ACIAD1521 / TrEMBL Alignments

BLASTP 2.2.28+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: 792bbed75e04d0666fb470b36f659d4d.TrEMBL.fasta
           24 sequences; 4,266 total letters



Query= ACIAD1521

Length=139
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Q6FC36 Sec-independent protein translocase protein TatB [Acinet...   265    7e-95
  A0A0Q5G8M2 Translocase [Acinetobacter sp. Leaf130]                   260    5e-93
  A0A241YJY1 Sec-independent protein translocase protein TatB [Ac...   260    5e-93
  A0A2T5QKS0 Sec-independent protein translocase protein TatB [Ac...   260    5e-93
  A0A0M3FHZ2 Sec-independent protein translocase protein TatB [Ac...   259    1e-92
  A0A0R0RSG7 Sec-independent protein translocase protein TatB [Ac...   258    4e-92
  A0A204EU55 Sec-independent protein translocase protein TatB [Ac...   257    6e-92
  A0A1Y3F7D0 Sec-independent protein translocase protein TatB [Ac...   257    6e-92
  N9S3E2 Sec-independent protein translocase protein TatB [Acinet...   257    8e-92
  A0A009KGX2 Sec-independent protein translocase protein TatB [Ac...   257    8e-92
  N8S7H2 Sec-independent protein translocase protein TatB [Acinet...   257    8e-92
  A0A1C2P1P4 Sec-independent protein translocase protein TatB [Ac...   256    2e-91
  A0A1V2USX4 Sec-independent protein translocase protein TatB [Ac...   254    1e-90
  I6MGU8 TatB [Moraxella catarrhalis]                                 73.2    5e-20
  I6MGV1 MttA/Hcf106 family protein [Moraxella catarrhalis]           72.8    7e-20
  F1XD70 TatB [Moraxella catarrhalis O35E]                            72.8    7e-20
  A1YYZ8 Sec-independent protein translocase protein TatB [Xantho...  66.2    2e-17
  A6N9K2 Sec-independent protein translocase protein TatB [Entero...  60.8    1e-15
  A0A0D8VEJ4 Sec-independent protein translocase protein TatB [Es...  56.2    4e-14
  Q9AKS1 Sec-independent protein translocase protein TatB [Pseudo...  54.3    1e-13
  Q2PHA3 Twin-arginine translocase B [Myxococcus xanthus]             44.7    7e-10
  Q590L8 Preprotein translocase subunit TatB [Legionella pneumoph...  41.2    4e-09
  Q9AED7 Preprotein translocase subunit TatB [Legionella pneumoph...  39.7    1e-08
  K9LW26 Synaptonemal complex protein ZYP1 [Hordeum vulgare subsp...  41.2    2e-08


> Q6FC36 Sec-independent protein translocase protein TatB [Acinetobacter 
baylyi (strain ATCC 33305 / BD413 / ADP1)]
Length=138

 Score =  265 bits (676),  Expect = 7e-95
 Identities = 138/138 (100%), Positives = 138/138 (100%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTANKFSEDQAA
Sbjct  121  PFLAHFKTANKFSEDQAA  138


> A0A0Q5G8M2 Translocase [Acinetobacter sp. Leaf130]
Length=138

 Score =  260 bits (664),  Expect = 5e-93
 Identities = 135/138 (98%), Positives = 137/138 (99%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELL+FAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK
Sbjct  1    MFNISFGELLSFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIE+KTKARRINDYIYTRSQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIEQKTKARRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTANKF EDQAA
Sbjct  121  PFLAHFKTANKFCEDQAA  138


> A0A241YJY1 Sec-independent protein translocase protein TatB [Acinetobacter 
nosocomialis]
Length=138

 Score =  260 bits (664),  Expect = 5e-93
 Identities = 135/138 (98%), Positives = 137/138 (99%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIE+KTKA+RINDYIYTRSQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIEQKTKAQRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFL HFKTANKFSEDQAA
Sbjct  121  PFLTHFKTANKFSEDQAA  138


> A0A2T5QKS0 Sec-independent protein translocase protein TatB [Acinetobacter 
oleivorans]
Length=150

