ACIAD1674 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 6a7a4217d8c7ea949e54b6ee7afa7fa7.SwissProt.fasta
           23 sequences; 3,747 total letters



Query= ACIAD1674

Length=143
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  A7GR09 Holin-like protein CidA [Bacillus cytotoxicus (strain DS...  87.0    1e-25
  Q81Y27 Holin-like protein CidA 1 [Bacillus anthracis]               86.3    3e-25
  C1ENB1 Holin-like protein CidA [Bacillus cereus (strain 03BB102)]   85.9    4e-25
  B7HKL5 Holin-like protein CidA [Bacillus cereus (strain AH187)]     85.9    4e-25
  B9IUJ0 Holin-like protein CidA [Bacillus cereus (strain Q1)]        85.9    4e-25
  Q637F8 Holin-like protein CidA [Bacillus cereus (strain ZK / E3...  85.9    4e-25
  Q6HFD1 Holin-like protein CidA [Bacillus thuringiensis subsp. k...  85.9    4e-25
  B7HCE7 Holin-like protein CidA [Bacillus cereus (strain B4264)]     85.1    7e-25
  Q81AB0 Holin-like protein CidA 1 [Bacillus cereus (strain ATCC ...  85.1    7e-25
  C0H3T7 Putative integral membrane protein YxzK [Bacillus subtil...  76.6    1e-21
  Q5HL70 Holin-like protein CidA [Staphylococcus epidermidis (str...  74.7    7e-21
  Q8CR38 Holin-like protein CidA [Staphylococcus epidermidis (str...  74.7    7e-21
  P60646 Holin-like protein CidA [Staphylococcus aureus (strain N...  73.2    3e-20
  Q6G6D3 Holin-like protein CidA [Staphylococcus aureus (strain M...  73.2    3e-20
  A8Z3D9 Holin-like protein CidA [Staphylococcus aureus (strain U...  73.2    3e-20
  P60648 Holin-like protein CidA [Staphylococcus aureus (strain M...  73.2    3e-20
  P60647 Holin-like protein CidA [Staphylococcus aureus (strain N...  73.2    3e-20
  P39591 Holin-like protein CidA [Bacillus subtilis (strain 168)]     72.0    7e-20
  Q6GDQ7 Holin-like protein CidA [Staphylococcus aureus (strain M...  71.6    9e-20
  A7ZA61 Holin-like protein CidA [Bacillus velezensis (strain DSM...  71.2    1e-19
  P72358 Antiholin-like protein LrgA [Staphylococcus aureus (stra...  51.2    2e-12
  Q9LEM9 Acyl-lipid (9-3)-desaturase [Ceratodon purpureus]            35.0    3e-06
  S0EEY7 Efflux pump FUS6 [Gibberella fujikuroi (strain CBS 195.3...  34.7    4e-06


> A7GR09 Holin-like protein CidA [Bacillus cytotoxicus (strain 
DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)]
Length=121

 Score = 87.0 bits (214),  Expect = 1e-25
 Identities = 40/107 (37%), Positives = 63/107 (59%), Gaps = 0/107 (0%)

Query  15   QIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFILGELVL  74
            QI LL  F W G  + + ++LPI   ++G+FL+LI L   + K +WI+ G+DF+L EL+L
Sbjct  9    QILLLFCFAWTGEWIAKQVHLPIPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELIL  68

Query  75   FFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFK  121
            FFIP  V ++ YK      G  L+  +++ T+CV + T     +  K
Sbjct  69   FFIPSAVAVIRYKDTLSQYGIDLIFIIMISTLCVTLVTGILTELLLK  115


> Q81Y27 Holin-like protein CidA 1 [Bacillus anthracis]
Length=121

 Score = 86.3 bits (212),  Expect = 3e-25
 Identities = 40/107 (37%), Positives = 62/107 (58%), Gaps = 0/107 (0%)

Query  15   QIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFILGELVL  74
            QI LL  F W G  + +  +LPI   ++G+FL+LI L   + K +WI+ G+DF+L EL+L
Sbjct  9    QILLLFCFAWTGEWIAKQAHLPIPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELIL  68

Query  75   FFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFK  121
            FFIP  V ++ YK      G  L+  +++ T+CV + T     +  K
Sbjct  69   FFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLK  115


> C1ENB1 Holin-like protein CidA [Bacillus cereus (strain 03BB102)]
Length=121

 Score = 85.9 bits (211),  Expect = 4e-25
 Identities = 39/107 (36%), Positives = 62/107 (58%), Gaps = 0/107 (0%)

