ACIAD1749 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 21d3663385f51f115ae3c44f344e5214.TrEMBL.fasta
           25 sequences; 8,495 total letters



Query= ACIAD1749

Length=337
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FBH3 Ubiquinol oxidase subunit II, cyanide insensitive [Acine...   674    0.0   
  N9FFB6 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacte...   626    0.0   
  N9E118 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacte...   625    0.0   
  A0A1Q3N811 Cytochrome d ubiquinol oxidase subunit II [Acinetoba...   619    0.0   
  N9LTL3 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacte...   615    0.0   
  A0A062DL74 Cytochrome d ubiquinol oxidase, subunit II [Acinetob...   612    0.0   
  A0A062F9P5 Cytochrome d ubiquinol oxidase, subunit II [Acinetob...   612    0.0   
  A0A009SG95 Cytochrome d ubiquinol oxidase, subunit II [Acinetob...   612    0.0   
  A0A1P8EGT9 Cytochrome d ubiquinol oxidase subunit II [Acinetoba...   611    0.0   
  A0A0M1I0D1 Ubiquinol oxidase subunit II [Acinetobacter sp. C15]      611    0.0   
  N9BV36 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacte...   611    0.0   
  A0A009QRA9 Cytochrome d ubiquinol oxidase, subunit II [Acinetob...   610    0.0   
  A0A143J0G4 Cytochrome bd-I ubiquinol oxidase subunit 2 [Acineto...   610    0.0   
  D8JI34 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacte...   610    0.0   
  A0A1Y3FE33 Ubiquinol oxidase subunit II, cyanide insensitive [A...   610    0.0   
  O07441 Cyanide insensitive terminal oxidase [Pseudomonas aerugi...   408    1e-144
  A6GV66 Cytochrome bd-II ubiquinol oxidase subunit II [Pseudomon...   394    2e-139
  O86081 Quinol oxidase subunit II QxtB [Rhodobacter sphaeroides]      353    2e-123
  Q799R0 Cytochrome oxidase d, subunit II [Rickettsia prowazekii]      276    6e-94 
  Q7X3N0 Cytochrome C oxidase assembly protein [Leifsonia xyli su...   166    1e-50 
  Q2ACC6 Cytochrome d ubiquinol oxidase subunit II [Shewanella vi...   166    2e-50 
  Q2QFA7 Cytochrome bd quinol oxidase subunit II [Desulfovibrio g...   164    4e-50 
  O05192 Subunit II of cytochrome bd [Klebsiella pneumoniae]           160    3e-48 
  O67974 Cytochrome d oxidase subunit II [Salmonella typhimurium]      148    7e-44 
  Q05780 Cytochrome d oxidase complex subunit II [Azotobacter vin...   143    7e-42 


> Q6FBH3 Ubiquinol oxidase subunit II, cyanide insensitive [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=336

 Score =  674 bits (1738),  Expect = 0.0
 Identities = 335/336 (99%), Positives = 336/336 (100%), Gaps = 0/336 (0%)

Query  1    LIMIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNET  60
            +IMIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNET
Sbjct  1    MIMIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNET  60

Query  61   WMVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFI  120
            WMVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFI
Sbjct  61   WMVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFI  120

Query  121  GGSIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLI  180
            GGSIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLI
Sbjct  121  GGSIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLI  180

Query  181  MKTDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILV  240
            MKTDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILV
Sbjct  181  MKTDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILV  240

Query  241  VIFTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQL  300
            VIFTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQL
Sbjct  241  VIFTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQL  300

Query  301  FALIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            FALIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH
Sbjct  301  FALIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336


> N9FFB6 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacter 
beijerinckii CIP 110307]
Length=334

 Score =  626 bits (1615),  Expect = 0.0
 Identities = 303/334 (91%), Positives = 322/334 (96%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIWIVIIA+GVFIY+VLDGFDLGIGILFPFIKDQ ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWIVIIAIGVFIYVVLDGFDLGIGILFPFIKDQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFPMVY+AVLSA Y+PIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG
Sbjct  61   VLGGAGLFAAFPMVYAAVLSAFYMPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK
Sbjct  121  SVLSSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TD RLQL+MY+LMPKL+  LL+IF  VSIYTPL+ P IA RWFTQPQ+ YFSPVPILV++
Sbjct  181  TDDRLQLSMYNLMPKLIIGLLLIFASVSIYTPLAHPMIAERWFTQPQILYFSPVPILVLV  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
            FT+LT++AC KRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA
Sbjct  241  FTYLTIKACQKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII+YTIMAYWVFRDKVR+GDEGYH
Sbjct  301  LIGALILIPIIIIYTIMAYWVFRDKVRIGDEGYH  334


> N9E118 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacter 
beijerinckii ANC 3835]
Length=334

 Score =  625 bits (1612),  Expect = 0.0
 Identities = 303/334 (91%), Positives = 322/334 (96%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIWIVIIA+GVFIYIVLDGFDLGIGILFPFIKDQ ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWIVIIAIGVFIYIVLDGFDLGIGILFPFIKDQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFPMVY+AVLSA Y+PIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG
Sbjct  61   VLGGAGLFAAFPMVYAAVLSAFYMPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK
Sbjct  121  SVLSSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TD RLQL+MY+LMPKL+  LL+IF  VSIYTPL+ P IA RWFTQPQ+ YFSPVPILV++
Sbjct  181  TDDRLQLSMYNLMPKLIIGLLLIFASVSIYTPLAHPMIAERWFTQPQILYFSPVPILVLV  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
            FT+LT++AC KR+ESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA
Sbjct  241  FTYLTIKACQKRKESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII+YTIMAYWVFRDKVR+GDEGYH
Sbjct  301  LIGALILIPIIIIYTIMAYWVFRDKVRIGDEGYH  334


