ACIAD1558 / SwissProt Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: c715d2abfecae01adf2a07e51120625b.SwissProt.fasta
           16 sequences; 6,247 total letters



Query= ACIAD1558

Length=215
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q3U129 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransfer...  39.7    4e-07
  Q6GV29 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransfer...  39.7    4e-07
  P75905 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Escherich...  37.0    3e-06
  P22639 Uncharacterized glycosyltransferase alr2836 [Nostoc sp. ...  36.2    5e-06
  Q53590 4,4'-diaponeurosporenoate glycosyltransferase [Staphyloc...  36.2    5e-06
  Q9VLQ1 Dolichyl-phosphate beta-glucosyltransferase [Drosophila ...  35.4    9e-06
  Q67FW5 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransfer...  35.0    1e-05
  Q5HCN1 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphyloc...  34.7    2e-05
  Q99QX3 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphyloc...  34.7    2e-05
  Q7A351 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphyloc...  34.7    2e-05
  Q6GDD8 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphyloc...  34.7    2e-05
  Q9RQP9 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphyloc...  34.7    2e-05
  Q5HKQ0 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphyloc...  34.3    2e-05
  Q8GLC5 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphyloc...  34.3    2e-05
  Q6G608 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphyloc...  33.9    3e-05
  Q8NUI7 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphyloc...  33.9    3e-05


> Q3U129 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like 
protein 1 [Mus musculus]
Length=357

 Score = 39.7 bits (91),  Expect = 4e-07
 Identities = 19/55 (35%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query  3   IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQV  57
           + I++P HN EQ L  CL S+   +Q      +E+ V  D+  D+SR+++E  +V
Sbjct  16  VSIILPVHNAEQWLDECLMSV---LQQDFEGAMELSVFNDASKDKSRAIIEKWKV  67


 Score = 17.7 bits (34),  Expect = 4.7
 Identities = 6/11 (55%), Positives = 8/11 (73%), Gaps = 0/11 (0%)

Query  204  PEGLSYFLKHL  214
            PE L +F +HL
Sbjct  199  PEDLLFFYEHL  209


> Q6GV29 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like 
protein 1 [Rattus norvegicus]
Length=357

 Score = 39.7 bits (91),  Expect = 4e-07
 Identities = 19/55 (35%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query  3   IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQV  57
           + I++P HN EQ L  CL S+   +Q      +E+ V  D+  D+SR+++E  +V
Sbjct  16  VSIILPVHNAEQWLDECLMSV---LQQDFEGTMELSVFNDASKDKSRAIIEKWKV  67


> P75905 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Escherichia 
coli (strain K12)]
Length=441

 Score = 37.0 bits (84),  Expect = 3e-06
 Identities = 26/112 (23%), Positives = 58/112 (52%), Gaps = 10/112 (9%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVE--SHQVNWI  60
            I I+IP  NEE+++    ++I  A+    +E +E++ V D  TD++R++++  + Q+  +
Sbjct  77   ISIIIPCFNEEKNVE---ETIHAALAQR-YENIEVIAVNDGSTDKTRAILDRMAAQIPHL  132

Query  61   ECNFACVGKARDLGIRQ-LIDQGVIWVACTDADTIVDSD---WILCQMLHQP  108
                    + + + ++         ++ C D D ++D D   +I+  ML+ P
Sbjct  133  RVIHLAQNQGKAIALKTGAAAAKSEYLVCIDGDALLDRDAAAYIVEPMLYNP  184


> P22639 Uncharacterized glycosyltransferase alr2836 [Nostoc sp. 
(strain PCC 7120 / SAG 25.82 / UTEX 2576)]
Length=322

 Score = 36.2 bits (82),  Expect = 5e-06
 Identities = 19/56 (34%), Positives = 30/56 (54%), Gaps = 4/56 (7%)

Query  1   MKIGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQ  56
           MKI ++I  +N  ++LS  + S+        H  +EI++V D  TD SR V+   Q
Sbjct  1   MKISVIISNYNYARYLSRAINSVLAQT----HSDIEIVIVDDGSTDNSRDVITQLQ  52


 Score = 21.9 bits (45),  Expect = 0.20
 Identities = 11/36 (31%), Positives = 20/36 (56%), Gaps = 0/36 (0%)

Query  126  VQQQQKYLAHYQDSMDHQHIHGANLSFSAEAYIQAG  161
            ++  Q+ LA+Y+    + H+  A+ +   EA  QAG
Sbjct  197  IKTLQENLAYYRIHGANNHMSAASATSEQEAKSQAG  232


> Q53590 4,4'-diaponeurosporenoate glycosyltransferase [Staphylococcus 
aureus (strain Newman)]
Length=375

 Score = 36.2 bits (82),  Expect = 5e-06
 Identities = 30/94 (32%), Positives = 44/94 (47%), Gaps = 8/94 (9%)

