ACIAD1749 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: c9fcf85ee438ecd58b03a2d99fa65c41.SwissProt.fasta
           8 sequences; 3,209 total letters



Query= ACIAD1749

Length=337
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  P0ABK4 Cytochrome bd-I ubiquinol oxidase subunit 2 [Escherichia...   161    4e-49
  P0ABK3 Cytochrome bd-I ubiquinol oxidase subunit 2 [Escherichia...   161    4e-49
  P0ABK2 Cytochrome bd-I ubiquinol oxidase subunit 2 [Escherichia...   161    4e-49
  P94365 Cytochrome bd ubiquinol oxidase subunit 2 [Bacillus subt...   157    9e-48
  P26458 Cytochrome bd-II ubiquinol oxidase subunit 2 [Escherichi...   151    3e-45
  P45020 Probable cytochrome oxidase subunit 2 [Haemophilus influ...   149    1e-44
  O34505 Putative cytochrome bd menaquinol oxidase subunit II [Ba...  45.1    8e-09
  Q9UVF6 pH-response regulator protein palH/RIM21 [Yarrowia lipol...  37.4    3e-06


> P0ABK4 Cytochrome bd-I ubiquinol oxidase subunit 2 [Escherichia 
coli O157:H7]
Length=379

 Score =  161 bits (408),  Expect = 4e-49
 Identities = 113/363 (31%), Positives = 182/363 (50%), Gaps = 46/363 (13%)

Query  3    MID---LSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGN  58
            MID   L  IW +++ V +  + V DGFD+G+G+L  F+ ++  ER +M+N++AP WDGN
Sbjct  1    MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTERRIMINSIAPHWDGN  60

Query  59   ETWMVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRT--KHLWD  116
            + W++  G  LFAA+PMVY+A  S  Y+ +IL++ +L FR V F++R K   T  +++WD
Sbjct  61   QVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGFDYRSKIEETRWRNMWD  120

Query  117  AAFIGGSIISSFLQGVILGAYIQGIHI-VDG----RYAGGGLDWLTPFSLFTGVGVVVVY  171
                 GS +   + GV  G  +QG+   VD      Y G     L PF L  GV  V + 
Sbjct  121  WGIFIGSFVPPLVIGVAFGNLLQGVPFNVDEYLRLYYTGNFFQLLNPFGLLAGVVSVGMI  180

Query  172  AALGCGWLIMKTDHRLQL------NMYSLMPKLMYALLIIFVCVSI--------------  211
               G  +L M+T   L L       + +L+  + +AL  ++V   I              
Sbjct  181  ITQGATYLQMRTVGELHLRTRATAQVAALVTLVCFALAGVWVMYGIDGYVVKSTMDHYAA  240

Query  212  YTPLSQPQI--AARWFTQPQLT-YFSPVPILVVIFTFLTVRACSKRQESMPFLY---TLA  265
              PL++  +  A  W      T     +P L V+   LT+      + +  F++   TLA
Sbjct  241  SNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTILTARMDKAAWAFVFSSLTLA  300

Query  266  LVFLAYTGFLISIFPYIIP------PSVTIWDAAAPANSQLFALIGALILIPIIIMYTIM  319
             + L      I++FP+++P       S+T+WDA +   +       A++L+PII++YT  
Sbjct  301  CIILTAG---IAMFPFVMPSSTMMNASLTMWDATSSQLTLNVMTWVAVVLVPIILLYTAW  357

Query  320  AYW  322
             YW
Sbjct  358  CYW  360


> P0ABK3 Cytochrome bd-I ubiquinol oxidase subunit 2 [Escherichia 
coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)]
Length=379

 Score =  161 bits (408),  Expect = 4e-49
 Identities = 113/363 (31%), Positives = 182/363 (50%), Gaps = 46/363 (13%)

Query  3    MID---LSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGN  58
            MID   L  IW +++ V +  + V DGFD+G+G+L  F+ ++  ER +M+N++AP WDGN
Sbjct  1    MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTERRIMINSIAPHWDGN  60

