ACIAD1674 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 1301350bfaa865d827e01e21955886ad.TrEMBL.fasta
           14 sequences; 2,003 total letters



Query= ACIAD1674

Length=143
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FBP3 Uncharacterized protein [Acinetobacter baylyi (strain AT...   288    4e-104
  N9RZP2 Uncharacterized protein [Acinetobacter ursingii NIPH 706]     206    3e-72 
  N9D885 Uncharacterized protein [Acinetobacter ursingii ANC 3649]     206    5e-72 
  A0A009ZBK3 LrgA family protein [Acinetobacter sp. 479375]            203    8e-71 
  A0A2S9EQP6 CidA/LrgA family protein [Acinetobacter sp. MYb10]        190    9e-66 
  A0A077KZL3 Uncharacterized protein [Acinetobacter guillouiae]        190    9e-66 
  N8Y946 Uncharacterized protein [Acinetobacter guillouiae NIPH 991]   190    9e-66 
  A0A0Q7G3R2 LrgA family protein [Acinetobacter sp. Root1280]          190    9e-66 
  A0A1P8EGM0 CidA/LrgA family protein [Acinetobacter soli]             189    2e-65 
  A0A072CY02 Transporter [Acinetobacter sp. ETR1]                      188    7e-65 
  N9BNY5 Uncharacterized protein [Acinetobacter soli NIPH 2899]        187    2e-64 
  A0A0M1I1H1 Murein hydrolase transporter LrgA [Acinetobacter sp....   187    2e-64 
  A0A241WGY7 CidA/LrgA family protein [Acinetobacter sp. ANC 3832]     186    3e-64 
  Q6PST9 Holin-like protein CidA [Staphylococcus aureus]              73.2    1e-20 


> Q6FBP3 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=142

 Score =  288 bits (736),  Expect = 4e-104
 Identities = 141/142 (99%), Positives = 142/142 (100%), Gaps = 0/142 (0%)

Query  1    VYQSRGLYLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQW  60
            +YQSRGLYLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQW
Sbjct  1    MYQSRGLYLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQW  60

Query  61   IKTGSDFILGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICF  120
            IKTGSDFILGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICF
Sbjct  61   IKTGSDFILGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICF  120

Query  121  KLEAWLKRHHRSGHQQRSGVKS  142
            KLEAWLKRHHRSGHQQRSGVKS
Sbjct  121  KLEAWLKRHHRSGHQQRSGVKS  142


> N9RZP2 Uncharacterized protein [Acinetobacter ursingii NIPH 706]
Length=142

 Score =  206 bits (525),  Expect = 3e-72
 Identities = 95/135 (70%), Positives = 118/135 (87%), Gaps = 0/135 (0%)

Query  8    YLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDF  67
            Y  +++IQI LL++FWW+GSLLQ+ LNLP+SAGV+GLFLVLIGL+SGVFKLQWIKTGSDF
Sbjct  8    YFAKVIIQIGLLLIFWWIGSLLQQTLNLPVSAGVIGLFLVLIGLVSGVFKLQWIKTGSDF  67

Query  68   ILGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLK  127
            +L ELVLFFIPCVVGL+NYK+LFI EGWQL++A+VLGT+CVMVFTAY+VH CFKLE+ LK
Sbjct  68   MLAELVLFFIPCVVGLINYKSLFIAEGWQLITAIVLGTLCVMVFTAYTVHFCFKLESRLK  127

Query  128  RHHRSGHQQRSGVKS  142
            +  +     +  +KS
Sbjct  128  QRSQDKMLHQHELKS  142


> N9D885 Uncharacterized protein [Acinetobacter ursingii ANC 3649]
Length=142

 Score =  206 bits (524),  Expect = 5e-72
 Identities = 95/135 (70%), Positives = 118/135 (87%), Gaps = 0/135 (0%)