> A0A1Q3N811 Cytochrome d ubiquinol oxidase subunit II [Acinetobacter 
sp. 39-4]
Length=334

 Score =  619 bits (1595),  Expect = 0.0
 Identities = 301/334 (90%), Positives = 319/334 (96%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIWIVIIA+GVFIY+VLDGFDLGIGILFPFIK Q ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWIVIIAIGVFIYVVLDGFDLGIGILFPFIKSQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG
Sbjct  61   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPF+LFTG+GVVVVYA LGCGWLIMK
Sbjct  121  SVLSSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFALFTGLGVVVVYATLGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TD +LQ +MY LMPKL+  LL+IF  VSIYTPL+ P IA RWFT+PQ+ YFSPVPILVV+
Sbjct  181  TDDQLQNSMYRLMPKLVLVLLLIFAAVSIYTPLAHPVIAERWFTKPQILYFSPVPILVVL  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
            FTFLT+RAC KRQ+SMPFLYTLALVFLAYTGFLISIFPY+IPPSVTIWDAAAPANSQLFA
Sbjct  241  FTFLTIRACQKRQDSMPFLYTLALVFLAYTGFLISIFPYVIPPSVTIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII+YTIMAYWVFRDKVRVGDEGYH
Sbjct  301  LIGALILIPIIIIYTIMAYWVFRDKVRVGDEGYH  334


> N9LTL3 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacter 
sp. ANC 3862]
Length=334

 Score =  615 bits (1587),  Expect = 0.0
 Identities = 300/334 (90%), Positives = 318/334 (95%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIWIVIIA+GVFIY+VLDGFDLGIGILFPFIK Q ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWIVIIAIGVFIYVVLDGFDLGIGILFPFIKSQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFPMVYSAVLSA YLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG
Sbjct  61   VLGGAGLFAAFPMVYSAVLSAFYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPF+LFTG+GVVVVYAALGCGWLIMK
Sbjct  121  SVLSSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFALFTGLGVVVVYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TD +LQ +MY LMPKL+ ALL+IF  VSIYTPL+ P IA RWFT+PQ+ YFSPVPILVV+
Sbjct  181  TDDQLQNSMYRLMPKLILALLLIFAAVSIYTPLAHPIIAERWFTKPQILYFSPVPILVVL  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
            FTFL +RAC KRQ+S PFLYTLALVFLAYTGFLISIFPY+IPPSVTIWDAAAPANSQLFA
Sbjct  241  FTFLAIRACQKRQDSTPFLYTLALVFLAYTGFLISIFPYVIPPSVTIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII+YTIMAYWVFRDKVRVGDEGYH
Sbjct  301  LIGALILIPIIIIYTIMAYWVFRDKVRVGDEGYH  334


> A0A062DL74 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacter 
baumannii 496487]
Length=334

 Score =  612 bits (1577),  Expect = 0.0
 Identities = 298/334 (89%), Positives = 317/334 (95%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIWIVIIA+GVFIY+VLDGFDLGIGILFPFIK+Q ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWIVIIAIGVFIYVVLDGFDLGIGILFPFIKNQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFP+VYSAVLSALYLPIILMVIALIFRGVAFEFRFKANR+K LWDAAFIGG
Sbjct  61   VLGGAGLFAAFPIVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRSKPLWDAAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK
Sbjct  121  SVLSSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TD  LQ  MY LMP+L+  LL+IF+ VSIYTP++ P IA RWF QPQL YFSPVPILVV+
Sbjct  181  TDDVLQSTMYRLMPRLIIVLLLIFIAVSIYTPMAHPIIAERWFNQPQLLYFSPVPILVVV  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
            FTFLT+RAC K QESMPFLYTLALVFLAYTGFLISIFPY+IPPS+TIWDAAAPANSQLFA
Sbjct  241  FTFLTIRACQKHQESMPFLYTLALVFLAYTGFLISIFPYVIPPSITIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII+YTIMAYWVFRDKVR+GDEGYH
Sbjct  301  LIGALILIPIIIIYTIMAYWVFRDKVRLGDEGYH  334


> A0A062F9P5 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacter 
baumannii 754286]
Length=334

 Score =  612 bits (1577),  Expect = 0.0
 Identities = 298/334 (89%), Positives = 317/334 (95%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIWIVIIA+GVFIY+VLDGFDLGIGILFPFIK+Q ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWIVIIAIGVFIYVVLDGFDLGIGILFPFIKNQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFP+VYSAVLSALYLPIILMVIALIFRGVAFEFRFKANR+K LWDAAFIGG
Sbjct  61   VLGGAGLFAAFPIVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRSKPLWDAAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK
Sbjct  121  SVLSSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TD  LQ  MY LMP+L+  LL+IF+ VSIYTP++ P IA RWF QPQL YFSPVPILVV+
Sbjct  181  TDDVLQSTMYRLMPRLIIVLLLIFIAVSIYTPMAHPIIAERWFNQPQLLYFSPVPILVVV  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
            FTFLT+RAC K QESMPFLYTLALVFLAYTGFLISIFPY+IPPS+TIWDAAAPANSQLFA
Sbjct  241  FTFLTIRACQKHQESMPFLYTLALVFLAYTGFLISIFPYVIPPSITIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII+YTIMAYWVFRDKVR+GDEGYH
Sbjct  301  LIGALILIPIIIIYTIMAYWVFRDKVRLGDEGYH  334


> A0A009SG95 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacter 
baumannii 951631]
Length=334