Query  59   ETWMVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRT--KHLWD  116
            + W++  G  LFAA+PMVY+A  S  Y+ +IL++ +L FR V F++R K   T  +++WD
Sbjct  61   QVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGFDYRSKIEETRWRNMWD  120

Query  117  AAFIGGSIISSFLQGVILGAYIQGIHI-VDG----RYAGGGLDWLTPFSLFTGVGVVVVY  171
                 GS +   + GV  G  +QG+   VD      Y G     L PF L  GV  V + 
Sbjct  121  WGIFIGSFVPPLVIGVAFGNLLQGVPFNVDEYLRLYYTGNFFQLLNPFGLLAGVVSVGMI  180

Query  172  AALGCGWLIMKTDHRLQL------NMYSLMPKLMYALLIIFVCVSI--------------  211
               G  +L M+T   L L       + +L+  + +AL  ++V   I              
Sbjct  181  ITQGATYLQMRTVGELHLRTRATAQVAALVTLVCFALAGVWVMYGIDGYVVKSTMDHYAA  240

Query  212  YTPLSQPQI--AARWFTQPQLT-YFSPVPILVVIFTFLTVRACSKRQESMPFLY---TLA  265
              PL++  +  A  W      T     +P L V+   LT+      + +  F++   TLA
Sbjct  241  SNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTILTARMDKAAWAFVFSSLTLA  300

Query  266  LVFLAYTGFLISIFPYIIP------PSVTIWDAAAPANSQLFALIGALILIPIIIMYTIM  319
             + L      I++FP+++P       S+T+WDA +   +       A++L+PII++YT  
Sbjct  301  CIILTAG---IAMFPFVMPSSTMMNASLTMWDATSSQLTLNVMTWVAVVLVPIILLYTAW  357

Query  320  AYW  322
             YW
Sbjct  358  CYW  360


> P0ABK2 Cytochrome bd-I ubiquinol oxidase subunit 2 [Escherichia 
coli (strain K12)]
Length=379

 Score =  161 bits (408),  Expect = 4e-49
 Identities = 113/363 (31%), Positives = 182/363 (50%), Gaps = 46/363 (13%)

Query  3    MID---LSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGN  58
            MID   L  IW +++ V +  + V DGFD+G+G+L  F+ ++  ER +M+N++AP WDGN
Sbjct  1    MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTERRIMINSIAPHWDGN  60

Query  59   ETWMVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRT--KHLWD  116
            + W++  G  LFAA+PMVY+A  S  Y+ +IL++ +L FR V F++R K   T  +++WD
Sbjct  61   QVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGFDYRSKIEETRWRNMWD  120

Query  117  AAFIGGSIISSFLQGVILGAYIQGIHI-VDG----RYAGGGLDWLTPFSLFTGVGVVVVY  171
                 GS +   + GV  G  +QG+   VD      Y G     L PF L  GV  V + 
Sbjct  121  WGIFIGSFVPPLVIGVAFGNLLQGVPFNVDEYLRLYYTGNFFQLLNPFGLLAGVVSVGMI  180

Query  172  AALGCGWLIMKTDHRLQL------NMYSLMPKLMYALLIIFVCVSI--------------  211
               G  +L M+T   L L       + +L+  + +AL  ++V   I              
Sbjct  181  ITQGATYLQMRTVGELHLRTRATAQVAALVTLVCFALAGVWVMYGIDGYVVKSTMDHYAA  240

Query  212  YTPLSQPQI--AARWFTQPQLT-YFSPVPILVVIFTFLTVRACSKRQESMPFLY---TLA  265
              PL++  +  A  W      T     +P L V+   LT+      + +  F++   TLA
Sbjct  241  SNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTILTARMDKAAWAFVFSSLTLA  300

Query  266  LVFLAYTGFLISIFPYIIP------PSVTIWDAAAPANSQLFALIGALILIPIIIMYTIM  319
             + L      I++FP+++P       S+T+WDA +   +       A++L+PII++YT  
Sbjct  301  CIILTAG---IAMFPFVMPSSTMMNASLTMWDATSSQLTLNVMTWVAVVLVPIILLYTAW  357

