ACIAD1774 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 0b381cfe542163886449ac065721e4c9.SwissProt.fasta
           30 sequences; 14,828 total letters



Query= ACIAD1774

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q2NTK9 Trehalose-6-phosphate synthase [Sodalis glossinidius (st...   339    1e-113
  A1AC53 Trehalose-6-phosphate synthase [Escherichia coli O1:K1 /...   327    8e-109
  Q1RAP1 Trehalose-6-phosphate synthase [Escherichia coli (strain...   327    8e-109
  Q0TGU0 Trehalose-6-phosphate synthase [Escherichia coli O6:K15:...   327    1e-108
  Q8FGN6 Trehalose-6-phosphate synthase [Escherichia coli O6:H1 (...   327    1e-108
  A8AFD4 Trehalose-6-phosphate synthase [Citrobacter koseri (stra...   326    1e-108
  B1X658 Trehalose-6-phosphate synthase [Escherichia coli (strain...   326    1e-108
  B1J0J4 Trehalose-6-phosphate synthase [Escherichia coli (strain...   326    1e-108
  B1LQW0 Trehalose-6-phosphate synthase [Escherichia coli (strain...   326    1e-108
  A7ZN22 Trehalose-6-phosphate synthase [Escherichia coli O139:H2...   326    1e-108
  P31677 Trehalose-6-phosphate synthase [Escherichia coli (strain...   326    1e-108
  A8A1A0 Trehalose-6-phosphate synthase [Escherichia coli O9:H4 (...   326    2e-108
  Q8XCE7 Trehalose-6-phosphate synthase [Escherichia coli O157:H7]     326    2e-108
  Q57N70 Trehalose-6-phosphate synthase [Salmonella choleraesuis ...   325    4e-108
  Q5PMW8 Trehalose-6-phosphate synthase [Salmonella paratyphi A (...   325    6e-108
  A9MU86 Trehalose-6-phosphate synthase [Salmonella paratyphi B (...   325    6e-108
  P0A1Q1 Trehalose-6-phosphate synthase [Salmonella typhi]             325    6e-108
  E1WGG8 Trehalose-6-phosphate synthase [Salmonella typhimurium (...   325    6e-108
  P0CL06 Trehalose-6-phosphate synthase [Salmonella typhimurium (...   325    6e-108
  A6TB47 Trehalose-6-phosphate synthase [Klebsiella pneumoniae su...   324    8e-108
  P55612 Trehalose-6-phosphate synthase [Sinorhizobium fredii (st...   324    9e-108
  Q6JTB2 Trehalose-6-phosphate synthase [Pseudomonas savastanoi]       324    1e-107
  Q92410 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] [...   255    4e-81 
  P40387 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] [...   247    7e-78 
  Q54K57 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A...   247    7e-76 
  G4RK44 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] /...   240    3e-73 
  O94213 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] [...   233    5e-73 
  Q00075 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1...   232    4e-72 
  Q00764 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5...   231    4e-72 
  Q00217 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2...   230    1e-71 


> Q2NTK9 Trehalose-6-phosphate synthase [Sodalis glossinidius (strain 
morsitans)]
Length=469

 Score =  339 bits (870),  Expect = 1e-113
 Identities = 177/454 (39%), Positives = 271/454 (60%), Gaps = 8/454 (2%)

Query  1    MSRLIILSNRVS-LPQTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQ--PFEQHFDIL  57
            MSRL+++SNR++ +   +  AGGLAV + D+L   GG+W GWNGK  E+  P E++    
Sbjct  1    MSRLVVVSNRIAAIEGKKESAGGLAVGIMDSLKDQGGLWFGWNGKISEEDEPLEKN----  56

Query  58   YKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATK  117
             +  IT+   +L Q +Y  YY  FSN  +WPA H R DL++Y  +++  Y  VN + A +
Sbjct  57   QQDNITFAAFSLKQSEYDQYYLNFSNTVIWPAFHYRLDLVQYQREDYDGYCRVNEMLAGR  116

Query  118  IAEFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDD  177
            +      DD++W+ DYH L  A  CR+LGM+N+IGFFLHIPF + EI+  +P  ++L++ 
Sbjct  117  LKPLVNEDDILWIHDYHLLPFAAACRKLGMKNRIGFFLHIPFPTSEIFNALPPRKELLEK  176

Query  178  LCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKT  237
            LC Y+L+G Q   D++  I   +++   + + ++ I    ++   + YPIGV+ + I++ 
Sbjct  177  LCEYDLVGFQAESDRQAFIENLALVTTVEDLDDDRIKAYNKLVTARVYPIGVEPESIREL  236

Query  238  LSN-LSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQIA  296
                L  +  +L +    + II VDR+DYSKGL ERF A+   L+        +++ QIA
Sbjct  237  AEGPLPPKLAHLRDKMNGQLIISVDRLDYSKGLPERFQAYETLLENYPQHRGNIRYFQIA  296

Query  297  SPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADICWV  356
               R +V  Y+ +    + +   IN  FS   W P+           LM+ +R+ ++  V
Sbjct  297  PTSRGDVQAYQDIRHELETEAGRINGHFSTLEWTPLFYLNQHYERSLLMKIFRHCEVGLV  356

Query  357  TSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKLAL  416
            T L+DGMNLVAKEY+A+QNP++PGVLILS FAGAA ++  AL+VNP +RD +  AL  AL
Sbjct  357  TPLRDGMNLVAKEYVASQNPNDPGVLILSHFAGAANELTSALLVNPYDRDGVASALDKAL  416

Query  417  NMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            +M L ER+ RY ++I  + + DI  W   FL DL
Sbjct  417  SMPLSERKARYQEMIAVIKQNDIVHWCQSFLDDL  450


> A1AC53 Trehalose-6-phosphate synthase [Escherichia coli O1:K1 
/ APEC]
Length=474

 Score =  327 bits (838),  Expect = 8e-109
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNKFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  EYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTACGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> Q1RAP1 Trehalose-6-phosphate synthase [Escherichia coli (strain 
UTI89 / UPEC)]
Length=474

 Score =  327 bits (838),  Expect = 8e-109
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNKFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  EYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTACGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> Q0TGU0 Trehalose-6-phosphate synthase [Escherichia coli O6:K15:H31 
(strain 536 / UPEC)]
Length=474

 Score =  327 bits (837),  Expect = 1e-108
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNKFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  DYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTACGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> Q8FGN6 Trehalose-6-phosphate synthase [Escherichia coli O6:H1 
(strain CFT073 / ATCC 700928 / UPEC)]
Length=474

 Score =  327 bits (837),  Expect = 1e-108
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNKFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  DYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTACGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> A8AFD4 Trehalose-6-phosphate synthase [Citrobacter koseri (strain 
ATCC BAA-895 / CDC 4225-83 / SGSC4696)]
Length=473

 Score =  326 bits (836),  Expect = 1e-108
 Identities = 177/458 (39%), Positives = 273/458 (60%), Gaps = 16/458 (3%)

Query  1    MSRLIILSNRVSLPQTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYKS  60
            M RL+++SNR++ P  +  AGGLAV +  AL   GG+W GW+G+   +  ++    + + 
Sbjct  1    MGRLVVVSNRIAPPDNKGGAGGLAVGVLGALKAAGGLWFGWSGETGNE--DKPLKKVTRG  58

Query  61   KITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIAE  120
             +T+ +  L++Q Y++YYC FSN  LWPA H R DL+++    ++ Y  VN L A K+  
Sbjct  59   NMTWASFNLSEQDYEEYYCQFSNAVLWPAFHYRLDLVQFQRPAWEGYSRVNALLADKLLP  118

Query  121  FAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLCH  180
              + DD+IWV DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC 
Sbjct  119  LLKDDDIIWVHDYHLLPFASELRKRGVNNRIGFFLHIPFPTPEIFNALPPHDTLLEQLCD  178

Query  181  YNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS-  239
            ++L+G QT  D+   +   S   +     +   S   +  + + YPIG++   I +  S 
Sbjct  179  FDLLGFQTENDRLAFLDSLSSQTRVTTRGSKSHSAWGKSFRTEVYPIGIEPDEIAQQASG  238

Query  240  ----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQI  295
                 L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ QI
Sbjct  239  PLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFQAYEALLEKYPQHHGKIRYTQI  295

Query  296  ASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNAD  352
            A   R EV  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +D
Sbjct  296  APTSRGEVQAYQDIRHQLETEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKVFRYSD  352

Query  353  ICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKAL  412
            +  VT L+DGMNLVAKE++AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  AL
Sbjct  353  VGLVTPLRDGMNLVAKEFVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDDVAVAL  412

Query  413  KLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
              AL M L ER  R+ ++++ +I+ DIN W+  F++DL
Sbjct  413  HRALTMPLAERISRHAEMLETIIKNDINHWQQRFIRDL  450


> B1X658 Trehalose-6-phosphate synthase [Escherichia coli (strain 
K12 / DH10B)]
Length=474

 Score =  326 bits (836),  Expect = 1e-108
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  DYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> B1J0J4 Trehalose-6-phosphate synthase [Escherichia coli (strain 
ATCC 8739 / DSM 1576 / Crooks)]
Length=474

 Score =  326 bits (836),  Expect = 1e-108
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  DYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> B1LQW0 Trehalose-6-phosphate synthase [Escherichia coli (strain 
SMS-3-5 / SECEC)]
Length=474

 Score =  326 bits (836),  Expect = 1e-108
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  DYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> A7ZN22 Trehalose-6-phosphate synthase [Escherichia coli O139:H28 
(strain E24377A / ETEC)]
Length=474

 Score =  326 bits (836),  Expect = 1e-108
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  DYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> P31677 Trehalose-6-phosphate synthase [Escherichia coli (strain 
K12)]
Length=474

 Score =  326 bits (836),  Expect = 1e-108
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  DYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> A8A1A0 Trehalose-6-phosphate synthase [Escherichia coli O9:H4 
(strain HS)]
Length=474

 Score =  326 bits (835),  Expect = 2e-108
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  DYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEVLLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> Q8XCE7 Trehalose-6-phosphate synthase [Escherichia coli O157:H7]
Length=474

 Score =  326 bits (835),  Expect = 2e-108
 Identities = 181/459 (39%), Positives = 270/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  DYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAVA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> Q57N70 Trehalose-6-phosphate synthase [Salmonella choleraesuis 
(strain SC-B67)]
Length=473

 Score =  325 bits (833),  Expect = 4e-108
 Identities = 181/463 (39%), Positives = 275/463 (59%), Gaps = 26/463 (6%)

Query  1    MSRLIILSNRVSLPQTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYKS  60
            MSRL+++SNR++ P  +  AGGLAV +  AL   GG+W GW+G+   +  ++    + K 
Sbjct  1    MSRLVVVSNRIAPPDNKGGAGGLAVGVLGALKAAGGLWFGWSGETGNE--DEPLKKVTKG  58

Query  61   KITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIAE  120
             IT+ +  L++Q Y+DYYC FSN  LWPA H R DL+++    ++ Y  VN L A K+  
Sbjct  59   NITWASFNLSEQDYEDYYCQFSNAVLWPAFHYRLDLVQFQRPAWEGYMRVNALLADKLLP  118

Query  121  FAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLCH  180
              + +D+IWV DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  ++L++ LC 
Sbjct  119  LIKENDIIWVHDYHLLPFASELRKRGVNNRIGFFLHIPFPTPEIFNALPPHDELLEQLCD  178

Query  181  YNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVT-----QIQDYPIGVDVKGIQ  235
            ++L+G QT  D+   ++    LL   ++     S  Q +      Q + YPIG++   I 
Sbjct  179  FDLLGFQTENDR---LAFLDSLLSQTRVTTR--SGKQHIAWGKDFQTEVYPIGIEPDEIA  233

Query  236  KTLS-----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKV  290
               +      L+     L N   +K I  V+R+DYSKGL ERF A+   L+       K+
Sbjct  234  LQAAGPLPPKLAQLKAELKN---VKNIFSVERLDYSKGLPERFLAYEALLENYPQHRGKI  290

Query  291  QHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQF  347
            ++ QIA   R EV  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ 
Sbjct  291  RYTQIAPTSRGEVQAYQDIRHQLETEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKI  347

Query  348  YRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDA  407
            +R +D+  VT L+DGMNLVAKE++AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD 
Sbjct  348  FRYSDVGLVTPLRDGMNLVAKEFVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDD  407

Query  408  MIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            +  AL  AL M L ER  R+ +++  +++ DIN+W++ F+ DL
Sbjct  408  VAAALNRALTMPLAERISRHAEMLDVIVKNDINRWQERFIHDL  450


> Q5PMW8 Trehalose-6-phosphate synthase [Salmonella paratyphi A 
(strain ATCC 9150 / SARB42)]
Length=473

 Score =  325 bits (832),  Expect = 6e-108
 Identities = 178/458 (39%), Positives = 270/458 (59%), Gaps = 16/458 (3%)

Query  1    MSRLIILSNRVSLPQTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYKS  60
            MSRL+++SNR++ P  +  AGGLAV +  AL   GG+W GW+G+   +  ++    + K 
Sbjct  1    MSRLVVVSNRIAPPDNKGGAGGLAVGVLGALKAAGGLWFGWSGETGNE--DEPLKKVTKG  58

Query  61   KITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIAE  120
             IT+ +  L++Q Y+DYYC FSN  LWPA H R DL+++    ++ Y  VN L A K+  
Sbjct  59   NITWASFNLSEQDYEDYYCQFSNAVLWPAFHYRLDLVQFQRPAWEGYMRVNALLADKLLP  118

Query  121  FAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLCH  180
              + +D+IWV DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  ++L++ LC 
Sbjct  119  LIKENDIIWVHDYHLLPFASELRKRGVNNRIGFFLHIPFPTPEIFNALPPHDELLEQLCD  178