 Score =  612 bits (1577),  Expect = 0.0
 Identities = 298/334 (89%), Positives = 317/334 (95%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIWIVIIA+GVFIY+VLDGFDLGIGILFPFIK+Q ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWIVIIAIGVFIYVVLDGFDLGIGILFPFIKNQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFP+VYSAVLSALYLPIILMVIALIFRGVAFEFRFKANR+K LWDAAFIGG
Sbjct  61   VLGGAGLFAAFPIVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRSKPLWDAAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK
Sbjct  121  SVLSSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TD  LQ  MY LMP+L+  LL+IF+ VSIYTP++ P IA RWF QPQL YFSPVPILVV+
Sbjct  181  TDDVLQSTMYRLMPRLIIVLLLIFIAVSIYTPMAHPIIAERWFNQPQLLYFSPVPILVVV  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
            FTFLT+RAC K QESMPFLYTLALVFLAYTGFLISIFPY+IPPS+TIWDAAAPANSQLFA
Sbjct  241  FTFLTIRACQKHQESMPFLYTLALVFLAYTGFLISIFPYVIPPSITIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII+YTIMAYWVFRDKVR+GDEGYH
Sbjct  301  LIGALILIPIIIIYTIMAYWVFRDKVRLGDEGYH  334


> A0A1P8EGT9 Cytochrome d ubiquinol oxidase subunit II [Acinetobacter 
soli]
Length=334

 Score =  611 bits (1576),  Expect = 0.0
 Identities = 297/334 (89%), Positives = 318/334 (95%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIW+VIIAVGVFIY+VLDGFDLGIGILFPFI+DQ ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWVVIIAVGVFIYVVLDGFDLGIGILFPFIQDQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFP+VYSAVLSALYLPI+LMVIALIFRGVAFEFRFKANRTKHLWD AFIGG
Sbjct  61   VLGGAGLFAAFPIVYSAVLSALYLPILLMVIALIFRGVAFEFRFKANRTKHLWDKAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGV+LGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVV+YAALGCGWLIMK
Sbjct  121  SVLSSFLQGVLLGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVLYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TDHRLQ +M+ +MPKL+  LL IF CVS+YTPLSQPQIAARWF+ PQL YFSPVPILVVI
Sbjct  181  TDHRLQEDMFKIMPKLILGLLFIFACVSLYTPLSQPQIAARWFSLPQLLYFSPVPILVVI  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
             + L +RAC+K+QES PFLY LAL+FLAY+GFLISIFPYIIPPSVTIWDAAAPANSQLFA
Sbjct  241  CSVLALRACAKKQESAPFLYILALLFLAYSGFLISIFPYIIPPSVTIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII YTIMAYWVFRDKVRVGDEGYH
Sbjct  301  LIGALILIPIIITYTIMAYWVFRDKVRVGDEGYH  334


> A0A0M1I0D1 Ubiquinol oxidase subunit II [Acinetobacter sp. C15]
Length=334

 Score =  611 bits (1576),  Expect = 0.0
 Identities = 297/334 (89%), Positives = 318/334 (95%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIW+VIIAVGVFIY+VLDGFDLGIGILFPFI+DQ ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWVVIIAVGVFIYVVLDGFDLGIGILFPFIQDQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFP+VYSAVLSALYLPI+LMVIALIFRGVAFEFRFKANRTKHLWD AFIGG
Sbjct  61   VLGGAGLFAAFPIVYSAVLSALYLPILLMVIALIFRGVAFEFRFKANRTKHLWDKAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGV+LGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVV+YAALGCGWLIMK
Sbjct  121  SVLSSFLQGVLLGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVLYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TDHRLQ +M+ +MPKL+  LL IF CVS+YTPLSQPQIAARWF+ PQL YFSPVPILVVI
Sbjct  181  TDHRLQEDMFKIMPKLILGLLFIFACVSLYTPLSQPQIAARWFSLPQLLYFSPVPILVVI  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
             + L +RAC+K+QES PFLY LAL+FLAY+GFLISIFPYIIPPSVTIWDAAAPANSQLFA
Sbjct  241  CSVLALRACAKKQESAPFLYILALLFLAYSGFLISIFPYIIPPSVTIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII YTIMAYWVFRDKVRVGDEGYH
Sbjct  301  LIGALILIPIIITYTIMAYWVFRDKVRVGDEGYH  334


> N9BV36 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacter 
soli NIPH 2899]
Length=334

 Score =  611 bits (1576),  Expect = 0.0
 Identities = 297/334 (89%), Positives = 318/334 (95%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIW+VIIAVGVFIY+VLDGFDLGIGILFPFI+DQ ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWVVIIAVGVFIYVVLDGFDLGIGILFPFIQDQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFP+VYSAVLSALYLPI+LMVIALIFRGVAFEFRFKANRTKHLWD AFIGG
Sbjct  61   VLGGAGLFAAFPIVYSAVLSALYLPILLMVIALIFRGVAFEFRFKANRTKHLWDKAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGV+LGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVV+YAALGCGWLIMK
Sbjct  121  SVLSSFLQGVLLGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVLYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TDHRLQ +M+ +MPKL+  LL IF CVS+YTPLSQPQIAARWF+ PQL YFSPVPILVVI
Sbjct  181  TDHRLQEDMFKIMPKLILGLLFIFACVSLYTPLSQPQIAARWFSLPQLLYFSPVPILVVI  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
             + L +RAC+K+QES PFLY LAL+FLAY+GFLISIFPYIIPPSVTIWDAAAPANSQLFA
Sbjct  241  CSVLALRACAKKQESAPFLYILALLFLAYSGFLISIFPYIIPPSVTIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII YTIMAYWVFRDKVRVGDEGYH
Sbjct  301  LIGALILIPIIITYTIMAYWVFRDKVRVGDEGYH  334


> A0A009QRA9 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacter 
sp. 809848]
Length=334