Query  8    YLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDF  67
            Y  +++IQI LL++FWW+GSLLQ+ LNLP+SAGV+GLFLVLIGL+SGVFKLQWIKTGSDF
Sbjct  8    YFAKVIIQIGLLLIFWWIGSLLQQALNLPVSAGVIGLFLVLIGLVSGVFKLQWIKTGSDF  67

Query  68   ILGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLK  127
            +L ELVLFFIPCVVGL+NYK+LFI EGWQL++A+VLGT+CVMVFTAY+VH CFKLE+ LK
Sbjct  68   MLAELVLFFIPCVVGLINYKSLFIAEGWQLITAIVLGTLCVMVFTAYTVHFCFKLESRLK  127

Query  128  RHHRSGHQQRSGVKS  142
            +  +     +  +KS
Sbjct  128  QRSQDKMLHQHELKS  142


> A0A009ZBK3 LrgA family protein [Acinetobacter sp. 479375]
Length=142

 Score =  203 bits (516),  Expect = 8e-71
 Identities = 92/121 (76%), Positives = 112/121 (93%), Gaps = 0/121 (0%)

Query  8    YLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDF  67
            Y  +++IQI LL++FWW+GSLLQ+ LNLP+SAGV+GLFLVLIGL+SGVFKLQWIKTGSDF
Sbjct  8    YFAKVIIQIGLLLIFWWIGSLLQQALNLPVSAGVIGLFLVLIGLVSGVFKLQWIKTGSDF  67

Query  68   ILGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLK  127
            +L ELVLFFIPCVVGL+NYK+LFI EGWQL++A+VL T+CVMVFTAY+VH CFKLE+ LK
Sbjct  68   MLAELVLFFIPCVVGLINYKSLFIAEGWQLITAIVLSTLCVMVFTAYTVHFCFKLESRLK  127

Query  128  R  128
            +
Sbjct  128  Q  128


> A0A2S9EQP6 CidA/LrgA family protein [Acinetobacter sp. MYb10]
Length=146

 Score =  190 bits (483),  Expect = 9e-66
 Identities = 86/122 (70%), Positives = 106/122 (87%), Gaps = 0/122 (0%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            + ++++QI LL+L WW+GS++Q+  NLPISA V+GLF+VLIGL++G+FKL WIK+GSDFI
Sbjct  13   IYKVILQIGLLILIWWIGSIIQKQFNLPISAAVIGLFMVLIGLMTGIFKLNWIKSGSDFI  72

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            LGELVLFFIPC +GLM YK LF+TEGWQL+  VVLGTICVMVFTAYSVHI FKLE  LK+
Sbjct  73   LGELVLFFIPCFIGLMKYKNLFMTEGWQLIVVVVLGTICVMVFTAYSVHIGFKLERKLKQ  132

Query  129  HH  130
             H
Sbjct  133  RH  134


> A0A077KZL3 Uncharacterized protein [Acinetobacter guillouiae]
Length=146

 Score =  190 bits (483),  Expect = 9e-66
 Identities = 87/122 (71%), Positives = 105/122 (86%), Gaps = 0/122 (0%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            + ++ +QI LL+L WW+GS++Q+  NLPISA V+GLF+VLIGL++G+FKL WIK+GSDFI
Sbjct  13   IYKVTLQIGLLILIWWIGSIIQKQFNLPISAAVIGLFMVLIGLMTGIFKLNWIKSGSDFI  72

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            LGELVLFFIPC +GLM YK LFITEGWQL+  VVLGTICVMVFTAYSVHI FKLE  LK+
Sbjct  73   LGELVLFFIPCFIGLMKYKNLFITEGWQLIVVVVLGTICVMVFTAYSVHIGFKLERKLKQ  132