Query  15   QIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFILGELVL  74
            QI LL  F W G  + +  +LP+   ++G+FL+LI L   + K +WI+ G+DF+L EL+L
Sbjct  9    QILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELIL  68

Query  75   FFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFK  121
            FFIP  V ++ YK      G  L+  +++ T+CV + T     +  K
Sbjct  69   FFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLK  115


> B7HKL5 Holin-like protein CidA [Bacillus cereus (strain AH187)]
Length=121

 Score = 85.9 bits (211),  Expect = 4e-25
 Identities = 39/107 (36%), Positives = 62/107 (58%), Gaps = 0/107 (0%)

Query  15   QIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFILGELVL  74
            QI LL  F W G  + +  +LP+   ++G+FL+LI L   + K +WI+ G+DF+L EL+L
Sbjct  9    QILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELIL  68

Query  75   FFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFK  121
            FFIP  V ++ YK      G  L+  +++ T+CV + T     +  K
Sbjct  69   FFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLK  115


> B9IUJ0 Holin-like protein CidA [Bacillus cereus (strain Q1)]
Length=121

 Score = 85.9 bits (211),  Expect = 4e-25
 Identities = 39/107 (36%), Positives = 62/107 (58%), Gaps = 0/107 (0%)

Query  15   QIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFILGELVL  74
            QI LL  F W G  + +  +LP+   ++G+FL+LI L   + K +WI+ G+DF+L EL+L
Sbjct  9    QILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELIL  68

Query  75   FFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFK  121
            FFIP  V ++ YK      G  L+  +++ T+CV + T     +  K
Sbjct  69   FFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLK  115


> Q637F8 Holin-like protein CidA [Bacillus cereus (strain ZK / 
E33L)]
Length=121

 Score = 85.9 bits (211),  Expect = 4e-25
 Identities = 39/107 (36%), Positives = 62/107 (58%), Gaps = 0/107 (0%)

Query  15   QIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFILGELVL  74
            QI LL  F W G  + +  +LP+   ++G+FL+LI L   + K +WI+ G+DF+L EL+L
Sbjct  9    QILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELIL  68

Query  75   FFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFK  121
            FFIP  V ++ YK      G  L+  +++ T+CV + T     +  K
Sbjct  69   FFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLK  115


> Q6HFD1 Holin-like protein CidA [Bacillus thuringiensis subsp. 
konkukian (strain 97-27)]
Length=121

 Score = 85.9 bits (211),  Expect = 4e-25
 Identities = 39/107 (36%), Positives = 62/107 (58%), Gaps = 0/107 (0%)

Query  15   QIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFILGELVL  74
            QI LL  F W G  + +  +LP+   ++G+FL+LI L   + K +WI+ G+DF+L EL+L
Sbjct  9    QILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELIL  68

Query  75   FFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFK  121
            FFIP  V ++ YK      G  L+  +++ T+CV + T     +  K
Sbjct  69   FFIPSAVAVIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLK  115


> B7HCE7 Holin-like protein CidA [Bacillus cereus (strain B4264)]
Length=121

 Score = 85.1 bits (209),  Expect = 7e-25
 Identities = 38/107 (36%), Positives = 62/107 (58%), Gaps = 0/107 (0%)

Query  15   QIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFILGELVL  74
            QI LL  F W G  + +  +LP+   ++G+FL+LI L   + K +WI+ G+DF+L EL+L
Sbjct  9    QILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELIL  68

Query  75   FFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFK  121
            FFIP  V ++ Y+      G  L+  +++ T+CV + T     +  K
Sbjct  69   FFIPSAVAVIRYRDTLTQYGIDLILIIMISTLCVTLVTGLLTELLLK  115


> Q81AB0 Holin-like protein CidA 1 [Bacillus cereus (strain ATCC 
14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL 
B-3711)]
Length=121

 Score = 85.1 bits (209),  Expect = 7e-25
 Identities = 38/107 (36%), Positives = 62/107 (58%), Gaps = 0/107 (0%)

Query  15   QIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFILGELVL  74
            QI LL  F W G  + +  +LP+   ++G+FL+LI L   + K +WI+ G+DF+L EL+L
Sbjct  9    QILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELIL  68

Query  75   FFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFK  121
            FFIP  V ++ Y+      G  L+  +++ T+CV + T     +  K
Sbjct  69   FFIPSAVAVIRYRDTLTQYGIDLILIIMISTLCVTLVTGLLTELLLK  115