 Score =  610 bits (1573),  Expect = 0.0
 Identities = 299/334 (90%), Positives = 317/334 (95%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIWIVIIA+GVFIY+VLDGFDLGIGILFPFIK+Q ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWIVIIAIGVFIYVVLDGFDLGIGILFPFIKNQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANR+K LWDAAFIGG
Sbjct  61   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRSKPLWDAAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGVILGAYIQGI+IVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK
Sbjct  121  SVLSSFLQGVILGAYIQGINIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TD  LQ  MY LMP+L+ ALL+IF+ VSIYTP++ P IA RWF  PQL YFSPVPILVV+
Sbjct  181  TDDVLQSAMYRLMPRLIIALLLIFIAVSIYTPMAHPIIAERWFNPPQLLYFSPVPILVVV  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
            FTFLT+RAC K QESMPFLYTLALVFLAYTGFLISIFPY+IPPS+TIWDAAAPANSQLFA
Sbjct  241  FTFLTIRACQKHQESMPFLYTLALVFLAYTGFLISIFPYVIPPSITIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII+YTIMAYWVFRDKVRVGDEGYH
Sbjct  301  LIGALILIPIIIIYTIMAYWVFRDKVRVGDEGYH  334


> A0A143J0G4 Cytochrome bd-I ubiquinol oxidase subunit 2 [Acinetobacter 
pittii]
Length=334

 Score =  610 bits (1573),  Expect = 0.0
 Identities = 299/334 (90%), Positives = 317/334 (95%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIWIVIIA+GVFIY+VLDGFDLGIGILFPFIK+Q ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWIVIIAIGVFIYVVLDGFDLGIGILFPFIKNQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANR+K LWDAAFIGG
Sbjct  61   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRSKPLWDAAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGVILGAYIQGI+IVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK
Sbjct  121  SVLSSFLQGVILGAYIQGINIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TD  LQ  MY LMP+L+ ALL+IF+ VSIYTP++ P IA RWF  PQL YFSPVPILVV+
Sbjct  181  TDDVLQSAMYRLMPRLIIALLLIFIAVSIYTPMAHPIIAERWFNPPQLLYFSPVPILVVV  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
            FTFLT+RAC K QESMPFLYTLALVFLAYTGFLISIFPY+IPPS+TIWDAAAPANSQLFA
Sbjct  241  FTFLTIRACQKHQESMPFLYTLALVFLAYTGFLISIFPYVIPPSITIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII+YTIMAYWVFRDKVRVGDEGYH
Sbjct  301  LIGALILIPIIIIYTIMAYWVFRDKVRVGDEGYH  334


> D8JI34 Cytochrome d ubiquinol oxidase, subunit II [Acinetobacter 
oleivorans (strain JCM 16667 / KCTC 23045 / DR1)]
Length=334

 Score =  610 bits (1573),  Expect = 0.0
 Identities = 299/334 (90%), Positives = 317/334 (95%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIWIVIIA+GVFIY+VLDGFDLGIGILFPFIK+Q ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWIVIIAIGVFIYVVLDGFDLGIGILFPFIKNQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANR+K LWDAAFIGG
Sbjct  61   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRSKPLWDAAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGVILGAYIQGI+IVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK
Sbjct  121  SVLSSFLQGVILGAYIQGINIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            TD  LQ  MY LMP+L+ ALL+IF+ VSIYTP++ P IA RWF  PQL YFSPVPILVV+
Sbjct  181  TDDVLQSAMYRLMPRLIIALLLIFIAVSIYTPMAHPIIAERWFNPPQLLYFSPVPILVVV  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
            FTFLT+RAC K QESMPFLYTLALVFLAYTGFLISIFPY+IPPS+TIWDAAAPANSQLFA
Sbjct  241  FTFLTIRACQKHQESMPFLYTLALVFLAYTGFLISIFPYVIPPSITIWDAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII+YTIMAYWVFRDKVRVGDEGYH
Sbjct  301  LIGALILIPIIIIYTIMAYWVFRDKVRVGDEGYH  334


> A0A1Y3FE33 Ubiquinol oxidase subunit II, cyanide insensitive 
[Acinetobacter seifertii]
Length=334

 Score =  610 bits (1572),  Expect = 0.0
 Identities = 292/334 (87%), Positives = 319/334 (96%), Gaps = 0/334 (0%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWM  62
            MIDLSLIWIVIIA+GVFIY+VLDGFDLGIGILFPFIKDQ ERDVMMNTVAPVWDGNETWM
Sbjct  1    MIDLSLIWIVIIAIGVFIYVVLDGFDLGIGILFPFIKDQQERDVMMNTVAPVWDGNETWM  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGG  122
            VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTK+LWDAAFIGG
Sbjct  61   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKYLWDAAFIGG  120

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++SSFLQGVILGAYIQGIHI+DGRYAGGGLDWLTPFS+FTG GV++VYAALGCGWLIMK
Sbjct  121  SVLSSFLQGVILGAYIQGIHIIDGRYAGGGLDWLTPFSVFTGFGVIIVYAALGCGWLIMK  180

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            T+ +LQ +MY LMPKL+  LL++F+ VS+YTPL+ P IAARWF   QL YFSPVPILVV+
Sbjct  181  TEMQLQTSMYRLMPKLIMTLLLVFIAVSVYTPLAHPVIAARWFNAHQLLYFSPVPILVVV  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
            FT+LT++AC K+QESMPFLYTLALVFLAYTGFLISIFPY+IPPS+TIW+AAAPANSQLFA
Sbjct  241  FTYLTIKACQKQQESMPFLYTLALVFLAYTGFLISIFPYVIPPSITIWEAAAPANSQLFA  300

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            LIGALILIPIII+YTIMAYWVFRDKVRVGDEGYH
Sbjct  301  LIGALILIPIIIIYTIMAYWVFRDKVRVGDEGYH  334