 Score =  260 bits (665),  Expect = 5e-93
 Identities = 135/138 (98%), Positives = 138/138 (100%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQT+VSIE+KTKA+RINDYIYTRSQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTTVSIEQKTKAQRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTANKFSEDQAA
Sbjct  121  PFLAHFKTANKFSEDQAA  138


> A0A0M3FHZ2 Sec-independent protein translocase protein TatB [Acinetobacter 
baumannii]
Length=138

 Score =  259 bits (661),  Expect = 1e-92
 Identities = 135/138 (98%), Positives = 136/138 (99%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSV  E+KTKARRINDYIYTRSQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVFTEQKTKARRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTANKFSEDQAA
Sbjct  121  PFLAHFKTANKFSEDQAA  138


> A0A0R0RSG7 Sec-independent protein translocase protein TatB [Acinetobacter 
pittii]
Length=138

 Score =  258 bits (658),  Expect = 4e-92
 Identities = 134/138 (97%), Positives = 137/138 (99%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLR+VLLKYRAVKNQI+KIQNDIENELDLIELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRTVLLKYRAVKNQINKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIE+KTKA RINDYIYTRSQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIEQKTKAWRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTANKFSEDQAA
Sbjct  121  PFLAHFKTANKFSEDQAA  138


> A0A204EU55 Sec-independent protein translocase protein TatB [Acinetobacter 
baumannii]
Length=138

 Score =  257 bits (657),  Expect = 6e-92
 Identities = 133/138 (96%), Positives = 136/138 (99%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRA+KNQISKIQNDIENELDLIELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAIKNQISKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQT+V  E+KTKARRINDYIYTRSQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTTVFTEQKTKARRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTANKFSEDQAA
Sbjct  121  PFLAHFKTANKFSEDQAA  138


> A0A1Y3F7D0 Sec-independent protein translocase protein TatB [Acinetobacter 
seifertii]
Length=138

 Score =  257 bits (657),  Expect = 6e-92
 Identities = 134/138 (97%), Positives = 136/138 (99%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSV  E+KTKA+RINDYIYTRSQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVFTEQKTKAQRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTANKFSEDQAA
Sbjct  121  PFLAHFKTANKFSEDQAA  138


> N9S3E2 Sec-independent protein translocase protein TatB [Acinetobacter 
sp. NIPH 542]
Length=138

 Score =  257 bits (656),  Expect = 8e-92
 Identities = 133/138 (96%), Positives = 135/138 (98%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDL ELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLFELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            R+MQEELQKIKQNEEQLKQQLALMQQEIENVQTSV  E+KTKARRINDYIYTRSQDELKT
Sbjct  61   RIMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVFTEQKTKARRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTANKFSEDQAA
Sbjct  121  PFLAHFKTANKFSEDQAA  138


> A0A009KGX2 Sec-independent protein translocase protein TatB [Acinetobacter 
baumannii 1419130]
Length=138

 Score =  257 bits (656),  Expect = 8e-92
 Identities = 134/138 (97%), Positives = 135/138 (98%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSV  E+KTKARRINDYIYT SQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVFTEQKTKARRINDYIYTHSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTANKFSEDQAA
Sbjct  121  PFLAHFKTANKFSEDQAA  138


> N8S7H2 Sec-independent protein translocase protein TatB [Acinetobacter 
seifertii]
Length=138

 Score =  257 bits (656),  Expect = 8e-92
 Identities = 134/138 (97%), Positives = 136/138 (99%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSV  E+KTKARRINDYIYTRSQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVFTEQKTKARRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTA+KFSEDQAA
Sbjct  121  PFLAHFKTAHKFSEDQAA  138


> A0A1C2P1P4 Sec-independent protein translocase protein TatB [Acinetobacter 
pittii]
Length=138

 Score =  256 bits (654),  Expect = 2e-91
 Identities = 133/138 (96%), Positives = 136/138 (99%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLR+VLLKYRAVKNQISKIQNDIENELDLIELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRTVLLKYRAVKNQISKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSV  E+KTKA+RINDYIYTRSQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVFTEQKTKAQRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTANKFSEDQAA
Sbjct  121  PFLAHFKTANKFSEDQAA  138


> A0A1V2USX4 Sec-independent protein translocase protein TatB [Acinetobacter 
genomosp. 33YU]
Length=138

