ACIAD1558 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: d6ae12508a44223515bdfb0f90a46e6a.TrEMBL.fasta
           30 sequences; 8,937 total letters



Query= ACIAD1558

Length=215
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FC03 Putative glycosyl transferase related protein [Acinetoba...   441    8e-162
  C0VI87 Glycosyltransferase, group 2 family protein [Acinetobact...   406    8e-148
  A0A239RY89 Putative glycosyl transferase [Acinetobacter johnsonii]   405    2e-147
  A0A009Y6P7 Glycosyl transferase 2 family protein [Acinetobacter...   405    2e-147
  D4XPV8 Glycosyltransferase, group 2 family protein [Acinetobact...   405    2e-147
  A0A1T1JDN7 Glycosyl transferase [Acinetobacter sp. MF4642]           405    2e-147
  A0A0M3AGA2 Glycosyl transferase [Acinetobacter sp. AG1]              404    3e-147
  A0A0M1HU68 Glycosyl transferase [Acinetobacter sp. C15]              404    5e-147
  N9S120 Glyco_trans_2-like domain-containing protein [Acinetobac...   402    2e-146
  N9BCJ5 Glyco_trans_2-like domain-containing protein [Acinetobac...   402    3e-146
  N9DBD5 Glyco_trans_2-like domain-containing protein [Acinetobac...   402    3e-146
  A0A1T1JNK2 Glycosyl transferase [Acinetobacter sp. MF4640]           401    5e-146
  N9U9C0 Glyco_trans_2-like domain-containing protein [Acinetobac...   401    5e-146
  D0S9Q1 Glycosyltransferase, group 2 family protein [Acinetobact...   401    5e-146
  A0A2N6V7U8 Glycosyl transferase [Acinetobacter ursingii]             401    5e-146
  A0A0U3T642 Glycosyl transferase [Acinetobacter johnsonii XBB1]       401    5e-146
  A0A1R7QGY1 Putative glycosyl transferase [Acinetobacter johnsonii]   401    5e-146
  O06035 EpsG [Lactococcus lactis subsp. cremoris]                    48.9    4e-10 
  Q9RG45 Cps1J [Streptococcus suis]                                   48.1    8e-10 
  A0A0H3JPC6 Poly(ribitol-phosphate) beta-N-acetylglucosaminyltra...  47.8    1e-09 
  Q1PSV5 Lgt3 [Moraxella catarrhalis]                                 47.0    2e-09 
  Q2QCA5 Lgt3 [Moraxella catarrhalis]                                 47.0    2e-09 
  Q5DIA0 Lgt3 [Moraxella catarrhalis]                                 47.0    2e-09 
  Q0ZRE9 Lgt3 [Moraxella catarrhalis]                                 47.0    2e-09 
  Q9RG44 Cps1K [Streptococcus suis]                                   46.6    2e-09 
  Q9X4V5 Cps2K [Streptococcus suis]                                   46.2    3e-09 
  Q2QCA9 Glycosyl transferase 2 family protein [Moraxella catarrh...  45.4    8e-09 
  O88085 Putative glycosyl transferase [Enterococcus faecalis]        44.3    1e-08 
  B5A7L8 Putative glycosyltransferase [Streptococcus parasanguinis]   44.3    1e-08 
  Q56046 EpsI [Streptococcus thermophilus]                            43.9    2e-08 


> Q6FC03 Putative glycosyl transferase related protein [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=214

 Score =  441 bits (1135),  Expect = 8e-162
 Identities = 214/214 (100%), Positives = 214/214 (100%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI
Sbjct  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> C0VI87 Glycosyltransferase, group 2 family protein [Acinetobacter 
sp. ATCC 27244]
Length=214

 Score =  406 bits (1043),  Expect = 8e-148
 Identities = 192/214 (90%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+QAI H GH QVEILVVLDSCTDQS  +V+SHQ+NW+
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIEQAIHHIGHSQVEILVVLDSCTDQSLMIVKSHQMNWL  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD MDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDRMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> A0A239RY89 Putative glycosyl transferase [Acinetobacter johnsonii]
Length=214