> O07441 Cyanide insensitive terminal oxidase [Pseudomonas aeruginosa]
Length=335

 Score =  408 bits (1048),  Expect = 1e-144
 Identities = 195/334 (58%), Positives = 251/334 (75%), Gaps = 2/334 (1%)

Query  4    IDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWMV  63
            IDL LIW VII  G+ +Y+V+DGFDLGIG+L+PF KD  +RDVMMNTVAPVWDGNETW+V
Sbjct  3    IDLPLIWAVIIIFGIMMYVVMDGFDLGIGMLYPFFKDSGDRDVMMNTVAPVWDGNETWLV  62

Query  64   LGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTK-HLWDAAFIGG  122
            LGGA LF AFP+ Y+ VLSALYLP+I M++ LIFRGVAFEFRFKA   K H+WD AFIGG
Sbjct  63   LGGAALFGAFPLAYAVVLSALYLPLIFMLVGLIFRGVAFEFRFKAKPAKQHIWDKAFIGG  122

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S++++F QGV LGA+I+GI + +  +AGG LDW+ PF LF G+ ++V Y  LGC WLIMK
Sbjct  123  SLVATFFQGVALGAFIEGIPVENRSFAGGSLDWIAPFPLFCGLALIVAYTLLGCTWLIMK  182

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            T+ RLQ  M+ L   L   LL I   VS++TPL+  +IAARWF+ P L +F PVPILV++
Sbjct  183  TEGRLQERMHDLARPLALVLLAIIGVVSLWTPLAHAEIAARWFSLPNLFWFLPVPILVLV  242

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
              +  +R+ +      PF+ TL L+FL Y+G  IS++P IIPP+V+IW+A+AP  SQ F 
Sbjct  243  TFYALLRSVANNDHVKPFVLTLVLIFLGYSGLGISLWPNIIPPAVSIWEASAPPQSQGFM  302

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            L+GAL +IP I+ YT  +Y+VFR KV+ GD GYH
Sbjct  303  LVGALFIIPFILGYTAWSYYVFRGKVKHGD-GYH  335


> A6GV66 Cytochrome bd-II ubiquinol oxidase subunit II [Pseudomonas 
oleovorans]
Length=335

 Score =  394 bits (1013),  Expect = 2e-139
 Identities = 187/334 (56%), Positives = 249/334 (75%), Gaps = 2/334 (1%)

Query  4    IDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNETWMV  63
            IDL LIW++II  GV +Y++ DGFDLGIGILFPF+KD+  RD M+N+VAPVWDGNETW+V
Sbjct  3    IDLPLIWLLIIGFGVMMYVIADGFDLGIGILFPFVKDRSHRDAMVNSVAPVWDGNETWLV  62

Query  64   LGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRT-KHLWDAAFIGG  122
            LGGA L AAFP  Y+ +LSA Y+P ILM++ LI+RGV+FEFRFKA+   K  WD AF+ G
Sbjct  63   LGGAALMAAFPKAYAILLSAFYVPAILMLLGLIWRGVSFEFRFKADEAHKPFWDKAFMLG  122

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S +++F QG ILGA+I G+ IV GR A G +DWLTPFS+FTG+GVV+ YA LG  WL++K
Sbjct  123  SFVAAFFQGAILGAFIDGVEIVGGRSAAGIMDWLTPFSVFTGIGVVIAYALLGSTWLVLK  182

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            T+  LQ  M  +     +ALL+     SI+TPL+   I+ RWF+ P + +F+PVP+LV  
Sbjct  183  TEGDLQRQMIRIAKPTTFALLVAIAIASIWTPLAHQAISDRWFSLPNIWFFAPVPVLVAA  242

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQLFA  302
             T+   R  +    + PF+++L L+FL YTGF+ISI+P I+PPS+ IWDAAAP+ S  F 
Sbjct  243  ATYYIQRTLNDDPHAGPFVWSLVLIFLGYTGFVISIWPNIVPPSLPIWDAAAPSESLGFT  302

Query  303  LIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            L+GAL++IP+I+ Y+  AY+VFR KV+VG EGYH
Sbjct  303  LVGALLIIPMILGYSAWAYYVFRGKVKVG-EGYH  335


> O86081 Quinol oxidase subunit II QxtB [Rhodobacter sphaeroides]
Length=335

 Score =  353 bits (907),  Expect = 2e-123
 Identities = 167/336 (50%), Positives = 222/336 (66%), Gaps = 1/336 (0%)

Query  1    LIMIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFIKDQHERDVMMNTVAPVWDGNET  60
            ++ ++LS IW  IIA  V +Y++LDGFDLG+GI FPF KD+ ERDVMMN+VAP+WDGNET
Sbjct  1    MLGLELSFIWAGIIAFAVLVYVILDGFDLGVGIFFPFAKDERERDVMMNSVAPIWDGNET  60

Query  61   WMVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFI  120
            W+VLGG GLFA FP+ Y+ V+ ALY PI+ M++AL+FRGVAFE+R++  R K LWD +F 
Sbjct  61   WLVLGGGGLFAVFPLAYAVVMPALYAPIVAMLLALVFRGVAFEYRWRTVRWKRLWDWSFA  120

Query  121  GGSIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLI  180
             GS++++ +QG+ LGA +QGI + +  YAGG  DWLTPFSL TG  V   Y  LG  W  
Sbjct  121  MGSLVAALMQGIALGAIVQGIEVENRAYAGGWFDWLTPFSLLTGFAVATGYGLLGATWCN  180

Query  181  MKTDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILV  240
            MK + R+Q +M  L   L +A L     VS++TPL     A RWF  P + +   VP+LV
Sbjct  181  MKLEGRVQTHMRQLARPLSFATLAFLGLVSLFTPLQDAVYAERWFRWPTMVWTLAVPVLV  240