Query  181  YNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS-  239
            ++L+G QT  D+   +   S   +             +  Q + YPIG++   I    + 
Sbjct  179  FDLLGFQTENDRLAFLDSLSSQTRVTTRSGKQHIAWGKDFQTEVYPIGIEPDEIALQAAG  238

Query  240  ----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQI  295
                 L+     L N   +K I  V+R+DYSKGL ERF A+   L+       K+++ QI
Sbjct  239  PLPPKLAQLKAELKN---VKNIFSVERLDYSKGLPERFLAYEALLENYPQHRGKIRYTQI  295

Query  296  ASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNAD  352
            A   R EV  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +D
Sbjct  296  APTSRGEVQAYQDIRHQLETEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYSD  352

Query  353  ICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKAL  412
            +  VT L+DGMNLVAKE++AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  AL
Sbjct  353  VGLVTPLRDGMNLVAKEFVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDDVAAAL  412

Query  413  KLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
              AL M L ER  R+ +++  +++ DIN+W++ F+ DL
Sbjct  413  NRALTMPLAERISRHAEMLDVIVKNDINRWQERFIHDL  450


> A9MU86 Trehalose-6-phosphate synthase [Salmonella paratyphi B 
(strain ATCC BAA-1250 / SPB7)]
Length=473

 Score =  325 bits (832),  Expect = 6e-108
 Identities = 178/458 (39%), Positives = 270/458 (59%), Gaps = 16/458 (3%)

Query  1    MSRLIILSNRVSLPQTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYKS  60
            MSRL+++SNR++ P  +  AGGLAV +  AL   GG+W GW+G+   +  ++    + K 
Sbjct  1    MSRLVVVSNRIAPPDNKGGAGGLAVGVLGALKAAGGLWFGWSGETGNE--DEPLKKVTKG  58

Query  61   KITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIAE  120
             IT+ +  L++Q Y+DYYC FSN  LWPA H R DL+++    ++ Y  VN L A K+  
Sbjct  59   NITWASFNLSEQDYEDYYCQFSNAVLWPAFHYRLDLVQFQRPAWEGYMRVNALLADKLLP  118

Query  121  FAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLCH  180
              + +D+IWV DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  ++L++ LC 
Sbjct  119  LIKENDIIWVHDYHLLPFASELRKRGVNNRIGFFLHIPFPTPEIFNALPPHDELLEQLCD  178

Query  181  YNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS-  239
            ++L+G QT  D+   +   S   +             +  Q + YPIG++   I    + 
Sbjct  179  FDLLGFQTENDRLAFLDSLSSQTRVTTRSGKQHIAWGKDFQTEVYPIGIEPDEIALQAAG  238

Query  240  ----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQI  295
                 L+     L N   +K I  V+R+DYSKGL ERF A+   L+       K+++ QI
Sbjct  239  PLPPKLAQLKAELKN---VKNIFSVERLDYSKGLPERFLAYEALLENYPQHRGKIRYTQI  295

Query  296  ASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNAD  352
            A   R EV  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +D
Sbjct  296  APTSRGEVQAYQDIRHQLETEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYSD  352

Query  353  ICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKAL  412
            +  VT L+DGMNLVAKE++AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  AL
Sbjct  353  VGLVTPLRDGMNLVAKEFVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDDVAAAL  412

Query  413  KLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
              AL M L ER  R+ +++  +++ DIN+W++ F+ DL
Sbjct  413  NRALTMPLAERISRHAEMLDVIVKNDINRWQERFIHDL  450


> P0A1Q1 Trehalose-6-phosphate synthase [Salmonella typhi]
Length=473

 Score =  325 bits (832),  Expect = 6e-108
 Identities = 178/458 (39%), Positives = 270/458 (59%), Gaps = 16/458 (3%)

Query  1    MSRLIILSNRVSLPQTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYKS  60
            MSRL+++SNR++ P  +  AGGLAV +  AL   GG+W GW+G+   +  ++    + K 
Sbjct  1    MSRLVVVSNRIAPPDNKGGAGGLAVGVLGALKAAGGLWFGWSGETGNE--DEPLKKVTKG  58

Query  61   KITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIAE  120
             IT+ +  L++Q Y+DYYC FSN  LWPA H R DL+++    ++ Y  VN L A K+  
Sbjct  59   NITWASFNLSEQDYEDYYCQFSNAVLWPAFHYRLDLVQFQRPAWEGYMRVNALLADKLLP  118

Query  121  FAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLCH  180
              + +D+IWV DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  ++L++ LC 
Sbjct  119  LIKENDIIWVHDYHLLPFASELRKRGVNNRIGFFLHIPFPTPEIFNALPPHDELLEQLCD  178

Query  181  YNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS-  239
            ++L+G QT  D+   +   S   +             +  Q + YPIG++   I    + 
Sbjct  179  FDLLGFQTENDRLAFLDSLSSQTRVTTRSGKQHIAWGKDFQTEVYPIGIEPDEIALQAAG  238

Query  240  ----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQI  295
                 L+     L N   +K I  V+R+DYSKGL ERF A+   L+       K+++ QI
Sbjct  239  PLPPKLAQLKAELKN---VKNIFSVERLDYSKGLPERFLAYEALLENYPQHRGKIRYTQI  295

Query  296  ASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNAD  352
            A   R EV  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +D
Sbjct  296  APTSRGEVQAYQDIRHQLETEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYSD  352

Query  353  ICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKAL  412
            +  VT L+DGMNLVAKE++AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  AL
Sbjct  353  VGLVTPLRDGMNLVAKEFVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDDVAAAL  412

Query  413  KLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
              AL M L ER  R+ +++  +++ DIN+W++ F+ DL
Sbjct  413  NRALTMPLAERISRHAEMLDVIVKNDINRWQERFIHDL  450


> E1WGG8 Trehalose-6-phosphate synthase [Salmonella typhimurium 
(strain SL1344)]
Length=473

 Score =  325 bits (832),  Expect = 6e-108
 Identities = 178/458 (39%), Positives = 270/458 (59%), Gaps = 16/458 (3%)

Query  1    MSRLIILSNRVSLPQTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYKS  60
            MSRL+++SNR++ P  +  AGGLAV +  AL   GG+W GW+G+   +  ++    + K 
Sbjct  1    MSRLVVVSNRIAPPDNKGGAGGLAVGVLGALKAAGGLWFGWSGETGNE--DEPLKKVTKG  58

Query  61   KITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIAE  120
             IT+ +  L++Q Y+DYYC FSN  LWPA H R DL+++    ++ Y  VN L A K+  
Sbjct  59   NITWASFNLSEQDYEDYYCQFSNAVLWPAFHYRLDLVQFQRPAWEGYMRVNALLADKLLP  118

Query  121  FAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLCH  180
              + +D+IWV DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  ++L++ LC 
Sbjct  119  LIKENDIIWVHDYHLLPFASELRKRGVNNRIGFFLHIPFPTPEIFNALPPHDELLEQLCD  178

Query  181  YNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS-  239
            ++L+G QT  D+   +   S   +             +  Q + YPIG++   I    + 
Sbjct  179  FDLLGFQTENDRLAFLDSLSSQTRVTTRSGKQHIAWGKDFQTEVYPIGIEPDEIALQAAG  238