 Score =  254 bits (648),  Expect = 1e-90
 Identities = 132/138 (96%), Positives = 134/138 (97%), Gaps = 0/138 (0%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MFNISFGELLAFAIIALIILGPEKLPHTLR+VLLKYRAVKNQISKIQNDIENELDLIELK
Sbjct  1    MFNISFGELLAFAIIALIILGPEKLPHTLRTVLLKYRAVKNQISKIQNDIENELDLIELK  60

Query  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQDELKT  120
            RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSV  E+K K RRINDYIYTRSQDELKT
Sbjct  61   RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVFTEQKAKPRRINDYIYTRSQDELKT  120

Query  121  PFLAHFKTANKFSEDQAA  138
            PFLAHFKTANKFSEDQAA
Sbjct  121  PFLAHFKTANKFSEDQAA  138


> I6MGU8 TatB [Moraxella catarrhalis]
Length=178

 Score = 73.2 bits (178),  Expect = 5e-20
 Identities = 35/100 (35%), Positives = 63/100 (63%), Gaps = 0/100 (0%)

Query  3    NISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKRV  62
            N+ F EL  F IIALI+LGP+KLP   R++   Y        K+Q +I NEL L+E +++
Sbjct  4    NLGFFELTLFGIIALIVLGPDKLPVAARTLGRWYSMFHRASQKLQTEITNELQLLETQQM  63

Query  63   MQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTK  102
            +++EL +I+Q+E ++K Q+  +++ ++  +T     +K +
Sbjct  64   LKKELDEIRQSEARIKAQMNALERSLDRTKTQQQNTQKNQ  103


> I6MGV1 MttA/Hcf106 family protein [Moraxella catarrhalis]
Length=178

 Score = 72.8 bits (177),  Expect = 7e-20
 Identities = 35/100 (35%), Positives = 63/100 (63%), Gaps = 0/100 (0%)

Query  3    NISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKRV  62
            N+ F EL  F IIALI+LGP+KLP   R++   Y        K+Q +I NEL L+E +++
Sbjct  4    NLGFFELTLFGIIALIVLGPDKLPVAARTLGRWYGMFHRASQKLQTEITNELQLLETQQM  63

Query  63   MQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTK  102
            +++EL +I+Q+E ++K Q+  +++ ++  +T     +K +
Sbjct  64   LKKELDEIRQSEARIKAQMNALERSLDRTKTQQQNTQKNQ  103


> F1XD70 TatB [Moraxella catarrhalis O35E]
Length=178

 Score = 72.8 bits (177),  Expect = 7e-20
 Identities = 35/100 (35%), Positives = 63/100 (63%), Gaps = 0/100 (0%)

Query  3    NISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELKRV  62
            N+ F EL  F IIALI+LGP+KLP   R++   Y        K+Q +I NEL L+E +++
Sbjct  4    NLGFFELTLFGIIALIVLGPDKLPVAARTLGRWYGMFHRASQKLQTEITNELQLLETQQM  63

Query  63   MQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTK  102
            +++EL +I+Q+E ++K Q+  +++ ++  +T     +K +
Sbjct  64   LKKELDEIRQSEARIKAQMNALERSLDRTKTQQQNTQKNQ  103


> A1YYZ8 Sec-independent protein translocase protein TatB [Xanthomonas 
oryzae pv. oryzae]
Length=213

 Score = 66.2 bits (160),  Expect = 2e-17
 Identities = 33/96 (34%), Positives = 56/96 (58%), Gaps = 0/96 (0%)

Query  1   MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
           MF+I  GEL   A++AL++LGPE+LP   R   L  R  + Q   ++ ++E EL+  ELK
Sbjct  1   MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQELERELEAEELK  60

Query  61  RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVS  96
           R +Q+    +++ E+QL+ +   ++Q    +   VS
Sbjct  61  RSLQDVQASLREAEDQLRNKQQQVEQGARALHDDVS  96


> A6N9K2 Sec-independent protein translocase protein TatB [Enterobacter 
cloacae]
Length=180

 Score = 60.8 bits (146),  Expect = 1e-15
 Identities = 36/108 (33%), Positives = 64/108 (59%), Gaps = 9/108 (8%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MF+I F ELL   +I LI+LGP++LP  +++V+   RA+++  S +QN++  EL L E  
Sbjct  1    MFDIGFSELLLVFVIGLIVLGPQRLPVAVKTVVGWVRALRSLASTVQNELAQELKLQE--  58