 Score =  405 bits (1040),  Expect = 2e-147
 Identities = 192/214 (90%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+ AIQH GH QVEILVVLDSCTDQS  +V+SHQ+NW+
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIKHAIQHIGHGQVEILVVLDSCTDQSLMIVKSHQMNWL  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD MDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> A0A009Y6P7 Glycosyl transferase 2 family protein [Acinetobacter 
sp. 479375]
Length=214

 Score =  405 bits (1040),  Expect = 2e-147
 Identities = 192/214 (90%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+ AIQH GH QVEILVVLDSCTDQS  +V+SHQ+NW+
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIKHAIQHIGHGQVEILVVLDSCTDQSLMIVKSHQMNWL  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD MDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> D4XPV8 Glycosyltransferase, group 2 family protein [Acinetobacter 
haemolyticus ATCC 19194]
Length=214

 Score =  405 bits (1040),  Expect = 2e-147
 Identities = 192/214 (90%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+ AIQH GH QVEILVVLDSCTDQS  +V+SHQ+NW+
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIKHAIQHIGHGQVEILVVLDSCTDQSLMIVKSHQMNWL  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD MDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> A0A1T1JDN7 Glycosyl transferase [Acinetobacter sp. MF4642]
Length=214

 Score =  405 bits (1040),  Expect = 2e-147
 Identities = 192/214 (90%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+ AIQH GH QVEILVVLDSCTDQS  +V+SHQ+NW+
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIKHAIQHIGHGQVEILVVLDSCTDQSLMIVKSHQMNWL  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD MDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> A0A0M3AGA2 Glycosyl transferase [Acinetobacter sp. AG1]
Length=214

 Score =  404 bits (1039),  Expect = 3e-147
 Identities = 192/214 (90%), Positives = 203/214 (95%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+QAIQ+ GH QVEILVVLDSCTDQS  +V+SHQ+NW+
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIEQAIQNIGHCQVEILVVLDSCTDQSLMIVKSHQMNWL  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGK RDLGIRQLIDQGV WVACTDADTIVD DW+LCQMLHQPTDAICG+V LDD
Sbjct  61   ECNFACVGKTRDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMLHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYLAHYQD MDHQHIHGANLSFS EAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLAHYQDRMDHQHIHGANLSFSTEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> A0A0M1HU68 Glycosyl transferase [Acinetobacter sp. C15]
Length=214

 Score =  404 bits (1038),  Expect = 5e-147
 Identities = 192/214 (90%), Positives = 203/214 (95%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+QAIQ+ GH QV+ILVVLDSCTDQS  +V+SHQ+NWI
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIEQAIQYIGHGQVKILVVLDSCTDQSLMIVKSHQMNWI  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD MDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> N9S120 Glyco_trans_2-like domain-containing protein [Acinetobacter 
ursingii NIPH 706]
Length=214

 Score =  402 bits (1034),  Expect = 2e-146
 Identities = 191/214 (89%), Positives = 203/214 (95%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+QAIQ+ GH QV+ILVVLDSCTDQS  +V+SHQ+NWI
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIEQAIQYIGHGQVKILVVLDSCTDQSLMIVKSHQMNWI  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD +W+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPEWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD MDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> N9BCJ5 Glyco_trans_2-like domain-containing protein [Acinetobacter 
johnsonii ANC 3681]
Length=214

 Score =  402 bits (1033),  Expect = 3e-146
 Identities = 191/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+QA Q+ GH QV+ILVVLDSCTDQS  +V+SHQ+NWI
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIEQATQYIGHGQVKILVVLDSCTDQSLMIVKSHQMNWI  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD MDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> N9DBD5 Glyco_trans_2-like domain-containing protein [Acinetobacter 
ursingii ANC 3649]
Length=214

 Score =  402 bits (1033),  Expect = 3e-146
 Identities = 191/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+ AIQ+ GH QV+ILVVLDSCTDQS  +V+SHQ+NWI
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIEHAIQYIGHGQVKILVVLDSCTDQSLMIVKSHQMNWI  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD MDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> A0A1T1JNK2 Glycosyl transferase [Acinetobacter sp. MF4640]
Length=214

 Score =  401 bits (1031),  Expect = 5e-146
 Identities = 190/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+ AIQH GH QVEILVVLDSCTDQS  +V+SHQ+NW+
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIKHAIQHIGHGQVEILVVLDSCTDQSLMIVKSHQMNWL  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD M+HQHIHGANLSFSAEAYI+AGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMNHQHIHGANLSFSAEAYIKAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> N9U9C0 Glyco_trans_2-like domain-containing protein [Acinetobacter 
sp. CIP 102143]
Length=214

