLAHDVQRWSEEFLSTL  488


> A1XGA8 Trehalose-6-phosphate synthase [Propionibacterium freudenreichii 
subsp. shermanii]
Length=493

 Score =  243 bits (620),  Expect = 1e-76
 Identities = 162/472 (34%), Positives = 239/472 (51%), Gaps = 27/472 (6%)

Query  2    SRLIILSNRVSLPQTE---------CVAGGLAVAMQDALSQLGGVWVGWNGKKIE--QPF  50
            S+ ++++NR+ + + +            GGL  A+   +   GG WVGW G   E  QPF
Sbjct  32   SQFVVVANRLPVDRVQNDDDSSGWALSPGGLVTALIPVMKDHGGTWVGWVGSADEHIQPF  91

Query  51   EQHFDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDV  110
               FD         M   L+ Q++ +YY G SN T WP  HD  +  EY+ + + +Y +V
Sbjct  92   T--FD-----GYGIMPVDLSAQEFNEYYEGMSNATFWPLYHDCVEHPEYHREWWDSYMEV  144

Query  111  NRLFATKIAEFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPC  170
            N+ FAT  AE A P   +WVQDY   +V    R++    KIGFFLHIPF   E++ ++P 
Sbjct  145  NQRFATAAAEVAAPGATVWVQDYQLQNVPALLRQMRPDLKIGFFLHIPFPPSELFMQLPW  204

Query  171  AEQLMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVD  230
              Q++  L   + IG Q      N   +   L   +   + + S + RV   + YPI +D
Sbjct  205  RYQVISGLLGSDQIGFQDPGSARNFAHLVRRLAGMRTQGDRIFSPDGRVILARAYPISID  264

Query  231  VKGI---QKTLSNLSDQDQY---LTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNT  284
             +GI    +T    ++ +Q    L NP   K  +GVDR+DY+KGL  R  AF E      
Sbjct  265  AQGILDLSRTPQARAEAEQLREDLGNPD--KIFLGVDRLDYTKGLRHRVRAFGELFTSGQ  322

Query  285  AFHQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHEL  344
                +  ++QIA+P R  VA Y+ L       V  INS   +    PI   + S P   L
Sbjct  323  LDPMRNVYLQIATPTREGVARYQVLRSIIDEMVGRINSSVGRIGRSPIEYRHASYPKMAL  382

Query  345  MQFYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKN  404
               YR AD+  VT L+DGMNLVAKEY+A+ + D  G L+LSEFAGA+ +++ A +VNP +
Sbjct  383  AAMYRAADVMVVTPLRDGMNLVAKEYVASHDSD-AGALVLSEFAGASLELKQAYMVNPYD  441

Query  405  RDAMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYI  456
             + M   L  A   +      R   + KQ+  +DI+ W + FL DL + + +
Sbjct  442  LNGMKNQLLRAAGDTHANHVRRMRSMRKQVFRHDIDAWANSFLTDLGTERSV  493


> Q875L7 Trehalose-6-phosphate synthase [Magnaporthe grisea]
Length=529

 Score =  242 bits (617),  Expect = 8e-76
 Identities = 156/471 (33%), Positives = 239/471 (51%), Gaps = 30/471 (6%)

Query  3    RLIILSNRVSLP---------QTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQ----P  49
            RL+++SNR+ +               +GGL   +          W GW G ++      P
Sbjct  15   RLLLISNRLPITIKRSDDGQYSFSMSSGGLVTGLSGLAKTTSFQWYGWPGLEVPDAEAGP  74

Query  50   FEQHFDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQD  109
              Q     Y +   ++   L  + Y     GF+N+ LWP  H     I ++   +  Y++
Sbjct  75   VVQRLKNEYGAHPVFVDDELADRHYN----GFANSILWPLFHYHPGEITFDESAWSAYKE  130