Query  240  ----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQI  295
                 L+     L N   +K I  V+R+DYSKGL ERF A+   L+       K+++ QI
Sbjct  239  PLPPKLAQLKAELKN---VKNIFSVERLDYSKGLPERFLAYEALLENYPQHRGKIRYTQI  295

Query  296  ASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNAD  352
            A   R EV  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +D
Sbjct  296  APTSRGEVQAYQDIRHQLETEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYSD  352

Query  353  ICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKAL  412
            +  VT L+DGMNLVAKE++AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  AL
Sbjct  353  VGLVTPLRDGMNLVAKEFVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDDVAAAL  412

Query  413  KLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
              AL M L ER  R+ +++  +++ DIN+W++ F+ DL
Sbjct  413  NRALTMPLAERISRHAEMLDVIVKNDINRWQERFIHDL  450


> P0CL06 Trehalose-6-phosphate synthase [Salmonella typhimurium 
(strain LT2 / SGSC1412 / ATCC 700720)]
Length=473

 Score =  325 bits (832),  Expect = 6e-108
 Identities = 178/458 (39%), Positives = 270/458 (59%), Gaps = 16/458 (3%)

Query  1    MSRLIILSNRVSLPQTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYKS  60
            MSRL+++SNR++ P  +  AGGLAV +  AL   GG+W GW+G+   +  ++    + K 
Sbjct  1    MSRLVVVSNRIAPPDNKGGAGGLAVGVLGALKAAGGLWFGWSGETGNE--DEPLKKVTKG  58

Query  61   KITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIAE  120
             IT+ +  L++Q Y+DYYC FSN  LWPA H R DL+++    ++ Y  VN L A K+  
Sbjct  59   NITWASFNLSEQDYEDYYCQFSNAVLWPAFHYRLDLVQFQRPAWEGYMRVNALLADKLLP  118

Query  121  FAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLCH  180
              + +D+IWV DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P  ++L++ LC 
Sbjct  119  LIKENDIIWVHDYHLLPFASELRKRGVNNRIGFFLHIPFPTPEIFNALPPHDELLEQLCD  178

Query  181  YNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS-  239
            ++L+G QT  D+   +   S   +             +  Q + YPIG++   I    + 
Sbjct  179  FDLLGFQTENDRLAFLDSLSSQTRVTTRSGKQHIAWGKDFQTEVYPIGIEPDEIALQAAG  238

Query  240  ----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQI  295
                 L+     L N   +K I  V+R+DYSKGL ERF A+   L+       K+++ QI
Sbjct  239  PLPPKLAQLKAELKN---VKNIFSVERLDYSKGLPERFLAYEALLENYPQHRGKIRYTQI  295

Query  296  ASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNAD  352
            A   R EV  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +D
Sbjct  296  APTSRGEVQAYQDIRHQLETEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYSD  352

Query  353  ICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKAL  412
            +  VT L+DGMNLVAKE++AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  AL
Sbjct  353  VGLVTPLRDGMNLVAKEFVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDDVAAAL  412

Query  413  KLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
              AL M L ER  R+ +++  +++ DIN+W++ F+ DL
Sbjct  413  NRALTMPLAERISRHAEMLDVIVKNDINRWQERFIHDL  450


> A6TB47 Trehalose-6-phosphate synthase [Klebsiella pneumoniae 
subsp. pneumoniae (strain ATCC 700721 / MGH 78578)]
Length=474

 Score =  324 bits (831),  Expect = 8e-108
 Identities = 178/458 (39%), Positives = 272/458 (59%), Gaps = 15/458 (3%)

Query  1    MSRLIILSNRVSLPQTE-CVAGGLAVAMQDALSQLGGVWVGWNGK--KIEQPFEQHFDIL  57
            MSRL+++SNR++LP  +   AGGLAV +  AL   GG+W GW+G+    +QP +Q    +
Sbjct  1    MSRLVVVSNRIALPDDKKSSAGGLAVGILGALRAAGGLWFGWSGEIGDDQQPLKQ----V  56

Query  58   YKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATK  117
             +  I++ +  L ++ + +YY  FSN  LWPA H R DL+ +  + ++ Y  VN + A K
Sbjct  57   SRGNISWASFNLNERDHDEYYNQFSNAVLWPAFHYRLDLVSFQREAWEGYLRVNAMLADK  116

Query  118  IAEFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDD  177
            +    +PDD +W+ DYH L  A   R+ G+ N+IGFFLHIPF + EI+  +P   +L++ 
Sbjct  117  LLPLIEPDDTLWIHDYHLLPFASELRKRGVNNRIGFFLHIPFPTPEIFNALPPHAELLEQ  176

Query  178  LCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKT  237
            LC Y+L+G QT  D+   +   ++  +   + +       +    + YPIG+D   I + 
Sbjct  177  LCDYDLLGFQTESDRTAFLDSIAMQTRLSDLGDKRYQAWGKAFSTEVYPIGIDPDEITRN  236

Query  238  LSN-LSDQDQYLTNP-SAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQI  295
                L  +   L N    +K I  V+R+DYSKGL ERF A+   L++    H K+++ QI
Sbjct  237  AKGPLPPKLAQLKNELKNVKNIFSVERLDYSKGLPERFLAYETLLEKYPQHHGKIRYTQI  296

Query  296  ASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNAD  352
            A   R +V  Y+ +  + +     IN +F Q  W P+     H+D K    LM+ +R +D
Sbjct  297  APTSRGDVQAYQDIRHQLETAAGRINGQFGQLGWTPLYYLNQHFDRK---LLMKVFRYSD  353

Query  353  ICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKAL  412
            +  VT L+DGMNLVAKEY+AAQ+PDNPGVL+LS+FAGAA+++  ALIVNP +RD +  AL
Sbjct  354  VGLVTPLRDGMNLVAKEYVAAQDPDNPGVLVLSQFAGAAQELTSALIVNPYDRDEVAAAL  413

Query  413  KLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
              AL+M L ER  R+  ++  + E DI+ W+  F++DL
Sbjct  414  DRALSMPLAERIARHSAMLDVIRENDIHNWQARFVEDL  451


> P55612 Trehalose-6-phosphate synthase [Sinorhizobium fredii (strain 
NBRC 101917 / NGR234)]
Length=464

 Score =  324 bits (830),  Expect = 9e-108
 Identities = 182/459 (40%), Positives = 261/459 (57%), Gaps = 6/459 (1%)

Query  1    MSRLIILSNRVSLPQTECVA--GGLAVAMQDALS-QLGGVWVGWNGKKIEQPFEQHFDIL  57
            MSRL+I+SNRV +P    +A  GGLAVA++ AL  Q GG+W+GW+GK   +        L
Sbjct  1    MSRLVIVSNRVPVPDKGGIAPAGGLAVALKVALEEQGGGIWMGWSGKSSGEDEPAPLAQL  60

Query  58   YKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATK  117
             +  ITY    LT    ++YY GF+N  LWP  H R DL EY  KE   Y  VNR FA +
Sbjct  61   QQGNITYALTDLTDTDVEEYYHGFANRVLWPICHYRLDLAEYGRKEMAGYFRVNRFFAHR  120