Query  320  AYW  322
             YW
Sbjct  358  CYW  360


> P94365 Cytochrome bd ubiquinol oxidase subunit 2 [Bacillus subtilis 
(strain 168)]
Length=338

 Score =  157 bits (396),  Expect = 9e-48
 Identities = 105/336 (31%), Positives = 177/336 (53%), Gaps = 16/336 (5%)

Query  3    MIDLSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGNETW  61
            M  L  +W +++AV    +  L+GFD G+G+   F+  ++ ER V++NT+ P WD NE W
Sbjct  1    MASLHDLWFILVAVLFVGFFFLEGFDFGVGMATRFLGHNELERRVLINTIGPFWDANEVW  60

Query  62   MVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTK--HLWDAAF  119
            ++ G   +FAAFP  Y+ +LS  Y+P +++++AL+ RGVAFEFR K +  K   +WD   
Sbjct  61   LLTGAGAIFAAFPNWYATMLSGYYIPFVIVLLALMGRGVAFEFRGKVDHLKWVKVWDWVV  120

Query  120  IGGSIISSFLQGVILGAYIQGIHI-VDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGW  178
              GS+I  F+ GV+     +G+ I  D        D++  +S+  GV V ++    G  +
Sbjct  121  FFGSLIPPFVLGVLFTTLFRGMPIDADMNIHAHVSDYINVYSILGGVTVTLLCFQHGLMF  180

Query  179  LIMKTDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPI  238
            + ++T   LQ     +  K+M    ++FV V  +  LS  Q    +  + ++T   P+ +
Sbjct  181  ITLRTIGDLQNRARKMAQKIMG---VVFVAVLAFAALSAYQ-TDMFTRRGEITI--PLAV  234

Query  239  LVVIFTFLTVRACSKRQESMPFLYTLALVFLAYTGFLISIFPYIIPPS------VTIWDA  292
            L+VI   L      K+++   F  T A + L      IS+FP ++  S      +T+ +A
Sbjct  235  LIVICFMLAAVFIRKKKDGWTFGMTGAGLALTVGMIFISLFPRVMVSSLHSAYDLTVANA  294

Query  293  AAPANSQLFALIGALILIPIIIMYTIMAYWVFRDKV  328
            ++   S     I AL L+P +I   I +Y+VFR +V
Sbjct  295  SSGDYSLKVMSIAALTLLPFVIGSQIWSYYVFRKRV  330


> P26458 Cytochrome bd-II ubiquinol oxidase subunit 2 [Escherichia 
coli (strain K12)]
Length=378

 Score =  151 bits (381),  Expect = 3e-45
 Identities = 103/356 (29%), Positives = 176/356 (49%), Gaps = 42/356 (12%)

Query  6    LSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGNETWMVL  64
            L  IW ++I V + ++++ DGFD+GIG L P + ++  ER +++N+V   W+GN+ W++L
Sbjct  7    LRFIWWLLIGVILVVFMISDGFDMGIGCLLPLVARNDDERRIVINSVGAHWEGNQVWLIL  66

Query  65   GGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKAN--RTKHLWDAAFIGG  122
             G  LFAA+P VY+A  S  Y+ +IL++ +L FR +AF++R K    R + +WDA  + G
Sbjct  67   AGGALFAAWPRVYAAAFSGFYVAMILVLCSLFFRPLAFDYRGKIADARWRKMWDAGLVIG  126

Query  123  SIISSFLQGVILGAYIQGIHI-----VDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCG  177
            S++   + G+  G  + G+       +   Y G     LTPF L  G+  + +    G  
Sbjct  127  SLVPPVVFGIAFGNLLLGVPFAFTPQLRVEYLGSFWQLLTPFPLLCGLLSLGMVILQGGV  186

Query  178  WLIMKT------DHRLQLNMYSLMPKLMYALLIIFVCVSI--YTPLSQPQ----------  219
            WL +KT        +L     +L+  L + L   ++ V I  +  L+Q            
Sbjct  187  WLQLKTVGVIHLRSQLATKRAALLVMLCFLLAGYWLWVGIDGFVLLAQDANGPSNPLMKL  246