Query  110  VNRLFATKIAEFAQPDDLIWVQDYHFLSVARHCRE-LGMQNK---IGFFLHIPFASLEIW  165
            VNRLFA  + +  Q  D+IWV DYH + +    RE +G   K   IGFFLH PF S EI+
Sbjct  131  VNRLFAQTVVKDVQDGDMIWVHDYHLMLLPEMLREEIGDSKKNVKIGFFLHTPFPSSEIY  190

Query  166  RKIPCAEQLMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDY  225
            R +P  + L+  + H +L+G  T     + +S CS +L A    N +    + VT +  +
Sbjct  191  RILPVRQALLQGVLHCDLLGFHTYDYARHFLSSCSRILSAPTTPNGVQFAGRFVT-VGAF  249

Query  226  PIGVD----VKGIQKTLSNLSDQDQYLTNP-SAIKTIIGVDRIDYSKGLFERFNAFAEFL  280
            PIG+D    V+G+QK    +  +   LT     +K I+GVDR+DY KG+ ++ +A   FL
Sbjct  250  PIGIDPEKFVEGLQKP--KVQQRIAALTRKFEGVKLIVGVDRLDYIKGVPQKLHALEVFL  307

Query  281  DRNTAFHQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKP  340
              +  +  K+  VQ+A P R +V  Y+ L       V  IN +F    ++PI   + S  
Sbjct  308  TEHPEWIGKIVLVQVAVPSRQDVEEYQNLRAVVNELVGRINGKFGTIEFMPIHFLHQSVS  367

Query  341  HHELMQFYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIV  400
              EL   Y  +D+C V+S +DGMNLV+ EYIA Q  D  GV+ILSEF GAA+ +  +LIV
Sbjct  368  FDELAALYAVSDVCLVSSTRDGMNLVSYEYIATQR-DRHGVMILSEFTGAAQSLSGSLIV  426

Query  401  NPKNRDAMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLN  451
            NP N + +  A+  A+ M  E+R+  + KL + + +Y    W   F+ +LN
Sbjct  427  NPWNTEELANAIHDAVTMGPEQREANFKKLERYVFKYTSAWWGSSFVAELN  477


> Q27V66 Trehalose-6-phosphate synthase [Saccharomycopsis fibuligera]
Length=488

 Score =  239 bits (610),  Expect = 3e-75
 Identities = 150/465 (32%), Positives = 245/465 (53%), Gaps = 20/465 (4%)

Query  4    LIILSNR--VSLPQTE-------CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHF  54
            ++++SNR  V++ ++E         +GGL  A+Q         W GW G +I Q  ++  
Sbjct  6    VLVVSNRLPVTIKRSEDGKYEYSMSSGGLVTALQGLKKSTSFQWYGWPGLEIPQDEQEKV  65

Query  55   DILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLF  114
                 +K   +   +  +  + +Y GFSN+ LWP  H     I ++   +  Y + N+ F
Sbjct  66   KNDLITKFDCIPIFIPDEIAELHYNGFSNSILWPLFHYHPGEINFDENAWFAYNEANKPF  125

Query  115  ATKIAEFAQPDDLIWVQDYHFLSVARHCRELGMQN-----KIGFFLHIPFASLEIWRKIP  169
            A +IA+  + +D+IWV DYH + +    ++   +      K+GFFLH PF S EI+R +P
Sbjct  126  AEEIAKHTKENDMIWVHDYHLMLLPELLKQRIAEKRIFNVKLGFFLHTPFPSSEIYRILP  185

Query  170  CAEQLMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGV  229
              +++M  +   +LIG  T     + +S  S +L    + N  I  N R   +  +PIG+
Sbjct  186  VRKEIMAGVLSCDLIGFHTYDYARHFLSSVSKVLHLNTLPNG-IEYNDRFISVGAFPIGI  244

Query  230  DVKGIQKTLSNLSDQDQYLTNPSA----IKTIIGVDRIDYSKGLFERFNAFAEFLDRNTA  285
            DV      L   + Q +     +     IK I+GVDR+DY KG+ ++ +AF  FL+ +  
Sbjct  245  DVDKFVNGLKTDTVQQRIKQLRAKLGDDIKVIVGVDRLDYIKGVPQKLHAFEVFLNEHPE  304