Query  241  VIFTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPSVTIWDAAAPANSQL  300
             +      R   +  +  PFL  L    L + G  IS +P ++PP +TI +AAAP  S L
Sbjct  241  ALLALRLWRGLERGDDVAPFLCALGFFVLGFVGIGISFYPMMVPPELTIVEAAAPDESLL  300

Query  301  FALIGALILIPIIIMYTIMAYWVFRDKVRVGDEGYH  336
            F L+G L+L+PII+ YT   YWVFR K+   DEGYH
Sbjct  301  FTLVGTLVLVPIILTYTAYTYWVFRGKID-ADEGYH  335


> Q799R0 Cytochrome oxidase d, subunit II [Rickettsia prowazekii]
Length=287

 Score =  276 bits (707),  Expect = 6e-94
 Identities = 134/281 (48%), Positives = 194/281 (69%), Gaps = 3/281 (1%)

Query  49   NTVAPVWDGNETWMVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKA  108
            N++AP WDGNETW+VLGG GLFAAFP+ YS ++SALY+PIILM++ LIFRGVAFEFRFKA
Sbjct  1    NSIAPFWDGNETWLVLGGGGLFAAFPLAYSILMSALYIPIILMLLGLIFRGVAFEFRFKA  60

Query  109  N-RTKHLWDAAFIGGSIISSFLQGVILGAYIQGIHIVDGR-YAGGGLDWLTPFSLFTGVG  166
            +   + +WD +F  GS+++ F QG++LG ++QGI ++DGR +AGG  D+LTPFS+ TG+ 
Sbjct  61   HIGHRCIWDYSFHFGSMLAVFCQGLMLGTFVQGI-VIDGRQFAGGSFDFLTPFSVMTGIA  119

Query  167  VVVVYAALGCGWLIMKTDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFT  226
            ++  YA LG  WLI+KT+++ Q   Y     +++ + +    VS+  P     I  RWF+
Sbjct  120  LIFGYALLGATWLILKTENKTQDWAYKSALYILFYVALFMGLVSLSAPFLNNYINHRWFS  179

Query  227  QPQLTYFSPVPILVVIFTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPS  286
             P + Y S +PI+ V+     ++A  +++E  PF+YT+ L  L Y G  ISI+PYI+P  
Sbjct  180  MPNIYYLSIIPIITVLIFIKLIKAIKQKKEVKPFIYTILLFLLGYLGLAISIWPYIVPYK  239

Query  287  VTIWDAAAPANSQLFALIGALILIPIIIMYTIMAYWVFRDK  327
            VT+ +AAA   SQ   L+GALI +P+I+ YT   Y++FR K
Sbjct  240  VTLENAAAVPESQSLLLVGALIFLPVILGYTFYCYYIFRGK  280


> Q7X3N0 Cytochrome C oxidase assembly protein [Leifsonia xyli 
subsp. xyli]
Length=339

 Score =  166 bits (419),  Expect = 1e-50
 Identities = 100/339 (29%), Positives = 177/339 (52%), Gaps = 29/339 (9%)

Query  4    IDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGNETWM  62
            +DL+++W +I+A     Y VLDGFD G+G+  PF+  D+ +R VM+NT+ PVWD NETW+
Sbjct  1    MDLAVLWFLIVAFFFVGYFVLDGFDFGVGMALPFLGSDEVDRRVMINTIGPVWDLNETWL  60

Query  63   VLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFK--ANRTKHLWDAAFI  120
            ++ GA LFAAFP  Y+++ S  YL ++L+++ALI RGV+FE+R +   +R K  +D   +
Sbjct  61   IVAGAALFAAFPEWYASLFSGFYLALLLILLALILRGVSFEYRHQRPGSRWKRWFDGMIV  120

Query  121  GGSIISSFLQGVILGAYIQGIHIVDG-RYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWL  179
             GS + + L GV     +QG+ +  G  Y G   D L  + L  G+  ++++   G  ++
Sbjct  121  VGSAVPALLWGVAFANIVQGVALDAGHNYTGTLFDLLNIYGLLGGLTTLLLFFTHGAVFI  180

Query  180  IMKTDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPIL  239
             +KT+  ++     L               ++ +      +AA +     + +FS V ++
Sbjct  181  SLKTEGDIRERARRL---------------AVTSGALTIAVAAAFLIWTAIAHFSVVFVI  225

Query  240  VVIFTFLTVRA----CSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPP------SVTI  289
            V     + + A      +  E   F +    + LA T    ++FP ++P       S+TI
Sbjct  226  VAALAAVALIASWLFTLRGAEGWSFAFMALTIALAVTALFTALFPNVLPSAPNPENSLTI  285

Query  290  WDAAAPANSQLFALIGALILIPIIIMYTIMAYWVFRDKV  328
             +A++   +       A   +P++++Y    YW+FR +V
Sbjct  286  ANASSTDATLTVMTWVAAFSLPLVLLYQGWTYWIFRKRV  324


> Q2ACC6 Cytochrome d ubiquinol oxidase subunit II [Shewanella 
violacea]
Length=379

 Score =  166 bits (420),  Expect = 2e-50
 Identities = 105/354 (30%), Positives = 162/354 (46%), Gaps = 37/354 (10%)

Query  6    LSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGNETWMVL  64
            L  IW  +I   +  + V DGFD+G+G L P + KD  ER +M+NT+AP WDGN+ W++ 
Sbjct  7    LRFIWWALIGFLLIGFAVTDGFDMGVGALLPILGKDDTERRIMINTIAPHWDGNQVWLIT  66