 Score =  401 bits (1031),  Expect = 5e-146
 Identities = 190/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+ AIQH GH QVEILVVLDSCTDQS  +V+SHQ+NW+
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIKHAIQHIGHGQVEILVVLDSCTDQSLMIVKSHQMNWL  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD M+HQHIHGANLSFSAEAYI+AGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMNHQHIHGANLSFSAEAYIKAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> D0S9Q1 Glycosyltransferase, group 2 family protein [Acinetobacter 
johnsonii SH046]
Length=214

 Score =  401 bits (1031),  Expect = 5e-146
 Identities = 190/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+ AIQH GH QVEILVVLDSCTDQS  +V+SHQ+NW+
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIKHAIQHIGHGQVEILVVLDSCTDQSLMIVKSHQMNWL  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD M+HQHIHGANLSFSAEAYI+AGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMNHQHIHGANLSFSAEAYIKAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> A0A2N6V7U8 Glycosyl transferase [Acinetobacter ursingii]
Length=214

 Score =  401 bits (1031),  Expect = 5e-146
 Identities = 190/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+ AIQH GH QVEILVVLDSCTDQS  +V+SHQ+NW+
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIKHAIQHIGHGQVEILVVLDSCTDQSLMIVKSHQMNWL  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD M+HQHIHGANLSFSAEAYI+AGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMNHQHIHGANLSFSAEAYIKAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> A0A0U3T642 Glycosyl transferase [Acinetobacter johnsonii XBB1]
Length=214

 Score =  401 bits (1031),  Expect = 5e-146
 Identities = 190/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+ AIQH GH QVEILVVLDSCTDQS  +V+SHQ+NW+
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIKHAIQHIGHGQVEILVVLDSCTDQSLMIVKSHQMNWL  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD M+HQHIHGANLSFSAEAYI+AGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMNHQHIHGANLSFSAEAYIKAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> A0A1R7QGY1 Putative glycosyl transferase [Acinetobacter johnsonii]
Length=214

 Score =  401 bits (1031),  Expect = 5e-146
 Identities = 191/214 (89%), Positives = 202/214 (94%), Gaps = 0/214 (0%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWI  60
            MKIGIVIPAHNEEQ+LSACLQSI+ AIQ+ GH QV+ILVVLDSCTDQS  +V+SHQ+NWI
Sbjct  1    MKIGIVIPAHNEEQNLSACLQSIELAIQYIGHGQVKILVVLDSCTDQSLMIVKSHQMNWI  60

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICGVVTLDD  120
            ECNFACVGKARDLGIRQLIDQGV WVACTDADTIVD DW+LCQM HQPTDAICG+V LDD
Sbjct  61   ECNFACVGKARDLGIRQLIDQGVTWVACTDADTIVDPDWLLCQMRHQPTDAICGIVILDD  120

Query  121  LSHLSVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180
            LSHLS+QQQQKYL HYQD MDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK
Sbjct  121  LSHLSIQQQQKYLTHYQDMMDHQHIHGANLSFSAEAYIQAGGFEPIPCHEDVSLIEKFIK  180

Query  181  QCCKVTRSNLVRVTTSSRLNGRAPEGLSYFLKHL  214
            QCCK+T SNLVRVTTSSRLNGRAPEGLSYFLKHL
Sbjct  181  QCCKITWSNLVRVTTSSRLNGRAPEGLSYFLKHL  214


> O06035 EpsG [Lactococcus lactis subsp. cremoris]
Length=316

 Score = 48.9 bits (115),  Expect = 4e-10
 Identities = 33/125 (26%), Positives = 65/125 (52%), Gaps = 15/125 (12%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESH-----  55
            +K+ I+IP +N E++LS CL SI +      ++++EI++V D  TD S+ +  S+     
Sbjct  2    IKLSIIIPIYNVEKYLSKCLNSILEQT----YKEIEIILVNDGSTDNSKDIAVSYCERFP  57