Query  286  FHQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELM  345
               KV  +Q+A P R +V  Y+ L       V  IN +F   +++PI   + S P +EL+
Sbjct  305  MVGKVILIQLAIPSRGDVEEYQNLRATVNELVGRINGKFGTIDFVPIHFMHRSVPFNELI  364

Query  346  QFYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNR  405
              Y  +D+C V+S +DGMNLV+ EYIA Q  DN GVLILSEFAGAA+ +  ++IVNP N 
Sbjct  365  SLYNISDVCLVSSTRDGMNLVSYEYIACQK-DNHGVLILSEFAGAAQSLNGSIIVNPWNI  423

Query  406  DAMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            + + +A+  +L +   +R+  + KL   + +Y    W + F+ +L
Sbjct  424  EELSEAIYESLTLPAPKRKSNHDKLFGYISKYTSAYWGESFVNEL  468


> Q7WUI7 Trehalose-6-phosphate synthase [Thermus thermophilus]
Length=449

 Score =  238 bits (607),  Expect = 3e-75
 Identities = 155/462 (34%), Positives = 234/462 (51%), Gaps = 33/462 (7%)

Query  4    LIILSNRVSLPQTE----CVAGGLAVAMQDALSQLGGVWVG---WNGK-KIEQPFEQHFD  55
            LII++NR     T        GGLA A+   L +  GVWV    W  K +   P E    
Sbjct  3    LIIVANRAPFRLTPEGLVPAVGGLATALLPVLERRHGVWVAAGEWREKGQAATPRE----  58

Query  56   ILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFA  115
                S++      L ++++Q YY GFSN  LWP  H   + +E     ++ YQ  NR FA
Sbjct  59   ----SQVRLEQVFLPEKEWQGYYGGFSNRVLWPLCHYFLERVELRRDFYQDYQRANRRFA  114

Query  116  TKIAEFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLM  175
             ++A+  +  D ++VQDYH L + R  RE  +  KIGFF HIP+ S  ++R +P    L+
Sbjct  115  ERVAQVFREGDTVFVQDYHLLLLPRLLRER-IPAKIGFFFHIPWPSSGVFRILPWGRALV  173

Query  176  DDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQ  235
            + +   +LIG  T +  EN +   +      +++ N + + +R  +++ +P+G+D     
Sbjct  174  EGVLGADLIGFHTPEYVENFLRTAAYY--GYQVEENRVRVGERWVRVEAHPLGIDTG---  228

Query  236  KTLSNLSDQDQYLTNPSAIKT-------IIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQ  288
                 L+       +  A+K        I+GVDR+DY+KG+ ER  A+   L     +  
Sbjct  229  -RFGELAQDPHIGLHARALKRLAGAERLILGVDRLDYTKGILERLLAYERLLQSYPQWRG  287

Query  289  KVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFY  348
            +V   QIA+P R  V  Y+ L  R    V  I   F +++W+P+   Y +    EL  FY
Sbjct  288  RVAFFQIATPSRTSVHAYRELKRRVDEVVGRIMGSFLREDWVPLRYFYQTYTQEELAAFY  347

Query  349  RNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAM  408
            R AD+  +T L+DGMNLVA EY         GVL+LS  AGAAE +++AL+VNP + D M
Sbjct  348  RAADVALITPLRDGMNLVAMEYAYT---TEDGVLVLSNLAGAAEYLKEALLVNPYDLDGM  404

Query  409  IKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
             +AL  AL M   ER+ R   L  ++   D+  W + FL  L
Sbjct  405  AQALDRALRMPGGERRERLSALKARIEALDVQGWAERFLASL  446



Lambda      K        H        a         alpha
   0.324    0.137    0.420    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3805400


  Database: 56204874c2cc668e36ad0d4bd05db0f7.TrEMBL.fasta
    Posted date:  Sep 28, 2020  1:07 PM
  Number of letters in database: 10,130
  Number of sequences in database:  21



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40