Query  65   GGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKAN--RTKHLWDAAFIGG  122
             G  LFAA+PMVY    S  Y+ ++L++ AL  R V F++R K    R +  WD A   G
Sbjct  67   AGGALFAAWPMVYGVSFSGFYVAMMLVLFALYLRPVGFDYRSKIEDPRWRSAWDWALFIG  126

Query  123  SIISSFLQGVILGAYIQGI-----HIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCG  177
              +   + GV  G  +QG+       +   Y GG    L PF +  G+  V ++   G  
Sbjct  127  GFVPPLIIGVAFGNLLQGVPFNFDEYLRATYHGGFFGLLNPFGILAGLVCVSMFMLQGAT  186

Query  178  WLIMKTDHRLQLNMYSLMPKLMYALLIIFVCVSIYT----------------PLSQPQI-  220
            WL MKT+  L+    +    L + L I F    I+                  +S P I 
Sbjct  187  WLQMKTESELRARAANAAQVLAFLLFIFFGAAGIWLVNGIDGYVITSVLDTYGVSDPTIK  246

Query  221  -----AARWFTQ-PQLTYFSPVPILVVIFTFLTVRACSKRQESMPFLYTLALVFLAYTGF  274
                 A  W T   +       P+L ++   L + +    +    F ++   V       
Sbjct  247  TVAVEAGAWLTNYDKYPVTMMFPVLGLLMPLLVILSSRLNRSGFAFFFSSIGVAAIILTC  306

Query  275  LISIFPYIIPP------SVTIWDAAAPANSQLFALIGALILIPIIIMYTIMAYW  322
              ++FP+++P       S+T+WDA A   S       A+I +PI++ YTI  Y+
Sbjct  307  GSAMFPFVMPSSLDPNVSLTMWDATASEKSLTVMTWAAIIFVPIVLSYTIFTYY  360


> Q2QFA7 Cytochrome bd quinol oxidase subunit II [Desulfovibrio 
gigas]
Length=336

 Score =  164 bits (415),  Expect = 4e-50
 Identities = 105/329 (32%), Positives = 166/329 (50%), Gaps = 16/329 (5%)

Query  6    LSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGNETWMVL  64
            L  IW ++  V   +Y VLDGFD GIG L PF+ K++ +R +M N   P WDGNE W++ 
Sbjct  2    LETIWFILWGVLWAMYFVLDGFDFGIGTLMPFLAKNETDRRIMYNAQGPFWDGNEVWLIT  61

Query  65   GGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRF--KANRTKHLWDAAFIGG  122
             G   FAAFP VY+ + S LY P+ L++ ALIFRGV FEFR   ++   K   D   + G
Sbjct  62   AGGVTFAAFPEVYAVMFSQLYTPLYLLLFALIFRGVTFEFRHLSESPTMKKFMDICHVLG  121

Query  123  SIISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK  182
            S + + L GV       G+ + +G   G     L P++L  G+  V  +   G  WL +K
Sbjct  122  SFLPALLLGVAFSNIFMGLPLENGVSQGSFFGLLNPYALAGGLLFVTAFCYHGAVWLAIK  181

Query  183  TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPILVVI  242
            +   ++        ++  AL+++ V     + L+   + A +   P L +   +P+  ++
Sbjct  182  SPASMRQRAIRAAEEIWPALVLLAVVFLAASALA-TDLYANYLKYPFLLFIPMIPVAGLV  240

Query  243  FTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPP------SVTIWDAAAPA  296
               LT  A  KR     ++++ A +F      +  IFP ++P       SVTI + A+  
Sbjct  241  ---LTRVALGKRNLWQSWIFSAATIFGTTAFGVAGIFPALLPSSIGPEHSVTIHNGASSP  297

Query  297  NSQLFALIGALILIPIIIMYTIMAYWVFR  325
             +    L  AL+++P II+Y     WVF+
Sbjct  298  LTLQIMLGVALVMVPAIILYQA---WVFK  323


> O05192 Subunit II of cytochrome bd [Klebsiella pneumoniae]
Length=379

 Score =  160 bits (405),  Expect = 3e-48
 Identities = 111/363 (31%), Positives = 175/363 (48%), Gaps = 46/363 (13%)

Query  3    MID---LSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGN  58
            MID   L  IW ++I + +  + V DGFD+G+G+L  F+ ++  ER +M+N +AP WDGN
Sbjct  1    MIDYEVLRFIWWLLIGILLIGFAVADGFDMGVGMLTRFLGRNDTERRIMINAIAPHWDGN  60

Query  59   ETWMVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKA--NRTKHLWD  116
            + W++  G  LFAA+PMVY+A  S  Y+ +IL++ +L FR V F++R K   NR +++WD
Sbjct  61   QVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGFDYRSKIEDNRWRNMWD  120

Query  117  AAFIGGSIISSFLQGVILGAYIQGI--HIVDG---RYAGGGLDWLTPFSLFTGVGVVVVY  171
                 GS +   + GV  G  +QG+  H+ +     Y G     L PF L  G+  V + 
Sbjct  121  WGIFVGSFVPPLVIGVAFGNLLQGVPFHVDEYLRLYYTGNFFQLLNPFGLLAGIVSVAMI  180

Query  172  AALGCGWLIMKTDHRLQLNMYSLMPKLMYALLIIFVCVSIY-------------------  212
               G  +L M+T   L L   S+        LI F    ++                   
Sbjct  181  LTQGATYLQMRTVGELHLRTRSVSTVPALVTLICFALAGVWVYYGIDGYVVKSVMDHTGP  240

Query  213  -TPLSQ--PQIAARWFTQ-PQLTYFSPVPILVVIFTFLTVRACSKRQESMPFLY---TLA  265
              PL++   + A  W      +     +P L      LTV +    + +  FL+   TLA
Sbjct  241  SNPLTKEVAREAGAWMVNFNNMPALWAIPALGPWLPLLTVISTKADKGAWAFLFSSLTLA  300