Query  129  HH  130
             H
Sbjct  133  RH  134


> N8Y946 Uncharacterized protein [Acinetobacter guillouiae NIPH 
991]
Length=146

 Score =  190 bits (483),  Expect = 9e-66
 Identities = 87/122 (71%), Positives = 105/122 (86%), Gaps = 0/122 (0%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            + ++ +QI LL+L WW+GS++Q+  NLPISA V+GLF+VLIGL++G+FKL WIK+GSDFI
Sbjct  13   IYKVTLQIGLLILIWWIGSIIQKQFNLPISAAVIGLFMVLIGLMTGIFKLNWIKSGSDFI  72

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            LGELVLFFIPC +GLM YK LFITEGWQL+  VVLGTICVMVFTAYSVHI FKLE  LK+
Sbjct  73   LGELVLFFIPCFIGLMKYKNLFITEGWQLIVVVVLGTICVMVFTAYSVHIGFKLERKLKQ  132

Query  129  HH  130
             H
Sbjct  133  RH  134


> A0A0Q7G3R2 LrgA family protein [Acinetobacter sp. Root1280]
Length=146

 Score =  190 bits (483),  Expect = 9e-66
 Identities = 87/122 (71%), Positives = 105/122 (86%), Gaps = 0/122 (0%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            + ++ +QI LL+L WW+GS++Q+  NLPISA V+GLF+VLIGL++G+FKL WIK+GSDFI
Sbjct  13   IYKVTLQIGLLILIWWIGSIIQKQFNLPISAAVIGLFMVLIGLMTGIFKLNWIKSGSDFI  72

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            LGELVLFFIPC +GLM YK LFITEGWQL+  VVLGTICVMVFTAYSVHI FKLE  LK+
Sbjct  73   LGELVLFFIPCFIGLMKYKNLFITEGWQLIVVVVLGTICVMVFTAYSVHIGFKLERKLKQ  132

Query  129  HH  130
             H
Sbjct  133  RH  134


> A0A1P8EGM0 CidA/LrgA family protein [Acinetobacter soli]
Length=142

 Score =  189 bits (481),  Expect = 2e-65
 Identities = 88/130 (68%), Positives = 108/130 (83%), Gaps = 0/130 (0%)

Query  4    SRGLYLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKT  63
            SR   L +I +QI LL++ WW+GSL+Q+   LPISAGV+GLFLVL+GLLSG FKL WIK+
Sbjct  3    SRYSVLAKISLQIGLLIMLWWIGSLIQKLFQLPISAGVIGLFLVLLGLLSGTFKLNWIKS  62

Query  64   GSDFILGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLE  123
            GSDFIL ELVLFF+PCVVGLMNYK LF++EG QL++AVVLGT+CVM+ T Y+VH+CFKLE
Sbjct  63   GSDFILSELVLFFVPCVVGLMNYKVLFLSEGLQLITAVVLGTVCVMLATVYTVHLCFKLE  122

Query  124  AWLKRHHRSG  133
             WL+   R G
Sbjct  123  QWLQHTFRFG  132


> A0A072CY02 Transporter [Acinetobacter sp. ETR1]
Length=146

 Score =  188 bits (477),  Expect = 7e-65
 Identities = 85/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            + ++++QI LL+L WW+ S++Q+  NLPISA V+GLF+VLIGL++G+FKL WIK+GSDFI
Sbjct  13   IYKVILQIGLLILIWWISSIIQKQFNLPISAAVIGLFMVLIGLMTGIFKLNWIKSGSDFI  72

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            LGELVLFFIPC +GLM YK LF+TEGWQL+  VVLGTICVMVFTAYSVHI FKLE  LK+
Sbjct  73   LGELVLFFIPCFIGLMKYKNLFMTEGWQLIVVVVLGTICVMVFTAYSVHIGFKLERKLKQ  132

Query  129  HH  130
             H
Sbjct  133  RH  134


> N9BNY5 Uncharacterized protein [Acinetobacter soli NIPH 2899]
Length=142

 Score =  187 bits (474),  Expect = 2e-64
 Identities = 87/130 (67%), Positives = 107/130 (82%), Gaps = 0/130 (0%)