> C0H3T7 Putative integral membrane protein YxzK [Bacillus subtilis 
(strain 168)]
Length=134

 Score = 76.6 bits (187),  Expect = 1e-21
 Identities = 38/113 (34%), Positives = 67/113 (59%), Gaps = 0/113 (0%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            +++I++Q+ +L +F+ +G  +Q   +LP+S  +VGL L+LI L   +  +  I+ G+ F+
Sbjct  3    VIRIILQVLILYVFFMIGEAIQHLFHLPVSGSIVGLVLLLICLGLRIVPVSIIEDGAGFL  62

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFK  121
            L  L L FIP + G++NY +L    G  LL  VVL TI  ++   ++  +  K
Sbjct  63   LSFLPLLFIPAMTGVINYPSLISFNGLMLLITVVLSTIVTIIAAGFASQLLEK  115


> Q5HL70 Holin-like protein CidA [Staphylococcus epidermidis (strain 
ATCC 35984 / RP62A)]
Length=130

 Score = 74.7 bits (182),  Expect = 7e-21
 Identities = 33/107 (31%), Positives = 65/107 (61%), Gaps = 0/107 (0%)

Query  8    YLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDF  67
            +++++++Q+AL+ML  ++G+ +Q+ L++P++  +VGL L  + L   +    WI  G+DF
Sbjct  6    FVIKLILQLALIMLITFIGTEVQKLLHIPLAGSIVGLMLFFLLLQFKIVPESWINVGADF  65

Query  68   ILGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAY  114
            +L  +V FFIP VVG+M+  +            +++GT  V + + Y
Sbjct  66   LLKTMVFFFIPSVVGIMDVASNITMNYILFFIVIIIGTCLVALSSGY  112


> Q8CR38 Holin-like protein CidA [Staphylococcus epidermidis (strain 
ATCC 12228 / FDA PCI 1200)]
Length=130

 Score = 74.7 bits (182),  Expect = 7e-21
 Identities = 33/107 (31%), Positives = 65/107 (61%), Gaps = 0/107 (0%)

Query  8    YLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDF  67
            +++++++Q+AL+ML  ++G+ +Q+ L++P++  +VGL L  + L   +    WI  G+DF
Sbjct  6    FVIKLILQLALIMLITFIGTEVQKLLHIPLAGSIVGLMLFFLLLQFKIVPESWINVGADF  65

Query  68   ILGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAY  114
            +L  +V FFIP VVG+M+  +            +++GT  V + + Y
Sbjct  66   LLKTMVFFFIPSVVGIMDVASNITMNYILFFIVIIIGTCLVALSSGY  112


> P60646 Holin-like protein CidA [Staphylococcus aureus (strain 
N315)]
Length=131

 Score = 73.2 bits (178),  Expect = 3e-20
 Identities = 38/125 (30%), Positives = 78/125 (62%), Gaps = 5/125 (4%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            ++++++Q+ ++++  ++G+ +Q+  +LP++  +VGLFL  + L   +  L W++ G++F+
Sbjct  7    IIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVEDGANFL  66

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            L  +V FFIP VVG+M+  +  IT  + L  AV++   C++  +  S +I  K+   +K 
Sbjct  67   LKTMVFFFIPSVVGIMDVAS-EITLNYILFFAVIIIGTCIVALS--SGYIAEKMS--VKH  121

Query  129  HHRSG  133
             HR G
Sbjct  122  KHRKG  126


> Q6G6D3 Holin-like protein CidA [Staphylococcus aureus (strain 
MSSA476)]
Length=131

 Score = 73.2 bits (178),  Expect = 3e-20
 Identities = 38/125 (30%), Positives = 78/125 (62%), Gaps = 5/125 (4%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            ++++++Q+ ++++  ++G+ +Q+  +LP++  +VGLFL  + L   +  L W++ G++F+
Sbjct  7    IIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVEDGANFL  66

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            L  +V FFIP VVG+M+  +  IT  + L  AV++   C++  +  S +I  K+   +K 
Sbjct  67   LKTMVFFFIPSVVGIMDVAS-EITLNYILFFAVIIIGTCIVALS--SGYIAEKMS--VKH  121

Query  129  HHRSG  133
             HR G
Sbjct  122  KHRKG  126


> A8Z3D9 Holin-like protein CidA [Staphylococcus aureus (strain 
USA300 / TCH1516)]
Length=131