Query  56   -QVNWIECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTDAICG  114
                + E +   +  AR+ G+ ++      +V   D+D  +D+D  L +++    D+   
Sbjct  58   NVFKYFEKDNGGLSSARNFGLEKISGD---FVGFLDSDDYIDND--LYEIMINSLDSSIK  112

Query  115  VVTLD  119
            +V  D
Sbjct  113  IVECD  117


> Q9RG45 Cps1J [Streptococcus suis]
Length=323

 Score = 48.1 bits (113),  Expect = 8e-10
 Identities = 28/101 (28%), Positives = 58/101 (57%), Gaps = 12/101 (12%)

Query  2   KIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESH-----Q  56
           KI +++P +N +++LS+C++S    I +  ++ +EIL++ D   D S  + + +     +
Sbjct  3   KISVIVPVYNVDKYLSSCIES----IINQNYKNIEILLIDDGSVDDSAKICKEYAEKDKR  58

Query  57  VNWIECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDS  97
           V     N + V  AR+ GI++   + +++V   D+D +VDS
Sbjct  59  VKIFFTNHSGVSNARNHGIKRSTAEYIMFV---DSDDVVDS  96


> A0A0H3JPC6 Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase 
TarS [Staphylococcus aureus (strain Mu50 / ATCC 700699)]
Length=573

 Score = 47.8 bits (112),  Expect = 1e-09
 Identities = 29/104 (28%), Positives = 58/104 (56%), Gaps = 11/104 (11%)

Query  1   MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESH-----  55
           MK  +++P +N E++++  L S+  A Q     + E++VV D  TDQ+  +VE +     
Sbjct  2   MKFSVIVPTYNSEKYITELLNSL--AKQDFPKTEFEVVVVDDCSTDQTLQIVEKYRNKLN  59

Query  56  -QVNWIECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSD  98
            +V+ +E N    GK R++ ++Q   + V++V   D+D  ++ +
Sbjct  60  LKVSQLETNSGGPGKPRNVALKQAEGEFVLFV---DSDDYINKE  100


> Q1PSV5 Lgt3 [Moraxella catarrhalis]
Length=534

 Score = 47.0 bits (110),  Expect = 2e-09
 Identities = 42/154 (27%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDS-CTDQSRSVVESHQVNW-I  60
            + +V+   NE +HL ACL+++        H+ V+ ++VLDS  TD +R + ES+   W +
Sbjct  283  LSLVMICKNESKHLKACLETV--------HDIVDEIIVLDSGSTDNTRQIAESYGAKWHV  334

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSD--WILCQMLHQP--TDAICGVV  116
              ++   GK R L   Q    G  +V   DAD  +D      +  +L  P  TD +  V 
Sbjct  335  NTDWQGFGKQRQLA--QAYATG-DYVLVLDADERLDQPLRQAITDVLKNPVQTDKVFSVA  391

Query  117  TLDDLSHLSVQQQQKYLAHYQDSMDHQHIHGANL  150
             ++    + VQ +  Y          QH   ++L
Sbjct  392  RVNTFCGIEVQPRWWYTDKLSRLYARQHFQYSDL  425


 Score = 41.2 bits (95),  Expect = 2e-07
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 14/122 (11%)

Query  2    KIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDS-CTDQSRSVVESHQVNWI  60
            ++ +V+   NE  +L   L +I         + V+ +++LDS  TD  + + +SH   W 
Sbjct  8    RLSVVMIVKNEADNLKVSLPAIA--------DWVDEIIILDSGSTDDGQKIAQSHGAKW-  58

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVD---SDWILCQMLHQPTDAICGVVT  117
              N    G  R   + Q    G  W+   DAD +V     + IL  + + PTD + G+  
Sbjct  59   HVNTDWQGFGRQRQLAQAYATG-DWILALDADEVVTPQLKNSILKVIKNPPTDTVYGIKR  117

Query  118  LD  119
            LD
Sbjct  118  LD  119


> Q2QCA5 Lgt3 [Moraxella catarrhalis]
Length=534

 Score = 47.0 bits (110),  Expect = 2e-09
 Identities = 42/154 (27%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDS-CTDQSRSVVESHQVNW-I  60
            + +V+   NE +HL ACL+++        H+ V+ ++VLDS  TD +R + ES+   W +
Sbjct  283  LSLVMICKNESKHLKACLETV--------HDIVDEIIVLDSGSTDNTRQIAESYGAKWHV  334