Query  4    SRGLYLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKT  63
            SR   L +I +QI LL++ WW+GSL+Q+   LPI AGV+GLFLVL+GLLSG FKL WIK+
Sbjct  3    SRYSVLAKISLQIGLLIMLWWIGSLIQKLFQLPIPAGVIGLFLVLLGLLSGTFKLNWIKS  62

Query  64   GSDFILGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLE  123
            GSDFIL ELVLFF+PCVVGLMNYK LF++EG QL++AVVLGT+CVM+ T Y+VH+CFKLE
Sbjct  63   GSDFILSELVLFFVPCVVGLMNYKVLFLSEGLQLITAVVLGTVCVMLATVYTVHLCFKLE  122

Query  124  AWLKRHHRSG  133
             WL+   R G
Sbjct  123  QWLQHTLRFG  132


> A0A0M1I1H1 Murein hydrolase transporter LrgA [Acinetobacter sp. 
C15]
Length=142

 Score =  187 bits (474),  Expect = 2e-64
 Identities = 87/130 (67%), Positives = 107/130 (82%), Gaps = 0/130 (0%)

Query  4    SRGLYLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKT  63
            SR   L +I +QI LL++ WW+GSL+Q+   LPI AGV+GLFLVL+GLLSG FKL WIK+
Sbjct  3    SRYSVLAKISLQIGLLIMLWWIGSLIQKLFQLPIPAGVIGLFLVLLGLLSGTFKLNWIKS  62

Query  64   GSDFILGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLE  123
            GSDFIL ELVLFF+PCVVGLMNYK LF++EG QL++AVVLGT+CVM+ T Y+VH+CFKLE
Sbjct  63   GSDFILSELVLFFVPCVVGLMNYKVLFLSEGLQLITAVVLGTVCVMLATVYTVHLCFKLE  122

Query  124  AWLKRHHRSG  133
             WL+   R G
Sbjct  123  QWLQHTLRFG  132


> A0A241WGY7 CidA/LrgA family protein [Acinetobacter sp. ANC 3832]
Length=148

 Score =  186 bits (473),  Expect = 3e-64
 Identities = 84/120 (70%), Positives = 104/120 (87%), Gaps = 0/120 (0%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            + Q+ +Q+ +L++FWW+GS++Q   NLP+SA V+GLF+VLIGLLSGVFKLQWIK GSDFI
Sbjct  14   MTQVFLQVGILLMFWWIGSVIQSVFNLPVSAAVIGLFIVLIGLLSGVFKLQWIKAGSDFI  73

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            L ELVLFFIPC++GLM YK LF+TEGWQL+ +V LGTICVMVFTAYSVH+ FKLE  LK+
Sbjct  74   LAELVLFFIPCLIGLMKYKDLFLTEGWQLIISVFLGTICVMVFTAYSVHLGFKLETKLKQ  133


> Q6PST9 Holin-like protein CidA [Staphylococcus aureus]
Length=131

 Score = 73.2 bits (178),  Expect = 1e-20
 Identities = 38/125 (30%), Positives = 78/125 (62%), Gaps = 5/125 (4%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            ++++++Q+ ++++  ++G+ +Q+  +LP++  +VGLFL  + L   +  L W++ G++F+
Sbjct  7    IIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVEDGANFL  66

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            L  +V FFIP VVG+M+  +  IT  + L  AV++   C++  +  S +I  K+   +K 
Sbjct  67   LKTMVFFFIPSVVGIMDVAS-EITLNYILFFAVIIIGTCIVALS--SGYIAEKMS--VKH  121

Query  129  HHRSG  133
             HR G
Sbjct  122  KHRKG  126



Lambda      K        H        a         alpha
   0.336    0.148    0.491    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 172605


  Database: 1301350bfaa865d827e01e21955886ad.TrEMBL.fasta
    Posted date:  Sep 26, 2020  7:38 PM
  Number of letters in database: 2,003
  Number of sequences in database:  14



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40