Query  61   RVMQEELQKIKQNE-----EQLKQQLALMQQEIENVQTSVSIERKTKA  103
               QE L+K+++        +LK  +  +++  E+++ S S+    KA
Sbjct  59   --FQESLKKVEKASMDNLTPELKASMDELREAAESMKRSYSVNDPEKA  104


> A0A0D8VEJ4 Sec-independent protein translocase protein TatB [Escherichia 
coli]
Length=171

 Score = 56.2 bits (134),  Expect = 4e-14
 Identities = 41/143 (29%), Positives = 74/143 (52%), Gaps = 12/143 (8%)

Query  1    MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
            MF+I F ELL   II L++LGP++LP  +++V    RA+++  + +QN++  EL L E  
Sbjct  1    MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQE--  58

Query  61   RVMQEELQKIKQNE-----EQLKQQLALMQQEIENVQTSVSIERKTKARRINDYIYTRSQ  115
               Q+ L+K+++        +LK  +  ++Q  E+++ S       KA   +D  +T   
Sbjct  59   --FQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVANDPEKA---SDEAHTIHN  113

Query  116  DELKTPFLAHFKTANKFSEDQAA  138
              +K    AH       ++ QA+
Sbjct  114  PVVKDNETAHEGVTPAAAQTQAS  136


> Q9AKS1 Sec-independent protein translocase protein TatB [Pseudomonas 
stutzeri]
Length=139

 Score = 54.3 bits (129),  Expect = 1e-13
 Identities = 28/81 (35%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query  1   MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
           MF+I F ELL   ++AL++LGPE+LP  +R   L    +K   + I+ ++E E+   E++
Sbjct  1   MFDIGFTELLLVGLVALMVLGPERLPGAVRPTGLWVGRLKRSFANIKAEVEREIGADEIR  60

Query  61  RVMQEELQKIKQNEEQLKQQL  81
           R +  E  +I   E ++KQ +
Sbjct  61  RQLHNE--RILDLEREMKQSI  79


> Q2PHA3 Twin-arginine translocase B [Myxococcus xanthus]
Length=182

 Score = 44.7 bits (104),  Expect = 7e-10
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 0/53 (0%)

Query  1   MFNISFGELLAFAIIALIILGPEKLPHTLRSVLLKYRAVKNQISKIQNDIENE  53
           MFNI  GE++   + AL+ILGP++LP   R +    R  + Q  +++N +E E
Sbjct  1   MFNIGAGEMVFILVAALLILGPQRLPELARGIGKFLREFRRQTDEVRNVVERE  53


> Q590L8 Preprotein translocase subunit TatB [Legionella pneumophila]
Length=89

 Score = 41.2 bits (95),  Expect = 4e-09
 Identities = 27/94 (29%), Positives = 47/94 (50%), Gaps = 8/94 (9%)

Query  4   ISFGELLAFAIIALIILGPEKLPHT---LRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
           +S GELL   I+A+I+ GP KLP     L  ++ K   +K   S       NE+ L+E +
Sbjct  1   MSLGELLLIFIVAIIVFGPSKLPMLATHLGMLVRKMNQLKEHTSSFWQQQLNEIQLLENQ  60

Query  61  RVMQEELQKIKQNEEQLKQQLALMQQEIENVQTS  94
           R  ++  ++ +Q + + K        ++EN + S
Sbjct  61  RKAEKADRQYQQTDSENKN-----SDDMENTRPS  89


> Q9AED7 Preprotein translocase subunit TatB [Legionella pneumophila]
Length=89

 Score = 39.7 bits (91),  Expect = 1e-08
 Identities = 24/76 (32%), Positives = 39/76 (51%), Gaps = 3/76 (4%)

Query  4   ISFGELLAFAIIALIILGPEKLPHT---LRSVLLKYRAVKNQISKIQNDIENELDLIELK  60
           +S GELL   I+A+I+ GP KLP     L  ++ K   +K   S       NE+ L E +
Sbjct  1   MSLGELLLVFIVAIIVFGPSKLPMLATHLGMLVRKLNQLKEHTSSFWQQQLNEIQLYENQ  60