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSD--WILCQMLHQP--TDAICGVV  116
              ++   GK R L   Q    G  +V   DAD  +D      +  +L  P  TD +  V 
Sbjct  335  NTDWQGFGKQRQLA--QAYATG-DYVLVLDADERLDQPLRQAITDVLKNPVQTDKVFSVA  391

Query  117  TLDDLSHLSVQQQQKYLAHYQDSMDHQHIHGANL  150
             ++    + VQ +  Y          QH   ++L
Sbjct  392  RVNTFCGIEVQPRWWYTDKLSRLYARQHFQYSDL  425


 Score = 41.2 bits (95),  Expect = 2e-07
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 14/122 (11%)

Query  2    KIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDS-CTDQSRSVVESHQVNWI  60
            ++ +V+   NE  +L   L +I         + V+ +++LDS  TD  + + +SH   W 
Sbjct  8    RLSVVMIVKNEADNLKVSLPAIA--------DWVDEIIILDSGSTDDGQKIAQSHGAKW-  58

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVD---SDWILCQMLHQPTDAICGVVT  117
              N    G  R   + Q    G  W+   DAD +V     + IL  + + PTD + G+  
Sbjct  59   HVNTDWQGFGRQRQLAQAYATG-DWILALDADEVVTPQLKNSILKVIKNPPTDTVYGIKR  117

Query  118  LD  119
            LD
Sbjct  118  LD  119


> Q5DIA0 Lgt3 [Moraxella catarrhalis]
Length=534

 Score = 47.0 bits (110),  Expect = 2e-09
 Identities = 42/154 (27%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDS-CTDQSRSVVESHQVNW-I  60
            + +V+   NE +HL ACL+++        H+ V+ ++VLDS  TD +R + ES+   W +
Sbjct  283  LSLVMICKNESKHLKACLETV--------HDIVDEIIVLDSGSTDNTRQIAESYGAKWHV  334

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSD--WILCQMLHQP--TDAICGVV  116
              ++   GK R L   Q    G  +V   DAD  +D      +  +L  P  TD +  V 
Sbjct  335  NTDWQGFGKQRQLA--QAYATG-DYVLVLDADERLDQPLRQAITDVLKNPVQTDKVFSVA  391

Query  117  TLDDLSHLSVQQQQKYLAHYQDSMDHQHIHGANL  150
             ++    + VQ +  Y          QH   ++L
Sbjct  392  RVNTFCGIEVQPRWWYADKLSRLYARQHFQYSDL  425


 Score = 41.2 bits (95),  Expect = 2e-07
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 14/122 (11%)

Query  2    KIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDS-CTDQSRSVVESHQVNWI  60
            ++ +V+   NE  +L   L +I         + V+ +++LDS  TD  + + +SH   W 
Sbjct  8    RLSVVMIVKNEADNLKVSLPAIA--------DWVDEIIILDSGSTDDGQKIAQSHGAKW-  58

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVD---SDWILCQMLHQPTDAICGVVT  117
              N    G  R   + Q    G  W+   DAD +V     + IL  + + PTD + G+  
Sbjct  59   HVNTDWQGFGRQRQLAQAYATG-DWILALDADEVVTPQLKNSILKVIKNPPTDTVYGIKR  117

Query  118  LD  119
            LD
Sbjct  118  LD  119


> Q0ZRE9 Lgt3 [Moraxella catarrhalis]
Length=534

 Score = 47.0 bits (110),  Expect = 2e-09
 Identities = 42/154 (27%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDS-CTDQSRSVVESHQVNW-I  60
            + +V+   NE +HL ACL+++        H+ V+ ++VLDS  TD +R + ES+   W +
Sbjct  283  LSLVMICKNESKHLKACLETV--------HDIVDEIIVLDSGSTDNTRQIAESYGAKWHV  334

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSD--WILCQMLHQP--TDAICGVV  116
              ++   GK R L   Q    G  +V   DAD  +D      +  +L  P  TD +  V 
Sbjct  335  NTDWQGFGKQRQLA--QAYATG-DYVLLLDADERLDQPLRQAITDVLKNPVQTDKVFSVA  391

