ACIAD1666 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 6b96e054d919929dfe55003dd0f4d932.TrEMBL.fasta
           12 sequences; 1,715 total letters



Query= ACIAD1666

Length=147
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FBQ1 Uncharacterized protein [Acinetobacter baylyi (strain AT...   288    4e-104
  A0A241WFX9 Uncharacterized protein [Acinetobacter sp. ANC 3832]      142    7e-47 
  A0A2S9EQ45 Uncharacterized protein [Acinetobacter sp. MYb10]         138    2e-45 
  A0A2U3N3I3 Uncharacterized protein [Acinetobacter sp. KPC-SM-21]     138    2e-45 
  A0A0Q7G7Q3 Uncharacterized protein [Acinetobacter sp. Root1280]      137    3e-45 
  N9BFU2 Uncharacterized protein [Acinetobacter johnsonii ANC 3681]    137    7e-45 
  A0A077L2I3 Uncharacterized protein [Acinetobacter guillouiae]        136    9e-45 
  A0A072CRA4 Uncharacterized protein [Acinetobacter sp. ETR1]          136    9e-45 
  A0A0A8TRY6 Uncharacterized protein [Acinetobacter bereziniae]        136    1e-44 
  L9MFR4 Uncharacterized protein [Acinetobacter sp. WC-743]            136    1e-44 
  N9DFR1 Uncharacterized protein [Acinetobacter bereziniae LMG 10...   136    1e-44 
  N8Y9J6 Uncharacterized protein [Acinetobacter guillouiae NIPH 991]   135    2e-44 


> Q6FBQ1 Uncharacterized protein [Acinetobacter baylyi (strain 
ATCC 33305 / BD413 / ADP1)]
Length=146

 Score =  288 bits (736),  Expect = 4e-104
 Identities = 146/146 (100%), Positives = 146/146 (100%), Gaps = 0/146 (0%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI
Sbjct  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK
Sbjct  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120

Query  121  LFKIQILLLIIQYILLIVLIGLFSEY  146
            LFKIQILLLIIQYILLIVLIGLFSEY
Sbjct  121  LFKIQILLLIIQYILLIVLIGLFSEY  146


> A0A241WFX9 Uncharacterized protein [Acinetobacter sp. ANC 3832]
Length=144

 Score =  142 bits (357),  Expect = 7e-47
 Identities = 73/140 (52%), Positives = 96/140 (69%), Gaps = 2/140 (1%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            MNM + VLSRLL  T  LL SGYVAF +S   +      SL +W+L+ L F+   IHHYI
Sbjct  1    MNMKFFVLSRLLSSTTTLLASGYVAFALSIISIQLKAWQSLTFWILICLVFILCAIHHYI  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            S+RVKFD D+L +L Q   S++ + + LTQ  D ++L  KLMP +K GR WD RF+GCLK
Sbjct  61   SIRVKFDADILSTLAQQ--SKQQNENDLTQALDHSLLYFKLMPQNKAGRDWDLRFQGCLK  118

Query  121  LFKIQILLLIIQYILLIVLI  140
            LFKIQ+  +++QYI+LI LI
Sbjct  119  LFKIQMTFVVMQYIVLITLI  138


 Score = 16.5 bits (31),  Expect = 1.6
 Identities = 7/14 (50%), Positives = 10/14 (71%), Gaps = 0/14 (0%)

Query  41   LQYWLLLTLNFLAL  54
            +QY +L+TL F  L
Sbjct  129  MQYIVLITLIFKLL  142


> A0A2S9EQ45 Uncharacterized protein [Acinetobacter sp. MYb10]
Length=142

 Score =  138 bits (348),  Expect = 2e-45
 Identities = 66/140 (47%), Positives = 96/140 (69%), Gaps = 2/140 (1%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            M M++ V+++LL  T  +LLSGY+AF +S   +LF G  S+++W  + +  L   +HHY+
Sbjct  1    MKMNFYVVAQLLSATTAILLSGYLAFALSIFAILFKGWQSIEFWTFIVITLLLSGLHHYL  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            S RVKFD  L++ + +   SQ  S + LT QFDQT++ +KLMP SK GR W  RF GC K
Sbjct  61   SFRVKFDAQLIKMIARE--SQTESIENLTLQFDQTLMSMKLMPASKAGRDWSQRFAGCFK  118