Query  5    IVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWIECNF  64
            I+IPA NEE+ +   L SI Q         V+++V+ D  TD++  V  S+    ++   
Sbjct  43   IIIPARNEEKRIGHLLHSIIQQ-----QVPVDVIVMNDGSTDETARVARSYGATVVDVVD  97

Query  65   ACVGKARDLGIRQLIDQGVIWVACTDADTIVDSD  98
               GK    G      QGV   ACT+    VD+D
Sbjct  98   DTDGKW--YGKSHACYQGVTH-ACTNRIAFVDAD  128


> Q9VLQ1 Dolichyl-phosphate beta-glucosyltransferase [Drosophila 
melanogaster]
Length=326

 Score = 35.4 bits (80),  Expect = 9e-06
 Identities = 18/55 (33%), Positives = 32/55 (58%), Gaps = 4/55 (7%)

Query  1    MKIGIVIPAHNEEQHLSA----CLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSV  51
            +++ +++PA+NEEQ L +    CL  ++Q    T +   E++VV D   D + SV
Sbjct  66   LELSVIVPAYNEEQRLPSMLDECLAFLEQKSAGTPNFTYEVIVVSDGSQDATVSV  120


> Q67FW5 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like 
protein 1 [Homo sapiens]
Length=361

 Score = 35.0 bits (79),  Expect = 1e-05
 Identities = 17/55 (31%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query  3   IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQV  57
           + I++P HN E  L  CL+S+   +Q      +E+ V  D+  D+S +++E  +V
Sbjct  20  VSIILPVHNAEPWLDECLRSV---LQQDFEGTMELSVFNDASKDKSGAIIEKWRV  71


 Score = 17.7 bits (34),  Expect = 4.7
 Identities = 6/11 (55%), Positives = 8/11 (73%), Gaps = 0/11 (0%)

Query  204  PEGLSYFLKHL  214
            PE L +F +HL
Sbjct  203  PEDLLFFYEHL  213


> Q5HCN1 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphylococcus 
aureus (strain COL)]
Length=412

 Score = 34.7 bits (78),  Expect = 2e-05
 Identities = 25/101 (25%), Positives = 48/101 (48%), Gaps = 12/101 (12%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWIEC  62
            I  ++  +NE + +   L ++        +E+ EI+++ D  +D +  ++   + N    
Sbjct  49   ITFLLACYNESETIEDTLSNVLAL----KYEKKEIIIINDGSSDNTAELIYKIKEN---N  101

Query  63   NFACVGKARDLGIRQLIDQGVI-----WVACTDADTIVDSD  98
            +F  V    + G    ++QG+      +V C DADTIVD D
Sbjct  102  DFIFVDLQENRGKANALNQGIKQASYDYVMCLDADTIVDQD  142


> Q99QX3 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphylococcus 
aureus (strain Mu50 / ATCC 700699)]
Length=412

 Score = 34.7 bits (78),  Expect = 2e-05
 Identities = 25/101 (25%), Positives = 48/101 (48%), Gaps = 12/101 (12%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWIEC  62
            I  ++  +NE + +   L ++        +E+ EI+++ D  +D +  ++   + N    
Sbjct  49   ITFLLACYNESETIEDTLSNVLAL----KYEKKEIIIINDGSSDNTAELIYKIKEN---N  101

Query  63   NFACVGKARDLGIRQLIDQGVI-----WVACTDADTIVDSD  98
            +F  V    + G    ++QG+      +V C DADTIVD D
Sbjct  102  DFIFVDLQENRGKANALNQGIKQASYDYVMCLDADTIVDQD  142


> Q7A351 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphylococcus 
aureus (strain N315)]
Length=412

 Score = 34.7 bits (78),  Expect = 2e-05
 Identities = 25/101 (25%), Positives = 48/101 (48%), Gaps = 12/101 (12%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWIEC  62
            I  ++  +NE + +   L ++        +E+ EI+++ D  +D +  ++   + N    
Sbjct  49   ITFLLACYNESETIEDTLSNVLAL----KYEKKEIIIINDGSSDNTAELIYKIKEN---N  101

Query  63   NFACVGKARDLGIRQLIDQGVI-----WVACTDADTIVDSD  98
            +F  V    + G    ++QG+      +V C DADTIVD D
Sbjct  102  DFIFVDLQENRGKANALNQGIKQASYDYVMCLDADTIVDQD  142


> Q6GDD8 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphylococcus 
aureus (strain MRSA252)]
Length=412

 Score = 34.7 bits (78),  Expect = 2e-05
 Identities = 25/101 (25%), Positives = 48/101 (48%), Gaps = 12/101 (12%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWIEC  62
            I  ++  +NE + +   L ++        +E+ EI+++ D  +D +  ++   + N    
Sbjct  49   ITFLLACYNESETIEDTLSNVLAL----KYEKKEIIIINDGSSDNTAELIYKIKEN---N  101