Query  117  TLDDLSHLSVQQQQKYLAHYQDSMDHQHIHGANL  150
             ++    + VQ +  Y          QH   ++L
Sbjct  392  RVNTFCGIEVQPRWWYADKLSRLYARQHFQYSDL  425


 Score = 41.2 bits (95),  Expect = 2e-07
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 14/122 (11%)

Query  2    KIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDS-CTDQSRSVVESHQVNWI  60
            ++ +V+   NE  +L   L +I         + V+ +++LDS  TD  + + +SH   W 
Sbjct  8    RLSVVMIVKNEADNLKVSLPAIA--------DWVDEIIILDSGSTDDGQKIAQSHGAKW-  58

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVD---SDWILCQMLHQPTDAICGVVT  117
              N    G  R   + Q    G  W+   DAD +V     + IL  + + PTD + G+  
Sbjct  59   HVNTDWQGFGRQRQLAQAYATG-DWILALDADEVVTPQLKNSILKVIKNPPTDTVYGIKR  117

Query  118  LD  119
            LD
Sbjct  118  LD  119


> Q9RG44 Cps1K [Streptococcus suis]
Length=279

 Score = 46.6 bits (109),  Expect = 2e-09
 Identities = 54/231 (23%), Positives = 99/231 (43%), Gaps = 40/231 (17%)

Query  2    KIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVV-----ESHQ  56
            KI I++P +N E++LS C+ SI   +  T ++ +EIL+V D  TD S  +      +  +
Sbjct  6    KISIIVPIYNVEKYLSKCIDSI---VNQT-YKHIEILLVNDGSTDNSEEICLAYAKKDSR  61

Query  57   VNWIECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTD------  110
            + + +     +  AR+ GI +       ++A  D+D  + S++I  Q LH+  +      
Sbjct  62   IRYFKKENGGLSDARNYGISRAKGD---YLAFIDSDDFIHSEFI--QRLHEAIERENALV  116

Query  111  AICGVVTLDDLSHL----------SVQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQA  160
            A+ G   +D   H           +V   +       ++  H+ +   N  +  E + + 
Sbjct  117  AVAGYDRVDASGHFLTAEPLPTNQAVLSGRNVCKKLLEADGHRFVVACNKLYKKELF-ED  175

Query  161  GGFEPIPCHED-------VSLIEK--FIKQCCKVTRSNLVRVTTSSRLNGR  202
              FE    HED       +  +EK   +K+C          +TTSS  + R
Sbjct  176  FRFEKGKIHEDEYFTYRLLYELEKVAIVKECLYYYVDRENSITTSSMTDHR  226


> Q9X4V5 Cps2K [Streptococcus suis]
Length=276

 Score = 46.2 bits (108),  Expect = 3e-09
 Identities = 36/134 (27%), Positives = 66/134 (49%), Gaps = 20/134 (15%)

Query  1    MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVV-----ESH  55
            + I I++P +N EQ+LS C+ SI   +  T ++ +EIL+V D  TD S  +      +  
Sbjct  2    INISIIVPIYNVEQYLSKCINSI---VNQT-YKHIEILLVNDGSTDNSEEICLAYAKKDS  57

Query  56   QVNWIECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSDWILCQMLHQPTD-----  110
            ++ + +     +  AR+ GI +       ++A  D+D  + S++I  Q LH+  +     
Sbjct  58   RIRYFKKENGGLSDARNYGISRAKGD---YLAFIDSDDFIHSEFI--QRLHEAIERENAL  112

Query  111  -AICGVVTLDDLSH  123
             A+ G   +D   H
Sbjct  113  VAVAGYDRVDASGH  126


> Q2QCA9 Glycosyl transferase 2 family protein [Moraxella catarrhalis]
Length=534

 Score = 45.4 bits (106),  Expect = 8e-09
 Identities = 40/154 (26%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDS-CTDQSRSVVESHQVNW-I  60
            + +V+   NE +HL ACL+++        H+ V+ ++VLDS  TD +R + +S+   W +
Sbjct  283  LSLVMICKNESKHLKACLETV--------HDIVDEIIVLDSGSTDNTRQIAKSYGAKWHV  334