Query  121  LFKIQILLLIIQYILLIVLI  140
            L K+QI LL+IQY++L++LI
Sbjct  119  LLKLQIALLLIQYLVLMILI  138


> A0A2U3N3I3 Uncharacterized protein [Acinetobacter sp. KPC-SM-21]
Length=145

 Score =  138 bits (347),  Expect = 2e-45
 Identities = 64/140 (46%), Positives = 100/140 (71%), Gaps = 1/140 (1%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            MN ++ +LS+LL  T  LL SGY+AF +S   ++  G   L+ W+   L+ + + +H ++
Sbjct  1    MNYNFFILSKLLSNTRSLLFSGYIAFSLSIICIILKGWQFLELWIYTFLSIILVALHQFV  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            S+ VKFD D+L  + +  L Q +++ QLT+Q D +++  KLMP +KTGR+W+ RF+GCLK
Sbjct  61   SILVKFDADILDFISKLHL-QNINNKQLTEQLDSSLIYFKLMPKNKTGRNWNTRFQGCLK  119

Query  121  LFKIQILLLIIQYILLIVLI  140
            LFK+QI+LL+IQYI+LI+LI
Sbjct  120  LFKLQIILLVIQYIMLIILI  139


> A0A0Q7G7Q3 Uncharacterized protein [Acinetobacter sp. Root1280]
Length=142

 Score =  137 bits (346),  Expect = 3e-45
 Identities = 66/140 (47%), Positives = 95/140 (68%), Gaps = 2/140 (1%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            M M++ V+++LL  T  +LLSGY+AF +S   +LF G  S ++W  + +  L   +HHY+
Sbjct  1    MKMNFYVVAQLLSATTAILLSGYLAFALSIFAILFKGWQSFEFWTFIVITLLLSGLHHYL  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            S RVKFD  L++ + +   SQ  S + LT QFDQT++ +KLMP SK GR W  RF GC K
Sbjct  61   SFRVKFDAQLIKMIARE--SQTESIENLTLQFDQTLMSMKLMPASKAGRDWSQRFAGCFK  118

Query  121  LFKIQILLLIIQYILLIVLI  140
            L K+QI LL+IQY++L++LI
Sbjct  119  LLKLQIALLLIQYLVLMILI  138


> N9BFU2 Uncharacterized protein [Acinetobacter johnsonii ANC 3681]
Length=144

 Score =  137 bits (344),  Expect = 7e-45
 Identities = 67/140 (48%), Positives = 97/140 (69%), Gaps = 2/140 (1%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            M MH+ V ++LL  T  LL SGYVAF+++   +L     SL++W+L+ L F  + I HY+
Sbjct  1    MKMHFYVAAKLLSATYGLLFSGYVAFVLTILAILLKSWQSLEFWILIFLCFGLMAIQHYL  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            +LR+KFD +L++ + Q   S  V+ + LTQQFDQ++L  KL+P SK GR W  RF GC +
Sbjct  61   ALRLKFDAELIEVIAQQ--SDTVAIEDLTQQFDQSLLQFKLIPKSKVGRDWSLRFAGCFR  118

Query  121  LFKIQILLLIIQYILLIVLI  140
            LFK+QI +L IQYI+L++LI
Sbjct  119  LFKLQITVLFIQYIVLVILI  138


> A0A077L2I3 Uncharacterized protein [Acinetobacter guillouiae]
Length=142

 Score =  136 bits (343),  Expect = 9e-45
 Identities = 65/140 (46%), Positives = 95/140 (68%), Gaps = 2/140 (1%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            M M++ V+++LL  T  +LLSGY+AF +S   +LF G  S ++W  + +  L   +HHY+
Sbjct  1    MKMNFYVVAQLLSATTAILLSGYLAFSLSIFAILFKGWQSFEFWTFIVITLLLSGLHHYL  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            S +VKFD  L++ + +   SQ  S + LT QFDQT++ +KLMP SK GR W  RF GC K
Sbjct  61   SFKVKFDAQLIKMIARE--SQTESIENLTLQFDQTLMSMKLMPASKAGRDWSQRFAGCFK  118

Query  121  LFKIQILLLIIQYILLIVLI  140
            L K+QI LL++QY++LI+LI
Sbjct  119  LLKLQIALLLLQYLVLIILI  138


> A0A072CRA4 Uncharacterized protein [Acinetobacter sp. ETR1]
Length=142

 Score =  136 bits (343),  Expect = 9e-45
 Identities = 66/140 (47%), Positives = 94/140 (67%), Gaps = 2/140 (1%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            M M++ V+++LL  T  +LLSGY+AF +S   +LF G  S ++W  + +  L    HHY+
Sbjct  1    MKMNFYVVAQLLSVTTAILLSGYLAFALSIFAILFKGWQSFEFWAFIVITLLLSGFHHYL  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            S RVKFD  L++ + +   SQ  S + LT QFDQT++ +KLMP SK GR W  RF GC K
Sbjct  61   SFRVKFDAQLIKMIARE--SQTESIENLTLQFDQTLMSMKLMPASKAGRDWSQRFAGCFK  118