Query  220  ---IAARWFTQ----PQLTYFSPVPILVVIFTFLTVRACSKRQESMPFLYTLALVFLAYT  272
               +   W       P L  F   P+L      LTV A  + +    FL    + F    
Sbjct  247  VAVLPGAWMNNFVESPVLWIF---PLLGFFCPLLTVMAIYRGRPGWGFLMASLMQFGVIF  303

Query  273  GFLISIFPYIIPPSV------TIWDAAAPANSQLFALIGALILIPIIIMYTIMAYW  322
               I++FP+++P SV      T+WD+ +   +    L+  LI +PI+++YT+ +Y+
Sbjct  304  TAGITLFPFVMPSSVSPISSLTLWDSTSSQLTLSIMLVIVLIFLPIVLLYTLWSYY  359


> P45020 Probable cytochrome oxidase subunit 2 [Haemophilus influenzae 
(strain ATCC 51907 / DSM 11121 / KW20 / Rd)]
Length=378

 Score =  149 bits (376),  Expect = 1e-44
 Identities = 105/358 (29%), Positives = 165/358 (46%), Gaps = 39/358 (11%)

Query  3    MID---LSLIWIVIIAVGVFIYIVLDGFDLGIGILFPFI-KDQHERDVMMNTVAPVWDGN  58
            MID   L  IW V++ V +  + V DGFD+G+  L P I K + ER +M+NT+AP WDGN
Sbjct  1    MIDYEFLRFIWWVLVIVLLIGFSVTDGFDMGVTALLPVIGKKEVERRIMINTIAPHWDGN  60

Query  59   ETWMVLGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRT--KHLWD  116
            + W++  G  +FAA+P+VY+   S  Y+ ++L++ AL  R + FE+R K +    + +WD
Sbjct  61   QVWLLTAGGAIFAAWPIVYAVSFSGFYIALVLVLAALFLRPLGFEYRAKIDNPTWRSVWD  120

Query  117  AAFIGGSIISSFLQGVILGAYIQGI-----HIVDGRYAGGGLDWLTPFSLFTGVGVVVVY  171
                 G  + + + GV  G  +QG+      +    Y G   + L PF+L  GV  + + 
Sbjct  121  WGLFAGGFVPALVFGVAFGNLLQGVPFHFNELTQVTYTGSFFELLNPFALLCGVISLSML  180

Query  172  AALGCGWLIMKTDHRLQLNMYSLMPKLMYALLIIFVCVSI----------------YTPL  215
               G  WL MKT   L+    ++        LI FV   +                + P 
Sbjct  181  VTHGANWLQMKTTEALRDRARTVSQIGSIVTLIAFVLAGVWLYSKDGYVVTSTIDHFAPS  240

Query  216  SQPQIAARWFTQPQLTYFSPVPILVVIFTFLTVRACSKRQESMPFLYTLALVFLAYT--G  273
            S         T      F+ +PIL +      V A      S       A  F A T  G
Sbjct  241  SPMNKEVAVETGAWFRNFNEMPILWIFPALAVVAALLNAAFSKANRCGFAFFFSALTMAG  300

Query  274  FLI----SIFPYIIP------PSVTIWDAAAPANSQLFALIGALILIPIIIMYTIMAY  321
             +I    S+FP+++P       S+ +WD+ +   +    LI A++ + I + YTI +Y
Sbjct  301  VIITAAVSMFPFVMPSSSHPEQSLLMWDSTSSELTLTLMLIFAVVFVVIALAYTIWSY  358


> O34505 Putative cytochrome bd menaquinol oxidase subunit II [Bacillus 
subtilis (strain 168)]
Length=346

 Score = 45.1 bits (105),  Expect = 8e-09
 Identities = 74/345 (21%), Positives = 131/345 (38%), Gaps = 24/345 (7%)

Query  7    SLIWIVIIAVGVFIYIVLDGFDLGIGIL-FPFIKDQHER--DVMMNTVAPVWDGNETWMV  63
            +LI I II   VFIY V+   D G G     ++  +H +  D+    ++P W+    ++V
Sbjct  7    ALIAISIIWGFVFIYAVMATMDFGAGFWSMIYLNKEHMKATDIANRFLSPTWEVTNVFIV  66