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVDSD--WILCQMLHQP--TDAICGVV  116
              ++   GK R L   Q    G  +V   DAD  +D      +  +L  P  TD +  V 
Sbjct  335  NTDWQGFGKQRQLA--QAYATG-DYVLALDADERLDQPLRQAITDVLKNPVQTDKVFSVA  391

Query  117  TLDDLSHLSVQQQQKYLAHYQDSMDHQHIHGANL  150
             ++    + +Q +  Y          QH   ++L
Sbjct  392  RVNTFCGIEIQPRWWYADKLSRLYARQHFQYSDL  425


 Score = 41.2 bits (95),  Expect = 2e-07
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 14/122 (11%)

Query  2    KIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDS-CTDQSRSVVESHQVNWI  60
            ++ +V+   NE  +L   L +I         + V+ +++LDS  TD  + + +SH   W 
Sbjct  8    RLSVVMIVKNEADNLKVSLPAIA--------DWVDEIIILDSGSTDDGQKIAQSHGAKW-  58

Query  61   ECNFACVGKARDLGIRQLIDQGVIWVACTDADTIVD---SDWILCQMLHQPTDAICGVVT  117
              N    G  R   + Q    G  W+   DAD +V     + IL  + + PTD + G+  
Sbjct  59   HVNTDWQGFGRQRQLAQAYATG-DWILALDADEVVTPQLKNSILKVIKNPPTDTVYGIKR  117

Query  118  LD  119
            LD
Sbjct  118  LD  119


> O88085 Putative glycosyl transferase [Enterococcus faecalis]
Length=241

 Score = 44.3 bits (103),  Expect = 1e-08
 Identities = 21/63 (33%), Positives = 43/63 (68%), Gaps = 4/63 (6%)

Query  1   MKIGIVIPAHNEEQHL---SACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQV  57
           MK+ ++IPA+NEE+++    A +++ +Q + H  HE ++ +V+ D  TD ++ ++E +Q+
Sbjct  1   MKVLLIIPAYNEEENILRTIASIETFKQEVTHFQHE-LDYVVINDGSTDGTKQILEVNQI  59

Query  58  NWI  60
           N I
Sbjct  60  NAI  62


> B5A7L8 Putative glycosyltransferase [Streptococcus parasanguinis]
Length=297

 Score = 44.3 bits (103),  Expect = 1e-08
 Identities = 18/52 (35%), Positives = 35/52 (67%), Gaps = 4/52 (8%)

Query  2   KIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVE  53
           KI ++IPA+N E++L  C++S++  I    +  +EI++V D  TD++  ++E
Sbjct  8   KISVIIPAYNAEKYLEQCVESVRTQI----YNNIEIIIVNDGSTDRTAEIIE  55


 Score = 18.5 bits (36),  Expect = 3.7
 Identities = 5/15 (33%), Positives = 11/15 (73%), Gaps = 0/15 (0%)

Query  176  EKFIKQCCKVTRSNL  190
            EK+++QC +  R+ +
Sbjct  19   EKYLEQCVESVRTQI  33


> Q56046 EpsI [Streptococcus thermophilus]
Length=324

 Score = 43.9 bits (102),  Expect = 2e-08
 Identities = 38/127 (30%), Positives = 61/127 (48%), Gaps = 18/127 (14%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWIEC  62
            I IVIP +N E++L  CLQS    +Q+  +   E+++V D  TD S S+ E   VN  + 
Sbjct  7    ISIVIPVYNVEKYLEKCLQS----VQNQTYNNFEVILVNDGSTDSSLSICEKF-VNQ-DK  60

Query  63   NFACVGK-------ARDLGIRQLIDQGVIWVACTDADTIVDSDWI--LCQMLHQPTDAIC  113
             F+   K       AR+ GI++     + +V   D+D  +  D++  L   +   T  +C
Sbjct  61   RFSVFSKENGGMSSARNFGIKKAKGSFITFV---DSDDYIVKDYLSHLVAGIKSETSIVC  117

Query  114  GVVTLDD  120
                L D
Sbjct  118  SKFFLVD  124



Lambda      K        H        a         alpha
   0.325    0.136    0.425    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1264536


  Database: d6ae12508a44223515bdfb0f90a46e6a.TrEMBL.fasta
    Posted date:  Sep 19, 2020  2:49 PM
  Number of letters in database: 8,937
  Number of sequences in database:  30



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40