Query  61  RVMQEELQKIKQNEEQ  76
           R  ++  Q+ +Q + +
Sbjct  61  RKAEKADQQYQQTDSE  76


> K9LW26 Synaptonemal complex protein ZYP1 [Hordeum vulgare subsp. 
vulgare]
Length=863

 Score = 41.2 bits (95),  Expect = 2e-08
 Identities = 25/78 (32%), Positives = 47/78 (60%), Gaps = 3/78 (4%)

Query  43   ISKIQNDIENELDLIELKRVMQEELQKIK-QNEEQLKQQLALMQQEIENVQTSVSIERKT  101
            +++IQ D  NEL    L+   +EELQ+I+ Q E +L+++L+L++QE E    +V+I  + 
Sbjct  626  VARIQQD--NELKESTLRAYHKEELQRIRSQGENELRERLSLLRQEHEAQIKTVNIRHED  683

Query  102  KARRINDYIYTRSQDELK  119
              +++ D +  +   E K
Sbjct  684  DCQKLQDELELQKSKEEK  701


 Score = 21.2 bits (43),  Expect = 0.14
 Identities = 15/75 (20%), Positives = 37/75 (49%), Gaps = 14/75 (19%)

Query  47   QNDIENELDLIELKRVMQEELQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTKARRI  106
            ++D +   D +EL++  +E             +Q AL+Q + + +  S  ++++  +++ 
Sbjct  682  EDDCQKLQDELELQKSKEE-------------KQRALLQLQWKVMGESQQVDQEVNSKKR  728

Query  107  NDYIYTRSQDELKTP  121
             D  Y R + +L+ P
Sbjct  729  RD-PYVRKESQLQLP  742


 Score = 20.0 bits (40),  Expect = 0.34
 Identities = 20/73 (27%), Positives = 32/73 (44%), Gaps = 9/73 (12%)

Query  44   SKIQNDIENELDLIELKRVMQEE-LQKIKQNEEQLKQQLALMQQEIENVQTSVSIERKTK  102
            S++Q  ++  L+   L    +EE LQK  + E   ++ L  MQ        SV  E+   
Sbjct  419  SELQGRVQKLLEDSSLAENQKEELLQKTLKLESDNQELLGRMQ--------SVLDEKSND  470

Query  103  ARRINDYIYTRSQ  115
            A  ++  I  R Q
Sbjct  471  AESLHSEIAKRDQ  483


 Score = 18.1 bits (35),  Expect = 1.5
 Identities = 10/35 (29%), Positives = 19/35 (54%), Gaps = 1/35 (3%)

Query  69   KIKQNEEQLKQQLALMQQEI-ENVQTSVSIERKTK  102
            K+++  EQ+    A +QQ + EN++  V     +K
Sbjct  72   KLRRATEQINMLEAKLQQAVNENMKLKVKQTEDSK  106


 Score = 18.1 bits (35),  Expect = 1.5
 Identities = 11/47 (23%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query  51   ENELDLIELKRVMQEELQKIKQNEEQL---KQQLALMQQEIENVQTS  94
            +N   L E   ++ +   K++  E+ +   KQ++  ++QE E +  S
Sbjct  152  KNSKALDEFNCLLHDSSAKLECAEQSITSGKQEILRIKQEKEEMDQS  198


 Score = 17.7 bits (34),  Expect = 1.9
 Identities = 6/19 (32%), Positives = 11/19 (58%), Gaps = 0/19 (0%)

Query  85   QQEIENVQTSVSIERKTKA  103
            + E+E     ++  RKTK+
Sbjct  787  EYEVETANGKITKRRKTKS  805


 Score = 16.9 bits (32),  Expect = 3.4
 Identities = 7/20 (35%), Positives = 13/20 (65%), Gaps = 0/20 (0%)

Query  58   ELKRVMQEELQKIKQNEEQL  77
            E+ R+ QE+ +  +  +EQL
Sbjct  184  EILRIKQEKEEMDQSYKEQL  203



Lambda      K        H        a         alpha
   0.322    0.136    0.357    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 344556


  Database: 792bbed75e04d0666fb470b36f659d4d.TrEMBL.fasta
    Posted date:  Sep 25, 2020  11:53 AM
  Number of letters in database: 4,266
  Number of sequences in database:  24



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40