Query  121  LFKIQILLLIIQYILLIVLI  140
            L K+QI LL+IQY++L++LI
Sbjct  119  LLKLQIALLLIQYLVLMILI  138


> A0A0A8TRY6 Uncharacterized protein [Acinetobacter bereziniae]
Length=142

 Score =  136 bits (342),  Expect = 1e-44
 Identities = 64/140 (46%), Positives = 98/140 (70%), Gaps = 2/140 (1%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            M M + ++++LL  T  LLLSGYVAF +S   +LF G  +++ W+ + +  L + +HHY+
Sbjct  1    MKMKFFIVAKLLSATGGLLLSGYVAFALSIFAILFKGWQTIELWIFIVITLLLMAVHHYL  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            S RVKFD +L++ L     S+  S + LTQQFDQ++L++KL+P +K GR W  RF GC +
Sbjct  61   SFRVKFDAELIEMLAIQ--SRADSIEHLTQQFDQSLLEMKLLPQNKVGRDWTLRFAGCFR  118

Query  121  LFKIQILLLIIQYILLIVLI  140
            L K+QI L++IQY++LI+LI
Sbjct  119  LIKLQIALVLIQYLVLIILI  138


> L9MFR4 Uncharacterized protein [Acinetobacter sp. WC-743]
Length=142

 Score =  136 bits (342),  Expect = 1e-44
 Identities = 64/140 (46%), Positives = 98/140 (70%), Gaps = 2/140 (1%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            M M + ++++LL  T  LLLSGYVAF +S   +LF G  +++ W+ + +  L + +HHY+
Sbjct  1    MKMKFFIVAKLLSATGGLLLSGYVAFALSIFAILFKGWQTIELWIFIVITLLLMAVHHYL  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            S RVKFD +L++ L     S+  S + LTQQFDQ++L++KL+P +K GR W  RF GC +
Sbjct  61   SFRVKFDAELIEMLAIQ--SRADSIEHLTQQFDQSLLEMKLLPQNKVGRDWTLRFAGCFR  118

Query  121  LFKIQILLLIIQYILLIVLI  140
            L K+QI L++IQY++LI+LI
Sbjct  119  LIKLQIALVLIQYLVLIILI  138


> N9DFR1 Uncharacterized protein [Acinetobacter bereziniae LMG 
1003 = CIP 70.12]
Length=142

 Score =  136 bits (342),  Expect = 1e-44
 Identities = 64/140 (46%), Positives = 98/140 (70%), Gaps = 2/140 (1%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            M M + ++++LL  T  LLLSGYVAF +S   +LF G  +++ W+ + +  L + +HHY+
Sbjct  1    MKMKFFIVAKLLSATGGLLLSGYVAFALSIFAILFKGWQTIELWIFIVITLLLMAVHHYL  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            S RVKFD +L++ L     S+  S + LTQQFDQ++L++KL+P +K GR W  RF GC +
Sbjct  61   SFRVKFDAELIEMLAIQ--SRADSIEHLTQQFDQSLLEMKLLPQNKVGRDWTLRFAGCFR  118

Query  121  LFKIQILLLIIQYILLIVLI  140
            L K+QI L++IQY++LI+LI
Sbjct  119  LIKLQIALVLIQYLVLIILI  138


> N8Y9J6 Uncharacterized protein [Acinetobacter guillouiae NIPH 
991]
Length=142

 Score =  135 bits (340),  Expect = 2e-44
 Identities = 65/140 (46%), Positives = 94/140 (67%), Gaps = 2/140 (1%)

Query  1    MNMHWIVLSRLLGQTNYLLLSGYVAFIVSTTLLLFYGASSLQYWLLLTLNFLALFIHHYI  60
            M M++ V+++LL  T  +LLSGY+A  +S   +LF G  S ++W  + +  L   +HHY+
Sbjct  1    MKMNFYVVAQLLSATTAILLSGYLALALSIFAILFKGWQSFEFWTFIVITLLLSGLHHYL  60

Query  61   SLRVKFDGDLLQSLLQYQLSQKVSSDQLTQQFDQTMLDLKLMPVSKTGRSWDNRFKGCLK  120
            S RVKFD  L++ + +   SQ  S + LT QFDQT++ +KLMP SK GR W  RF GC K
Sbjct  61   SFRVKFDAQLIKMIARE--SQTESIENLTLQFDQTLMSMKLMPASKAGRDWSQRFAGCFK  118

Query  121  LFKIQILLLIIQYILLIVLI  140
            L K+QI LL+IQY++L++LI
Sbjct  119  LLKLQIALLLIQYLVLMILI  138



Lambda      K        H        a         alpha
   0.335    0.147    0.442    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 153065


  Database: 6b96e054d919929dfe55003dd0f4d932.TrEMBL.fasta
    Posted date:  Sep 19, 2020  1:23 PM
  Number of letters in database: 1,715
  Number of sequences in database:  12



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40