Query  63   NFACVGKARDLGIRQLIDQGVI-----WVACTDADTIVDSD  98
            +F  V    + G    ++QG+      +V C DADTIVD D
Sbjct  102  DFIFVDLQENRGKANALNQGIKQASYDYVMCLDADTIVDQD  142


> Q9RQP9 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphylococcus 
aureus (strain NCTC 8325)]
Length=412

 Score = 34.7 bits (78),  Expect = 2e-05
 Identities = 25/101 (25%), Positives = 48/101 (48%), Gaps = 12/101 (12%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWIEC  62
            I  ++  +NE + +   L ++        +E+ EI+++ D  +D +  ++   + N    
Sbjct  49   ITFLLACYNESETIEDTLSNVLAL----KYEKKEIIIINDGSSDNTAELIYKIKEN---N  101

Query  63   NFACVGKARDLGIRQLIDQGVI-----WVACTDADTIVDSD  98
            +F  V    + G    ++QG+      +V C DADTIVD D
Sbjct  102  DFIFVDLQENRGKANALNQGIKQASYDYVMCLDADTIVDQD  142


> Q5HKQ0 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphylococcus 
epidermidis (strain ATCC 35984 / RP62A)]
Length=412

 Score = 34.3 bits (77),  Expect = 2e-05
 Identities = 25/102 (25%), Positives = 50/102 (49%), Gaps = 14/102 (14%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVV----ESHQVN  58
            I  ++  +NE + +   L S+        + + EI+++ D  +D +  ++    ++H   
Sbjct  49   ISFLLACYNESETVQDTLSSVLSL----EYPEKEIIIINDGSSDNTAEIIYDFKKNHDFK  104

Query  59   WIECNFACVGKARDL--GIRQLIDQGVIWVACTDADTIVDSD  98
            +++      GKA  L  GI+Q   +   +V C DADT++D D
Sbjct  105  FVDLEVNR-GKANALNEGIKQASYE---YVMCLDADTVIDDD  142


> Q8GLC5 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphylococcus 
epidermidis]
Length=412

 Score = 34.3 bits (77),  Expect = 2e-05
 Identities = 25/102 (25%), Positives = 50/102 (49%), Gaps = 14/102 (14%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVV----ESHQVN  58
            I  ++  +NE + +   L S+        + + EI+++ D  +D +  ++    ++H   
Sbjct  49   ISFLLACYNESETVQDTLSSVLSL----EYPEKEIIIINDGSSDNTAEIIYEFKKNHDFK  104

Query  59   WIECNFACVGKARDL--GIRQLIDQGVIWVACTDADTIVDSD  98
            +++      GKA  L  GI+Q   +   +V C DADT++D D
Sbjct  105  FVDLEVNR-GKANALNEGIKQASYE---YVMCLDADTVIDDD  142


> Q6G608 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphylococcus 
aureus (strain MSSA476)]
Length=412

 Score = 33.9 bits (76),  Expect = 3e-05
 Identities = 25/101 (25%), Positives = 47/101 (47%), Gaps = 12/101 (12%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWIEC  62
            I  ++  +NE   +   L ++        +E+ EI+++ D  +D +  ++   + N    
Sbjct  49   ITFLLACYNESDTIEDTLSNVLAL----KYEKKEIIIINDGSSDNTAELIYKIKEN---N  101

Query  63   NFACVGKARDLGIRQLIDQGVI-----WVACTDADTIVDSD  98
            +F  V    + G    ++QG+      +V C DADTIVD D
Sbjct  102  DFIFVDLQENRGKANALNQGIKQASYDYVMCLDADTIVDQD  142


> Q8NUI7 Poly-beta-1,6-N-acetyl-D-glucosamine synthase [Staphylococcus 
aureus (strain MW2)]
Length=412

 Score = 33.9 bits (76),  Expect = 3e-05
 Identities = 25/101 (25%), Positives = 47/101 (47%), Gaps = 12/101 (12%)

Query  3    IGIVIPAHNEEQHLSACLQSIQQAIQHTGHEQVEILVVLDSCTDQSRSVVESHQVNWIEC  62
            I  ++  +NE   +   L ++        +E+ EI+++ D  +D +  ++   + N    
Sbjct  49   ITFLLACYNESDTIEDTLSNVLAL----KYEKKEIIIINDGSSDNTAELIYKIKEN---N  101

Query  63   NFACVGKARDLGIRQLIDQGVI-----WVACTDADTIVDSD  98
            +F  V    + G    ++QG+      +V C DADTIVD D
Sbjct  102  DFIFVDLQENRGKANALNQGIKQASYDYVMCLDADTIVDQD  142



Lambda      K        H        a         alpha
   0.325    0.136    0.425    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 939590


  Database: c715d2abfecae01adf2a07e51120625b.SwissProt.fasta
    Posted date:  Sep 21, 2020  4:37 AM
  Number of letters in database: 6,247
  Number of sequences in database:  16



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40