Query  64   LGGAGLFAAFPMVYSAVLSALYLPIILMVIALIFRGVAFEFRFKANRTKHLWDAAFIGGS  123
                 LF+ FP     + + L +P  ++++ L  R     F   A   K L   + I G 
Sbjct  67   AIVVALFSFFPGATFVLGTVLLIPGSMILLLLAIRSGFLVFSNTAKERKTLRYISGISGF  126

Query  124  IISSFLQGVILGAYIQGIHIVDGRYAGGGLDWLTPFSLFTGVGVVVVYAALGCGWLIMK-  182
            II + L  V+   +   I   DG Y        +  + ++ +G  ++        L+   
Sbjct  127  IIPAILILVLPVTHGGFIEKTDGIYNLNMSKIFSSPNAYSFIGFAILSTLFLSSLLLADF  186

Query  183  ---TDHRLQLNMYSLMPKLMYALLIIFVCVSIYTPLSQPQIAARWFTQPQLTYFSPVPIL  239
                + +     Y     +   + ++F    + T  ++    A W     +  FS +   
Sbjct  187  SNVAEEQDAYRAYRKSALITGPISLLFAVCIMVTMRNE----ANWLYSGMMNDFSWIIAS  242

Query  240  VVIFTFLTVRACSKRQE-----SMPFLYTLAL---VFLAYTGFLISIFPYIIPPSVTIWD  291
             + F    +      +        P L  +A+    FLA   +  +  PY+I P VT+  
Sbjct  243  FITFVIAGIALFLPNKSFGQNIGKPRLALVAIGIQYFLASYAYGRAHLPYMIYPDVTVMS  302

Query  292  A-AAPANSQLFALIGALILIPIIIMYTIMAYW--VFRDKVRVGDE  333
                PA  +  AL    I+  II+      +W    RDK  +  E
Sbjct  303  GFTEPATFR--ALFATYIVAFIILFPGFFFFWKMFMRDKRYIRQE  345


> Q9UVF6 pH-response regulator protein palH/RIM21 [Yarrowia lipolytica 
(strain CLIB 122 / E 150)]
Length=632

 Score = 37.4 bits (85),  Expect = 3e-06
 Identities = 46/182 (25%), Positives = 79/182 (43%), Gaps = 17/182 (9%)

Query  158  PFSLFTGVGVVVVYAALGCGWLIMKTD------HRLQLNMYSLMPKLM--YALLIIFVCV  209
            P  LF  + V++   +L   +L   TD      +    N Y L  K+M  +A  I+ V  
Sbjct  145  PSPLFQKIAVLITAVSLTV-FLAQATDTLESQYNEGYQNAYELRHKIMGGWAFRILQVIT  203

Query  210  SIYTPLSQPQIAARWFTQPQLTYFSPVPILVVIFTFLTVRACSKR----QESMPFLYTLA  265
             + T L++ Q+  R F  P++     V    +IFT  T+ AC        + +    ++ 
Sbjct  204  CVITWLARLQVVIRLFDVPKINTRLAVVGSTLIFTNATIWACLNLIPPWSQYVRNAKSVL  263

Query  266  LVFLAYTGFLISIFPYIIPP--SVTIWDAAAPANSQLFALIG--ALILIPIIIMYTIMAY  321
             VF A    L+ +F  ++    S++    A    S + A I   A+IL  + I++ I  Y
Sbjct  264  PVFGALCSLLLEVFYLVVVVIYSISKRKYAYSRTSIVMAAISWLAMILPMVFIVFDIAHY  323

Query  322  WV  323
            W+
Sbjct  324  WI  325



Lambda      K        H        a         alpha
   0.334    0.148    0.477    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 837101


  Database: c9fcf85ee438ecd58b03a2d99fa65c41.SwissProt.fasta
    Posted date:  Sep 18, 2020  4:40 PM
  Number of letters in database: 3,209
  Number of sequences in database:  8



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40