Query  118  IAEFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDD  177
            +A   +PDD+IWV DY  + +A   R++G++N+IGFFLHIP+   ++   +P  E++M  
Sbjct  121  LAPLVKPDDVIWVHDYPLIPLAAELRQMGLENRIGFFLHIPWPPADVLFTMPVHEEIMRG  180

Query  178  LCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKT  237
            L HY+++G QT  D EN  S          +    +S   R+ +   Y IG++     + 
Sbjct  181  LSHYDVVGFQTDHDLENFASCLRREGIGDALGGGRLSAYGRIFKGGVYAIGIETAAFAEF  240

Query  238  LSNLSDQDQYLTNPSAIKT---IIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                S          +I+    IIGVDR+DYSKGL +R  AF  F+  N A   +V ++Q
Sbjct  241  AKKASTNSTVKKARESIERRSLIIGVDRLDYSKGLTQRIEAFERFILANPAQRGRVTYLQ  300

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRNADIC  354
            I    R EV  Y+ +      +   +N      +W+P+     S     L   YR   + 
Sbjct  301  ITPKSRSEVPEYEAMQRTVAEQAGRVNGALGAVDWVPMRYINRSVGRRVLAGLYRLGKVG  360

Query  355  WVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKALKL  414
             VT L+DG NLVAKEY+AAQ+PD+PGVL+LS FAGAA ++Q AL+VNP + +    A+  
Sbjct  361  LVTPLRDGKNLVAKEYVAAQDPDDPGVLVLSRFAGAARELQGALLVNPYDIEGTANAMAR  420

Query  415  ALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSS  453
            +L+M LEERQ R+  ++ QL+E+D+++W  DFL DL +S
Sbjct  421  SLSMPLEERQERWTTMMDQLLEHDVSRWCRDFLNDLTAS  459


> Q6JTB2 Trehalose-6-phosphate synthase [Pseudomonas savastanoi]
Length=474

 Score =  324 bits (830),  Expect = 1e-107
 Identities = 180/459 (39%), Positives = 269/459 (59%), Gaps = 17/459 (4%)

Query  1    MSRLIILSNRVSLPQTECV-AGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQHFDILYK  59
            MSRL+++SNR++ P      AGGLAV +  AL   GG+W GW+G+   +  +Q    + K
Sbjct  1    MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNE--DQPLKKVKK  58

Query  60   SKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRLFATKIA  119
              IT+ +  L++Q   +YY  FSN  LWPA H R DL+++    +  Y  VN L A K+ 
Sbjct  59   GNITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLL  118

Query  120  EFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQLMDDLC  179
               Q DD+IW+ DYH L  A   R+ G+ N+IGF LHIPF + EI+  +P  + L++ LC
Sbjct  119  PLLQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFLLHIPFPTPEIFNALPTYDTLLEQLC  178

Query  180  HYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKGIQKTLS  239
             Y+L+G QT  D+   +   S L +         +   +  + + YPIG++ K I K  +
Sbjct  179  DYDLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAA  238

Query  240  -----NLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKVQHVQ  294
                  L+     L N   ++ I  V+R+DYSKGL ERF A+   L++    H K+++ Q
Sbjct  239  GPLPPKLAQLKAELKN---VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQ  295

Query  295  IASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVC---HYDSKPHHELMQFYRNA  351
            IA   R +V  Y+ +  + + +   IN ++ Q  W P+     H+D K    LM+ +R +
Sbjct  296  IAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRK---LLMKIFRYS  352

Query  352  DICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIKA  411
            D+  VT L+DGMNLVAKEY+AAQ+P NPGVL+LS+FAGAA ++  ALIVNP +RD +  A
Sbjct  353  DVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAA  412

Query  412  LKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            L  AL MSL ER  R+ +++  +++ DIN W++ F+ DL
Sbjct  413  LDRALTMSLAERISRHAEMLDVIVKNDINHWQECFISDL  451


> Q92410 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
[Candida albicans (strain SC5314 / ATCC MYA-2876)]
Length=478

 Score =  255 bits (651),  Expect = 4e-81
 Identities = 160/465 (34%), Positives = 245/465 (53%), Gaps = 19/465 (4%)

Query  3    RLIILSNRVSLP---------QTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQH  53
            +++++SNR+ +               +GGL  A+Q         W GW G +I +  +  
Sbjct  5    KVLVVSNRIPVTIKRLDNGSYDYSMSSGGLVTALQGLKKTTEFQWYGWPGLEIPEDEQTK  64

Query  54   FDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRL  113
             +   KSK       L+      +Y GFSN+ LWP  H     + ++   +  Y + N+ 
Sbjct  65   VNDELKSKFNCTAIFLSDTIADLHYNGFSNSILWPLFHYHPGEMNFDENAWAAYIEANKK  124

Query  114  FATKIAEFAQPDDLIWVQDYHFLSVARHCR-ELGMQNK---IGFFLHIPFASLEIWRKIP  169
            FA +I +    DD+IWV DYH + +    R E+G + K   IGFFLH PF S EI+R +P
Sbjct  125  FALEIVKQVNDDDMIWVHDYHLMLLPEMLRQEIGNKKKNIKIGFFLHTPFPSSEIYRILP  184

Query  170  CAEQLMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGV  229
              +++++ +   +LIG  T     + IS  S ++       N I    R   I  +PIG+
Sbjct  185  VRKEILEGVLSCDLIGFHTYDYARHFISSVSRIVPNVSTLPNGIKYQGRSISIGAFPIGI  244

Query  230  DVK----GIQKTLSNLSDQDQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTA  285
            DV     G++K  S +    Q  +    +K I+GVDR+DY KG+ ++ +AF  FL+ N  
Sbjct  245  DVDNFIDGLKKD-SVVERIKQLKSKFKDVKVIVGVDRLDYIKGVPQKLHAFEVFLNENPE  303

Query  286  FHQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELM  345
            +  KV  VQ+A P R +V  Y+ L       V  IN EF    ++PI   + S P  EL+
Sbjct  304  WIGKVVLVQVAVPSRGDVEEYQSLRSTVSELVGRINGEFGTVEFVPIHYLHKSIPFDELI  363

Query  346  QFYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNR  405
              Y  +D+C V+S +DGMNLV+ EYIA Q  D  GVLILSEFAGAA+ +  ALIVNP N 
Sbjct  364  SLYNISDVCLVSSTRDGMNLVSYEYIACQQ-DRKGVLILSEFAGAAQSLNGALIVNPWNT  422

Query  406  DAMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            + + +A+K +L +  E+R++ + KL   + +Y    W + F+K+L
Sbjct  423  EDLSEAIKESLTLPEEKREFNFKKLFTYISKYTSGFWGESFVKEL  467


> P40387 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
[Schizosaccharomyces pombe (strain 972 / ATCC 24843)]
Length=513

 Score =  247 bits (631),  Expect = 7e-78
 Identities = 150/477 (31%), Positives = 248/477 (52%), Gaps = 21/477 (4%)