 Score = 73.2 bits (178),  Expect = 3e-20
 Identities = 38/125 (30%), Positives = 78/125 (62%), Gaps = 5/125 (4%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            ++++++Q+ ++++  ++G+ +Q+  +LP++  +VGLFL  + L   +  L W++ G++F+
Sbjct  7    IIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVEDGANFL  66

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            L  +V FFIP VVG+M+  +  IT  + L  AV++   C++  +  S +I  K+   +K 
Sbjct  67   LKTMVFFFIPSVVGIMDVAS-EITLNYILFFAVIIIGTCIVALS--SGYIAEKMS--VKH  121

Query  129  HHRSG  133
             HR G
Sbjct  122  KHRKG  126


> P60648 Holin-like protein CidA [Staphylococcus aureus (strain 
MW2)]
Length=131

 Score = 73.2 bits (178),  Expect = 3e-20
 Identities = 38/125 (30%), Positives = 78/125 (62%), Gaps = 5/125 (4%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            ++++++Q+ ++++  ++G+ +Q+  +LP++  +VGLFL  + L   +  L W++ G++F+
Sbjct  7    IIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVEDGANFL  66

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            L  +V FFIP VVG+M+  +  IT  + L  AV++   C++  +  S +I  K+   +K 
Sbjct  67   LKTMVFFFIPSVVGIMDVAS-EITLNYILFFAVIIIGTCIVALS--SGYIAEKMS--VKH  121

Query  129  HHRSG  133
             HR G
Sbjct  122  KHRKG  126


> P60647 Holin-like protein CidA [Staphylococcus aureus (strain 
NCTC 8325 / PS 47)]
Length=131

 Score = 73.2 bits (178),  Expect = 3e-20
 Identities = 38/125 (30%), Positives = 78/125 (62%), Gaps = 5/125 (4%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            ++++++Q+ ++++  ++G+ +Q+  +LP++  +VGLFL  + L   +  L W++ G++F+
Sbjct  7    IIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVEDGANFL  66

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            L  +V FFIP VVG+M+  +  IT  + L  AV++   C++  +  S +I  K+   +K 
Sbjct  67   LKTMVFFFIPSVVGIMDVAS-EITLNYILFFAVIIIGTCIVALS--SGYIAEKMS--VKH  121

Query  129  HHRSG  133
             HR G
Sbjct  122  KHRKG  126


> P39591 Holin-like protein CidA [Bacillus subtilis (strain 168)]
Length=128

 Score = 72.0 bits (175),  Expect = 7e-20
 Identities = 38/104 (37%), Positives = 63/104 (61%), Gaps = 0/104 (0%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            L+  VIQIALL +F  + + +   L++ I   ++G+ ++   L   + KL+WI+ G+ ++
Sbjct  4    LLLTVIQIALLFIFARLINWVTALLHINIPGSIIGIVILFTLLHFNIIKLEWIELGAAWL  63

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFT  112
            LGEL+LFFIP  VG++ Y  +    G  +L  V++ T  VMV T
Sbjct  64   LGELLLFFIPSAVGVIEYGDIMSKFGVSILLVVIISTFVVMVST  107


> Q6GDQ7 Holin-like protein CidA [Staphylococcus aureus (strain 
MRSA252)]
Length=131

 Score = 71.6 bits (174),  Expect = 9e-20
 Identities = 38/132 (29%), Positives = 79/132 (60%), Gaps = 11/132 (8%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            ++++++Q+ ++++  ++G+ +Q+  +LP++  +VGLFL  + L   +  L W++ G++F+
Sbjct  7    IIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVEDGANFL  66

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKLEAWLKR  128
            L  +V FFIP VVG+M+  +  IT  + L  AV++   C++  +  S +I  K+      
Sbjct  67   LKTMVFFFIPSVVGIMDVAS-EITLNYILFFAVIIIGTCIVALS--SGYIAEKMSV----  119

Query  129  HHRSGHQQRSGV  140
                 H+QR G+
Sbjct  120  ----KHKQRKGI  127


> A7ZA61 Holin-like protein CidA [Bacillus velezensis (strain DSM 
23117 / BGSC 10A6 / FZB42)]
Length=128

 Score = 71.2 bits (173),  Expect = 1e-19
 Identities = 39/104 (38%), Positives = 63/104 (61%), Gaps = 0/104 (0%)

Query  9    LVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFI  68
            L+  VIQIALL +F  + + +   L++ I   ++G+ ++   L   + KL+WI+ G+ ++
Sbjct  4    LLLTVIQIALLFIFARLINWVTAALHINIPGSIIGIVILFTLLHFKIIKLEWIELGAAWL  63