Query  266  LVFLAYTGFLISIFPYIIP------PSVTIWDAAAPANSQLFALIGALILIPIIIMYTIM  319
             + L      I++FP+I+P       S+T+WDA +   +       A++ +PII+ YT  
Sbjct  301  CIILTAG---IAMFPFIMPSSTAMNASLTMWDATSSTLTLNVMTYVAIVFVPIILAYTTW  357

Query  320  AYW  322
             YW
Sbjct  358  CYW  360


> O67974 Cytochrome d oxidase subunit II [Salmonella typhimurium]
Length=379

 Score =  148 bits (374),  Expect = 7e-44
 Identities = 105/368 (29%), Positives = 174/368 (47%), Gaps = 56/368 (15%)

Query  3    MID---LSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGN  58
            MID   L  IW +++ + +  + V DGFD+G+G+L  F+ ++  ER +M+N++AP WDGN
Sbjct  1    MIDYEVLRFIWWLLVGILLIGFAVTDGFDMGVGMLTRFLGRNDTERRIMINSIAPHWDGN  60

Query  59   ETWMVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKAN--RTKHLWD  116
            + W++  G  LFAA+PMVY+A  S  Y+ +IL++ +L FR V  ++R K    R +++WD
Sbjct  61   QVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGLDYRSKIEDPRWRNMWD  120

Query  117  AAFIGGSIISSFLQGVILGAYIQGIHIVDGRY-----AGGGLDWLTPFSLFTGVGVVVVY  171
                 G+ +   + GV  G  +QG+      Y      G     L P  L TG+  V + 
Sbjct  121  WGVFIGNFVPPLVIGVAFGNLLQGVPFHVDEYLRLYXTGNFFQMLKPXGLLTGIVSVGMI  180

Query  172  AALGCGWLIMKTDHRLQLNMYSLMPKLMYALLIIFVCVSI--------------------  211
               G  +L  +T   L L   +       A L+  VC+++                    
Sbjct  181  ITQGATYLXXRTVGELHLRARATS---QIAALVTLVCIALAGVWVMYGIDGYVVTSAIDH  237

Query  212  ---YTPLSQ--PQIAARW---FTQPQLTYFSPVPILVVIFTFLTVRACSKRQESMPFLY-  262
                 PL++   +    W   F    + +   VP L V+   LT+      + +  FL+ 
Sbjct  238  HTASNPLTKEVARETGAWLVNFNNAPILWL--VPALGVVLPLLTILTSRMEKGAWAFLFS  295

Query  263  --TLALVFLAYTGFLISIFPYIIP------PSVTIWDAAAPANSQLFALIGALILIPIII  314
              TLA + L      I++FP+++P       S+ +WDA +   +       A +L+PII+
Sbjct  296  SLTLACIILTAG---ITMFPFVMPSSTMMNASLAMWDATSSQMTLNLMTWVAAVLVPIIL  352

Query  315  MYTIMAYW  322
            +YT   YW
Sbjct  353  IYTSWCYW  360


> Q05780 Cytochrome d oxidase complex subunit II [Azotobacter vinelandii]
Length=379

 Score =  143 bits (360),  Expect = 7e-42
 Identities = 108/356 (30%), Positives = 166/356 (47%), Gaps = 41/356 (12%)

Query  6    LSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGNETWMVL  64
            L L+W  +I V +    + DGFD+G   L PFI K  +ER V +NTVAP WDGN+ W++ 
Sbjct  7    LKLVWWGLIGVLLIGLALTDGFDMGAMALMPFIAKTDNERRVAINTVAPHWDGNQVWLIT  66

Query  65   GGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTK--HLWDAAFIGG  122
             G  LFAA+P+VY+   S +Y  ++L++  L FR V F++R K    K   +WD A +  
Sbjct  67   AGGALFAAWPLVYATAFSGMYWALLLVLFGLFFRPVGFDYRSKLENKKWRDMWDWALLLQ  126

Query  123  SIISSFLQGVILGAYIQGI-----HIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCG  177
              + + L GV       G+       +   + G     L PF+L  GV  + +  A G  
Sbjct  127  VRLPALLFGVAFANLFLGLPFRLDETMRTHFEGSFFSLLHPFALLAGVVSLSMLCAHGGS  186

Query  178  WLIMKTDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLS----------QPQIA------  221
            WL+++T+  L               L  F    ++  L            P +A      
Sbjct  187  WLMLRTEGDLYERSCKATRLSAIVFLGCFFICGLWLLLGIEGQNLVDNFDPNVALNPLTK  246

Query  222  ------ARW---FTQPQLTYFSPVPILVVIFTFLTVRACSKRQESMPFLYT-LALVFLAY  271
                  + W   + +  LT F+  P+L ++   L +     ++  + FL T LA++    
Sbjct  247  QVTLDNSGWQTNYVRYPLTQFA--PLLGLVGGALALMGAQTKRNGLAFLGTSLAIIGAIL  304

Query  272  T-GFLI--SIFPYIIPP--SVTIWDAAAPANSQLFALIGALILIPIIIMYTIMAYW  322
            T GF    S+ P  I P  S+TIWDA +   +    LI A+I +PII+ YT+  YW
Sbjct  305  TAGFACSRSVMPSSIDPASSLTIWDAVSSQKTLGIMLIVAIIFVPIILGYTLWCYW  360



Lambda      K        H        a         alpha
   0.334    0.148    0.477    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2079315


  Database: 21d3663385f51f115ae3c44f344e5214.TrEMBL.fasta
    Posted date:  Sep 25, 2020  11:58 AM
  Number of letters in database: 8,495
  Number of sequences in database:  25



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40