Query  3    RLIILSNRVSLP---------QTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQH  53
            RLI++SNR+ +               +GGL  A+      +   W+GW G++I +  +  
Sbjct  20   RLIVVSNRLPITIKRKDNGTYDFSMSSGGLVSALSGLKKLMTFQWLGWCGQEIPEDEKPM  79

Query  54   FDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRL  113
                 + + + +   L  +    +Y GFSN+ LWP  H     I ++ + ++ Y+  N  
Sbjct  80   IIQRLQDECSAIPVFLDDETADRHYNGFSNSILWPLFHYHPGEINFDEENWEAYRAANYA  139

Query  114  FATKIAEFAQPDDLIWVQDYHFLSVARHCRELGMQN----KIGFFLHIPFASLEIWRKIP  169
            FA  I +  Q  DLIWVQDYH + + +  REL        KIGFFLH PF S EI+R +P
Sbjct  140  FAEAIVKNLQDGDLIWVQDYHLMVLPQMLRELIGDKFKDIKIGFFLHTPFPSSEIYRVLP  199

Query  170  CAEQLMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGV  229
               ++++ + + +L+G  T     + +S CS +L    + N  +  N ++  +  +PIG+
Sbjct  200  VRNEILEGVLNCDLVGFHTYDYARHFLSACSRILNLSTLPNG-VEYNGQMVSVGTFPIGI  258

Query  230  DVKGIQKTLSNLSDQDQYLT---NPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAF  286
            D +     L +   +D+  +       +K I+GVDR+DY KG+ ++F+AF  FL++   +
Sbjct  259  DPEKFSDALKSDVVKDRIASIERRLQGVKVIVGVDRLDYIKGVPQKFHAFEVFLEQYPEW  318

Query  287  HQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQ  346
              KV  VQ+A P R +V  Y+ L       V  IN  F    + PI   + S    EL+ 
Sbjct  319  VGKVVLVQVAVPSRQDVEEYQNLRAVVNELVGRINGRFGTVEYTPIHFLHKSVRFEELVA  378

Query  347  FYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRD  406
             Y  +D+C +TS +DGMNLV+ EYI  Q  +  G LILSEFAGAA+ +  ++++NP N +
Sbjct  379  LYNVSDVCLITSTRDGMNLVSYEYICTQQ-ERHGALILSEFAGAAQSLNGSIVINPWNTE  437

Query  407  AMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQYIQNFDYNH  463
             +  ++  AL M  ++R+   +KL + + +Y    W   F+ +L   Q IQ++ + H
Sbjct  438  ELANSIHDALTMPEKQREANENKLFRYVNKYTSQFWGQSFVGEL---QRIQHYSHPH  491


> Q54K57 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
A [Dictyostelium discoideum]
Length=733

 Score =  247 bits (630),  Expect = 7e-76
 Identities = 140/463 (30%), Positives = 246/463 (53%), Gaps = 16/463 (3%)

Query  3    RLIILSNRVSLP---------QTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQH  53
            RLI++SNR+ +            +  +GGL  A+    S    +WVGW G +IE+   + 
Sbjct  17   RLIVVSNRLPVSIKKESNGKWSCKMSSGGLVAALSGLKSNF--IWVGWIGAEIEEDDRKE  74

Query  54   FDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRL  113
               L     + +   L+++   ++Y GFSN  LWP  H     ++Y+ + + +Y + N  
Sbjct  75   IKELLWKDYSCIPVFLSEKVANEHYNGFSNGVLWPLFHYLPGDLDYDDRIWNSYVEANEQ  134

Query  114  FATKIAEFAQPDDLIWVQDYHFLSVARHCRELGMQNKIGFFLHIPFASLEIWRKIPCAEQ  173
            F++ +AE  +P+DL+WV DYH + +    ++     +IGFFLHIPF S EI+R +PC ++
Sbjct  135  FSSVVAEILKPNDLVWVHDYHMMLLPEILKQKKPDARIGFFLHIPFPSSEIFRVLPCRKE  194

Query  174  LMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIGVDVKG  233
            ++  + +  LIG  T     + +  C+ ++  +   N  +    R  Q+  +P+G+D   
Sbjct  195  ILLGILNCCLIGFHTYDYARHFLKSCTRIVGLETAPNG-VYFKDRFVQVGVFPVGIDPDK  253

Query  234  IQKTLSNLSDQD---QYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTAFHQKV  290
              ++L     Q+   +   +    K +IG+DR+DY KG+ ++  A      +   +  K+
Sbjct  254  FFESLKTTQVQNRIKELKESFEGTKVLIGIDRLDYIKGIPQKLQAIERLFQKYPEWKGKL  313

Query  291  QHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELMQFYRN  350
              +Q+A P R +V  Y++L +  +  V  IN  +    + PI   + S    EL   Y  
Sbjct  314  VLIQVAVPSRQDVEEYQKLKKEVEELVGRINGLYGSIGYSPIHYLFQSVDPSELTALYNI  373

Query  351  ADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNRDAMIK  410
            +D   +TS++DGMNLVA+EYI  Q  +N GVLILSEF GAA+ +  A+++NP N + +  
Sbjct  374  SDAALITSIRDGMNLVAQEYIVCQT-ENNGVLILSEFTGAAQSLSGAVMINPWNTEEVAD  432

Query  411  ALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSS  453
            ++  +L M  EER+ ++  L+K + ++  + W   F+K+LN +
Sbjct  433  SIHNSLLMPPEEREEKHQMLLKYVTKHTASHWGLGFVKELNKA  475


> G4RK44 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
/ Trehalose-6-phosphate phosphatase [Thermoproteus tenax (strain 
ATCC 35583 / DSM 2078 / JCM 9277 / NBRC 100435 / Kra 1)]
Length=731

 Score =  240 bits (612),  Expect = 3e-73
 Identities = 150/474 (32%), Positives = 248/474 (52%), Gaps = 30/474 (6%)

Query  3    RLIILSNRVSL---PQTEC--VAGGLAVAMQDALSQLGG---------VWVGWNGKKIEQ  48
            RLI++SNR+ +   P  E     GGLA AM+  L  + G         VWVGW+G   E+
Sbjct  2    RLIVVSNRLPVTISPSGEIRESVGGLATAMKSFLGAVNGGRELGLEEVVWVGWSGVPSER  61

Query  49   PFEQHFDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQ  108
                  + L    +  +   L+ ++ + +Y GFSN+TLWP  H   +   Y  K ++ Y+
Sbjct  62   ESNDLRERLRGMGLEPVP--LSSEEVEGFYEGFSNSTLWPLFHGFSEYATYEEKHWRAYR  119

Query  109  DVNRLFATKIAEFAQPDDLIWVQDYHFL---SVARHCRELGMQNKIGFFLHIPFASLEIW  165
             VN  +A  +   A+P DL+W+ DYH +   ++ R   E+G    +GFFLHIPF   E+ 
Sbjct  120  GVNEKYAKAVVALARPGDLVWIHDYHLMLAPAIVREAAEVG----VGFFLHIPFPPAELL  175