Query  69   LGELVLFFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFT  112
            LGEL+LFFIP  VG++ Y  +    G  +L  VV+ T  VMV T
Sbjct  64   LGELLLFFIPSAVGVIEYGDIMSKFGVSILLVVVISTFVVMVST  107


> P72358 Antiholin-like protein LrgA [Staphylococcus aureus (strain 
NCTC 8325 / PS 47)]
Length=147

 Score = 51.2 bits (121),  Expect = 2e-12
 Identities = 23/108 (21%), Positives = 57/108 (53%), Gaps = 0/108 (0%)

Query  15   QIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSGVFKLQWIKTGSDFILGELVL  74
            Q+ ++ L  +V  +++ ++ +P+ A V+GL L+ + L +G  KL  ++     +   + L
Sbjct  18   QVIVIALVLFVSKIIESFMPIPMPASVIGLVLLFVLLCTGAVKLGEVEKVGTTLTNNIGL  77

Query  75   FFIPCVVGLMNYKTLFITEGWQLLSAVVLGTICVMVFTAYSVHICFKL  122
             F+P  + ++N   +     + ++  +++ TI +++ T Y   I  K+
Sbjct  78   LFVPAGISVVNSLGVISQAPFLIIGLIIVSTILLLICTGYVTQIIMKV  125


> Q9LEM9 Acyl-lipid (9-3)-desaturase [Ceratodon purpureus]
Length=520

 Score = 35.0 bits (79),  Expect = 3e-06
 Identities = 21/79 (27%), Positives = 43/79 (54%), Gaps = 6/79 (8%)

Query  4    SRGLYLVQIVIQIALLMLFWWVGSLLQRWLNLPISAGVVGLFLVLIGLLSG------VFK  57
            S+  YL + +I ++++     + SL + +  + +SA ++GLF+   G LS       VF+
Sbjct  199  SKSYYLFKTLINVSIVATSIAIISLYKSYRAVLLSASLMGLFIQQCGWLSHDFLHHQVFE  258

Query  58   LQWIKTGSDFILGELVLFF  76
             +W+     +++G +VL F
Sbjct  259  TRWLNDVVGYVVGNVVLGF  277


> S0EEY7 Efflux pump FUS6 [Gibberella fujikuroi (strain CBS 195.34 
/ IMI 58289 / NRRL A-6831)]
Length=555

 Score = 34.7 bits (78),  Expect = 4e-06
 Identities = 29/90 (32%), Positives = 44/90 (49%), Gaps = 12/90 (13%)

Query  32   WLNLPISAGV----VGLFLVLIGLLSGVFKLQWIKT---GSDFILGELVLFFIPCVVGLM  84
            ++NLPI AGV    +GLFL L    SG FK Q  +    GS  ++G +    +    G  
Sbjct  189  YINLPI-AGVSLVALGLFLKLSRPPSGTFKEQMSRIDWGGSVLLIGSVTSIVLALSWGGS  247

Query  85   NYKTLFITEGWQLLSAVVLGTICVMVFTAY  114
             +       GWQ +  +V+G + ++ F AY
Sbjct  248  EHPW----SGWQTIVPLVIGLLALVAFFAY  273


 Score = 16.2 bits (30),  Expect = 5.5
 Identities = 6/13 (46%), Positives = 9/13 (69%), Gaps = 0/13 (0%)

Query  94   GWQLLSAVVLGTI  106
            G+Q+L  V  GT+
Sbjct  390  GFQILFGVGTGTV  402


 Score = 15.8 bits (29),  Expect = 7.3
 Identities = 8/29 (28%), Positives = 16/29 (55%), Gaps = 0/29 (0%)

Query  47   VLIGLLSGVFKLQWIKTGSDFILGELVLF  75
            VL+ +  G+F L   ++ +   +G  +LF
Sbjct  367  VLMSIACGLFTLLDAQSSTGRWVGFQILF  395


 Score = 15.8 bits (29),  Expect = 7.3
 Identities = 6/21 (29%), Positives = 13/21 (62%), Gaps = 0/21 (0%)

Query  57   KLQWIKTGSDFILGELVLFFI  77
            K+ W  + +  +LG ++ FF+
Sbjct  501  KVVWQVSLAFCLLGFILCFFV  521



Lambda      K        H        a         alpha
   0.336    0.148    0.491    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 306976


  Database: 6a7a4217d8c7ea949e54b6ee7afa7fa7.SwissProt.fasta
    Posted date:  Sep 26, 2020  9:04 PM
  Number of letters in database: 3,747
  Number of sequences in database:  23



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40