Query  166  RKIPCA--EQLMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQ  223
            + +P     ++++ L   +L+G  T +   N  S   V     K++   I++  R  ++ 
Sbjct  176  QLLPSEWRREILEGLLGSDLVGFHTYEYSAN-FSRSVVRFLGYKVEMGAIAVGHRRVRVG  234

Query  224  DYPIGVDVKGIQKTLSNLSDQDQYLTNPSAI---KTIIGVDRIDYSKGLFERFNAFAEFL  280
             +PIG+D      +  + S  ++       +   K +  +DR+DY+KG+  R  A+  FL
Sbjct  235  VFPIGIDFDRFYNSSQDPSVVEEMAKLREMLGRAKVVFSIDRLDYTKGVLRRVAAWERFL  294

Query  281  DRNTAFHQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKP  340
              +  +  +   V +  P R  V  Y+ +  +   +V  IN E  + NW+PIV  Y   P
Sbjct  295  REHPEWRGRAVFVLVVVPSRTGVPMYEEMKRQIDREVGRINGELGELNWVPIVYLYRFIP  354

Query  341  HHELMQFYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIV  400
               LM  Y  AD+  +T L+DGMNLVAKE++A++  D  GVLILSE AGA++++ +AL++
Sbjct  355  SPTLMALYNIADVALITPLRDGMNLVAKEFVASKR-DCRGVLILSELAGASKELAEALVI  413

Query  401  NPKNRDAMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSSQ  454
            NP +     +A+  AL+MS +E+  R   + ++L   D+ +W  DF+  L S++
Sbjct  414  NPNDVGGTAEAIAEALSMSEDEQCRRIRAMQERLRMRDVVRWGTDFIYSLISAK  467


> O94213 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
[Pichia angusta]
Length=475

 Score =  233 bits (595),  Expect = 5e-73
 Identities = 157/475 (33%), Positives = 252/475 (53%), Gaps = 36/475 (8%)

Query  4    LIILSNR--VSLPQTE------------CVAGGLAVAMQDALSQLGGVWVGWNGKKIE-Q  48
            +I++SNR  V++ +TE              +GGL  A+Q   +     W GW G  ++ +
Sbjct  6    VIVVSNRIPVTIKKTEDDENGKSRYDYTMSSGGLVTALQGLKNPFR--WFGWPGMSVDSE  63

Query  49   PFEQHFDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQ  108
               Q  +   K K       L+ +    +Y GFSN+ LWP  H     + ++   +  Y 
Sbjct  64   QGRQTVERDLKEKFNCYPIWLSDEIADLHYNGFSNSILWPLFHYHPGEMNFDEIAWAAYL  123

Query  109  DVNRLFATKIAEFAQPDDLIWVQDYHFLSVARHCREL----GMQN-KIGFFLHIPFASLE  163
            + N+LF   I +  +  D+IWV DYH + +    R+     G+ N KIGFFLH PF S E
Sbjct  124  EANKLFCQTILKEIKDGDVIWVHDYHLMLLPSLLRDQLNSKGLPNVKIGFFLHTPFPSSE  183

Query  164  IWRKIPCAEQLMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQ  223
            I+R +P  +++++ +   +LIG  T     + +S    +LK +     ++  +++VT + 
Sbjct  184  IYRILPVRKEILEGVLSCDLIGFHTYDYVRHFLSSVERILKLRTSPQGVVYNDRQVT-VS  242

Query  224  DYPIGVDVKGIQKTLSNLSDQDQYLTNPSAIKT--------IIGVDRIDYSKGLFERFNA  275
             YPIG+DV    K L+ L   D+  +    ++T        IIGVDR+DY KG+ ++ +A
Sbjct  243  AYPIGIDV---DKFLNGLKT-DEVKSRIKQLETRFGKDCKLIIGVDRLDYIKGVPQKLHA  298

Query  276  FAEFLDRNTAFHQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCH  335
            F  FL+R+  +  KV  +Q+A P R +V  Y+ L       V  IN  F    ++PI   
Sbjct  299  FEIFLERHPEWIGKVVLIQVAVPSRGDVEEYQSLRAAVNELVGRINGRFGTVEFVPIHFL  358

Query  336  YDSKPHHELMQFYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQ  395
            + S    EL+  Y  +D+C V+S +DGMNLV+ EYIA Q  D  G L+LSEFAGAA+ + 
Sbjct  359  HKSVNFQELISVYAASDVCVVSSTRDGMNLVSYEYIACQQ-DRKGSLVLSEFAGAAQSLN  417

Query  396  DALIVNPKNRDAMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
             AL+VNP N + + +A+   L MS E+R+  + K+ K + +Y  + W ++F+K+L
Sbjct  418  GALVVNPWNTEELSEAIYEGLIMSEEKRRGNFQKMFKYIEKYTASYWGENFVKEL  472


> Q00075 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
1 [Aspergillus niger]
Length=517

 Score =  232 bits (592),  Expect = 4e-72
 Identities = 151/465 (32%), Positives = 233/465 (50%), Gaps = 18/465 (4%)

Query  2    SRLIILSNRVSLP---------QTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQ  52
            +RL+++SNR+ +               +GGL   +          W GW G ++ +    
Sbjct  13   ARLLLVSNRLPITIKRSDDGRYDFSMSSGGLVSGLSGLSKSTTFQWYGWPGLEVPEEEIP  72

Query  53   HFDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNR  112
                  K +   +   +  +    +Y GFSN+ LWP  H     I ++   ++ Y++ NR
Sbjct  73   VVKERLKQEYNAVPVFIDDELADRHYNGFSNSILWPLFHYHPGEITFDESAWEAYKEANR  132

Query  113  LFATKIAEFAQPDDLIWVQDYHFLSVARHCRE-LGMQN---KIGFFLHIPFASLEIWRKI  168
            LFA  +A+  Q  DLIWV DYH + +    RE +G      KIGFFLH PF S EI+R +
Sbjct  133  LFAKAVAKEVQDGDLIWVHDYHLMLLPEMLREEIGDSKENVKIGFFLHTPFPSSEIYRIL  192

Query  169  PCAEQLMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIG  228
            P   +L+  + H +LIG  T     + +S CS LL      N  I    ++     +PIG
Sbjct  193  PVRNELLLGVLHCDLIGFHTYDYTRHFLSACSRLLGLTTTPNG-IEFQGKIIACGAFPIG  251

Query  229  VDVKGIQKTLSNLSDQDQYLTNPS---AIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTA  285
            +D +  ++ L     Q +          +K ++GVDR+DY KG+ ++ +A   FL  +  
Sbjct  252  IDPEKFEEGLKKEKVQKRIAMLEQKFQGVKLMVGVDRLDYIKGVPQKLHALEVFLSDHPE  311

Query  286  FHQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELM  345
            +  KV  VQ+A P R +V  Y+ L       V  IN +F    ++PI   + S    EL+
Sbjct  312  WVGKVVLVQVAVPSRQDVEEYQNLRAVVNELVGRINGKFGTVEFMPIHFLHKSVNFDELI  371

Query  346  QFYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNR  405
              Y  +D C V+S +DGMNLVA EYIA Q   + GVL+LSEFAGAA+ +  ++I+NP N 
Sbjct  372  ALYAVSDACIVSSTRDGMNLVAYEYIATQKKRH-GVLVLSEFAGAAQSLNGSIIINPWNT  430

Query  406  DAMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDL  450
            + +  A + A+ MS E+R   + KL K + +Y    W   F+ +L
Sbjct  431  EELAGAYQEAVTMSDEQRALNFSKLDKYVNKYTSAFWGQSFVTEL  475


> Q00764 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
56 kDa subunit [Saccharomyces cerevisiae (strain ATCC 204508 
/ S288c)]
Length=495

 Score =  231 bits (590),  Expect = 4e-72
 Identities = 149/468 (32%), Positives = 234/468 (50%), Gaps = 20/468 (4%)

Query  4    LIILSNRVSLPQTE----------CVAGGLAVAMQDALSQLGGVWVGWNGKKIEQPFEQH  53
            +I++SNR+ +  T+            +GGL  A++         W GW G +I    +  
Sbjct  18   IIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTALEGLKKTYTFKWFGWPGLEIPDDEKDQ  77

Query  54   FDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQDVNRL  113
                   K   +   L+ +    +Y GFSN+ LWP  H     I ++   +  Y + N+ 
Sbjct  78   VRKDLLEKFNAVPIFLSDEIADLHYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQT  137

Query  114  FATKIAEFAQPDDLIWVQDYHFLSVARHCR----ELGMQN-KIGFFLHIPFASLEIWRKI  168
            F  +IA+    +DLIWV DYH + V    R    E  +QN K+G+FLH PF S EI+R +
Sbjct  138  FTNEIAKTMNHNDLIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRIL  197

Query  169  PCAEQLMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQDYPIG  228
            P  ++++  +   +L+G  T     + +S    +L    + N  +    R   +  +PIG
Sbjct  198  PVRQEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNG-VEYQGRFVNVGAFPIG  256

Query  229  VDVKGIQKTLSNLSDQ---DQYLTNPSAIKTIIGVDRIDYSKGLFERFNAFAEFLDRNTA  285
            +DV      L   S Q    Q        K I+GVDR+DY KG+ ++ +A   FL+ +  
Sbjct  257  IDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGVPQKLHAMEVFLNEHPE  316

Query  286  FHQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPHHELM  345
            +  KV  VQ+A P R +V  Y+ L       V  IN +F    ++PI   + S P  EL+
Sbjct  317  WRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGRINGQFGTVEFVPIHFMHKSIPFEELI  376

Query  346  QFYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVNPKNR  405
              Y  +D+C V+S +DGMNLV+ EYIA Q  +  G LILSEF GAA+ +  A+IVNP N 
Sbjct  377  SLYAVSDVCLVSSTRDGMNLVSYEYIACQE-EKKGSLILSEFTGAAQSLNGAIIVNPWNT  435

Query  406  DAMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLNSS  453
            D +  A+  AL +   +++  + KL K + +Y    W ++F+ +L S+
Sbjct  436  DDLSDAINEALTLPDVKKEVNWEKLYKYISKYTSAFWGENFVHELYST  483


> Q00217 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 
2 [Aspergillus niger]
Length=480

 Score =  230 bits (586),  Expect = 1e-71
 Identities = 150/470 (32%), Positives = 238/470 (51%), Gaps = 27/470 (6%)

Query  3    RLIILSNRVSLP---------QTECVAGGLAVAMQDALSQLGGVWVGWNGKKIEQP----  49
            RL+I+SNR+ +          +    +GGL   +          W GW G ++ +     
Sbjct  13   RLLIVSNRLPITIRRSGGGKYEFSMSSGGLVTGLSGLSKTTTFQWYGWPGLEVPEDEIDS  72

Query  50   FEQHFDILYKSKITYMTCALTQQQYQDYYCGFSNNTLWPAMHDREDLIEYNPKEFKTYQD  109
             +Q     + +   +M   L  + Y     GFSN+ LWP +H     I ++   +  Y++
Sbjct  73   VKQRLQEEFNATPVFMDDKLADRHYN----GFSNSILWPLLHYHPGEIVFDEAAWDAYRE  128

Query  110  VNRLFATKIAEFAQPDDLIWVQDYHFLSVARHCRE----LGMQN-KIGFFLHIPFASLEI  164
             NRLFA  IA  A+  DL+WV DYH + +    RE    LG  N +IGFFLH PF S EI
Sbjct  129  ANRLFAKTIAHEAREGDLVWVHDYHLMLLPEVLREELAALGKNNIRIGFFLHTPFPSSEI  188

Query  165  WRKIPCAEQLMDDLCHYNLIGLQTAQDQENCISVCSVLLKAQKIQNNMISLNQRVTQIQD  224
            +R +P   QL+  +   +LIG  T     + +S CS +L      ++ +    R   +  
Sbjct  189  YRILPVRSQLLRGVLQCDLIGFHTYDYARHFLSCCSHILGLVTTPSS-VKFKDRSVAVGA  247

Query  225  YPIGVDVKGIQKTLSNLSDQDQYLTNPSAI---KTIIGVDRIDYSKGLFERFNAFAEFLD  281
            +PIG+D     + L +   Q++  +  +     K ++ VDR+DY KG+ ++ +A   FL 
Sbjct  248  FPIGIDPDKFTEGLKSPKVQNRIASLENKFQGTKLMVSVDRLDYIKGIPQKLHALEVFLS  307

Query  282  RNTAFHQKVQHVQIASPCRLEVATYKRLFERFKLKVELINSEFSQDNWLPIVCHYDSKPH  341
            ++  +  KV  VQ+A P R +V  Y+ L       V  IN +F   +++PI   + S   
Sbjct  308  QHPEWVGKVVLVQVAVPSRQDVEEYQNLRAVVNELVGRINGKFGTVDYMPIHFMHKSVSF  367

Query  342  HELMQFYRNADICWVTSLKDGMNLVAKEYIAAQNPDNPGVLILSEFAGAAEQMQDALIVN  401
             EL+  Y  +D C V+S +DGMNLV+ EY+A Q     GVLILSEFAGAA+ +  +++VN
Sbjct  368  DELIALYAASDACVVSSTRDGMNLVSFEYVATQQ-KRKGVLILSEFAGAAQSLNGSIVVN  426

Query  402  PKNRDAMIKALKLALNMSLEERQYRYHKLIKQLIEYDINQWRDDFLKDLN  451
            P N + +  A   A++MS + R  ++ KL K + +Y    W   F+ +L+
Sbjct  427  PWNTEELASAYHEAVSMSDDLRAQKFEKLYKYISKYTSAFWGKSFVAELS  476



Lambda      K        H        a         alpha
   0.324    0.137    0.420    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5535796


  Database: 0b381cfe542163886449ac065721e4c9.SwissProt.fasta
    Posted date:  Sep 28, 2020  1:32 PM
  Number of letters in database: 14,828
  Number of sequences in database:  30



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40